| Basic Information | |
|---|---|
| Family ID | F043498 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCN |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.31 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 83.97 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 3.21 |
| PF07498 | Rho_N | 1.92 |
| PF00128 | Alpha-amylase | 1.92 |
| PF07589 | PEP-CTERM | 1.92 |
| PF00753 | Lactamase_B | 1.92 |
| PF13517 | FG-GAP_3 | 1.28 |
| PF04072 | LCM | 1.28 |
| PF04191 | PEMT | 1.28 |
| PF07238 | PilZ | 1.28 |
| PF07228 | SpoIIE | 1.28 |
| PF13432 | TPR_16 | 1.28 |
| PF13561 | adh_short_C2 | 1.28 |
| PF08818 | DUF1801 | 1.28 |
| PF00072 | Response_reg | 1.28 |
| PF09206 | ArabFuran-catal | 0.64 |
| PF12840 | HTH_20 | 0.64 |
| PF00905 | Transpeptidase | 0.64 |
| PF06739 | SBBP | 0.64 |
| PF13358 | DDE_3 | 0.64 |
| PF12762 | DDE_Tnp_IS1595 | 0.64 |
| PF07719 | TPR_2 | 0.64 |
| PF07676 | PD40 | 0.64 |
| PF00593 | TonB_dep_Rec | 0.64 |
| PF01261 | AP_endonuc_2 | 0.64 |
| PF10026 | DUF2268 | 0.64 |
| PF00158 | Sigma54_activat | 0.64 |
| PF01988 | VIT1 | 0.64 |
| PF13231 | PMT_2 | 0.64 |
| PF10056 | DUF2293 | 0.64 |
| PF07593 | UnbV_ASPIC | 0.64 |
| PF01047 | MarR | 0.64 |
| PF00782 | DSPc | 0.64 |
| PF02021 | UPF0102 | 0.64 |
| PF01476 | LysM | 0.64 |
| PF13365 | Trypsin_2 | 0.64 |
| PF12698 | ABC2_membrane_3 | 0.64 |
| PF03466 | LysR_substrate | 0.64 |
| PF03544 | TonB_C | 0.64 |
| PF00756 | Esterase | 0.64 |
| PF07635 | PSCyt1 | 0.64 |
| PF03795 | YCII | 0.64 |
| PF00232 | Glyco_hydro_1 | 0.64 |
| PF12680 | SnoaL_2 | 0.64 |
| PF01641 | SelR | 0.64 |
| PF01593 | Amino_oxidase | 0.64 |
| PF14246 | TetR_C_7 | 0.64 |
| PF00535 | Glycos_transf_2 | 0.64 |
| PF07885 | Ion_trans_2 | 0.64 |
| PF13620 | CarboxypepD_reg | 0.64 |
| PF13641 | Glyco_tranf_2_3 | 0.64 |
| PF13701 | DDE_Tnp_1_4 | 0.64 |
| PF00959 | Phage_lysozyme | 0.64 |
| PF09844 | DUF2071 | 0.64 |
| PF02371 | Transposase_20 | 0.64 |
| PF02954 | HTH_8 | 0.64 |
| PF12848 | ABC_tran_Xtn | 0.64 |
| PF00890 | FAD_binding_2 | 0.64 |
| PF00005 | ABC_tran | 0.64 |
| PF06719 | AraC_N | 0.64 |
| PF13414 | TPR_11 | 0.64 |
| PF06475 | Glycolipid_bind | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.92 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.92 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.92 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 1.92 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.28 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.28 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.28 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.28 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.64 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.64 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.64 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.64 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
| COG3554 | Uncharacterized conserved protein | Function unknown [S] | 0.64 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG4977 | Transcriptional regulator GlxA, contains an amidase domain and an AraC-type DNA-binding HTH domain | Transcription [K] | 0.64 |
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.64 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10120040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1309 | Open in IMG/M |
| 3300004080|Ga0062385_10807159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300004092|Ga0062389_101411671 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300004092|Ga0062389_104318795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 535 | Open in IMG/M |
| 3300004156|Ga0062589_100451023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300005454|Ga0066687_10830939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 550 | Open in IMG/M |
| 3300005471|Ga0070698_101272441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300005541|Ga0070733_10795416 | Not Available | 635 | Open in IMG/M |
| 3300005602|Ga0070762_10853177 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005602|Ga0070762_10895621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 604 | Open in IMG/M |
| 3300005713|Ga0066905_100997377 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005713|Ga0066905_101402993 | Not Available | 632 | Open in IMG/M |
| 3300005764|Ga0066903_104879159 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005764|Ga0066903_106188327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300005921|Ga0070766_10980923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300006176|Ga0070765_101853243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300006358|Ga0068871_101653752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 607 | Open in IMG/M |
| 3300009143|Ga0099792_11217147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 511 | Open in IMG/M |
| 3300009176|Ga0105242_13008862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 522 | Open in IMG/M |
| 3300009633|Ga0116129_1247402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 505 | Open in IMG/M |
| 3300009644|Ga0116121_1155719 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300009665|Ga0116135_1490132 | Not Available | 509 | Open in IMG/M |
| 3300009792|Ga0126374_10842497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300010046|Ga0126384_10761558 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300010046|Ga0126384_12438504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300010047|Ga0126382_11681087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300010048|Ga0126373_10373171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1445 | Open in IMG/M |
| 3300010048|Ga0126373_10631198 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300010048|Ga0126373_12880873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300010360|Ga0126372_12609158 | Not Available | 557 | Open in IMG/M |
| 3300010361|Ga0126378_10027744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5019 | Open in IMG/M |
| 3300010366|Ga0126379_10466406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1327 | Open in IMG/M |
| 3300010376|Ga0126381_100124365 | Not Available | 3344 | Open in IMG/M |
| 3300010398|Ga0126383_10483091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1294 | Open in IMG/M |
| 3300010398|Ga0126383_11124006 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010403|Ga0134123_10820401 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300011120|Ga0150983_16407055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 623 | Open in IMG/M |
| 3300011270|Ga0137391_10132585 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
| 3300011270|Ga0137391_10472926 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300012200|Ga0137382_10684791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300012361|Ga0137360_11755811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 526 | Open in IMG/M |
| 3300012924|Ga0137413_11323795 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012929|Ga0137404_10103635 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300012971|Ga0126369_11324663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 810 | Open in IMG/M |
| 3300012971|Ga0126369_12044467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. 4M-Z18 | 661 | Open in IMG/M |
| 3300012971|Ga0126369_12984335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 554 | Open in IMG/M |
| 3300012989|Ga0164305_11845470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 547 | Open in IMG/M |
| 3300014160|Ga0181517_10379934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 728 | Open in IMG/M |
| 3300014162|Ga0181538_10395851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 737 | Open in IMG/M |
| 3300014495|Ga0182015_10461251 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300014501|Ga0182024_12115233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 619 | Open in IMG/M |
| 3300014654|Ga0181525_10192113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
| 3300014657|Ga0181522_10016346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4010 | Open in IMG/M |
| 3300014969|Ga0157376_10745059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 988 | Open in IMG/M |
| 3300015242|Ga0137412_10005204 | All Organisms → cellular organisms → Bacteria | 10409 | Open in IMG/M |
| 3300015242|Ga0137412_10013964 | All Organisms → cellular organisms → Bacteria | 6499 | Open in IMG/M |
| 3300015264|Ga0137403_10238649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1733 | Open in IMG/M |
| 3300015374|Ga0132255_102765141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300016341|Ga0182035_11071971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 716 | Open in IMG/M |
| 3300016341|Ga0182035_11303044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300016357|Ga0182032_10411510 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300016371|Ga0182034_10086373 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300016404|Ga0182037_10405847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300016404|Ga0182037_11247585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300017955|Ga0187817_10400071 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300017988|Ga0181520_10692114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 697 | Open in IMG/M |
| 3300018012|Ga0187810_10279163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
| 3300018024|Ga0187881_10403258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 560 | Open in IMG/M |
| 3300018040|Ga0187862_10889610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 510 | Open in IMG/M |
| 3300018043|Ga0187887_10006798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 8149 | Open in IMG/M |
| 3300019786|Ga0182025_1324394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2777 | Open in IMG/M |
| 3300020579|Ga0210407_10002520 | All Organisms → cellular organisms → Bacteria | 15669 | Open in IMG/M |
| 3300020579|Ga0210407_11404581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 518 | Open in IMG/M |
| 3300020580|Ga0210403_10731978 | Not Available | 790 | Open in IMG/M |
| 3300020580|Ga0210403_11023373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300020581|Ga0210399_10160894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1859 | Open in IMG/M |
| 3300020581|Ga0210399_10890023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 722 | Open in IMG/M |
| 3300021168|Ga0210406_10031549 | All Organisms → cellular organisms → Bacteria | 4783 | Open in IMG/M |
| 3300021168|Ga0210406_10197257 | Not Available | 1670 | Open in IMG/M |
| 3300021178|Ga0210408_10043862 | All Organisms → cellular organisms → Bacteria | 3504 | Open in IMG/M |
| 3300021180|Ga0210396_10733808 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300021180|Ga0210396_10900412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300021180|Ga0210396_10969972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 721 | Open in IMG/M |
| 3300021180|Ga0210396_11546061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300021401|Ga0210393_10040301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3666 | Open in IMG/M |
| 3300021404|Ga0210389_10292501 | Not Available | 1276 | Open in IMG/M |
| 3300021405|Ga0210387_10199290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1736 | Open in IMG/M |
| 3300021405|Ga0210387_10406751 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300021407|Ga0210383_10088626 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
| 3300021407|Ga0210383_11362912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 591 | Open in IMG/M |
| 3300021420|Ga0210394_10348340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300021420|Ga0210394_11739202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300021432|Ga0210384_10927602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300021432|Ga0210384_11065822 | Not Available | 711 | Open in IMG/M |
| 3300021433|Ga0210391_10944167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300021475|Ga0210392_10002535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 9390 | Open in IMG/M |
| 3300021475|Ga0210392_10547447 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 855 | Open in IMG/M |
| 3300021477|Ga0210398_10059774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3115 | Open in IMG/M |
| 3300021477|Ga0210398_10245648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300021477|Ga0210398_10632644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300021559|Ga0210409_11085850 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300022709|Ga0222756_1030742 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300022722|Ga0242657_1192885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 559 | Open in IMG/M |
| 3300024271|Ga0224564_1009773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1596 | Open in IMG/M |
| 3300024288|Ga0179589_10624800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 506 | Open in IMG/M |
| 3300025905|Ga0207685_10293396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 802 | Open in IMG/M |
| 3300025949|Ga0207667_12064191 | Not Available | 529 | Open in IMG/M |
| 3300026035|Ga0207703_10250938 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300026446|Ga0257178_1039814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 600 | Open in IMG/M |
| 3300027049|Ga0207806_1014525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 934 | Open in IMG/M |
| 3300027663|Ga0208990_1031275 | Not Available | 1687 | Open in IMG/M |
| 3300027829|Ga0209773_10271337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thioploca → Thioploca ingrica | 708 | Open in IMG/M |
| 3300027853|Ga0209274_10468581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 652 | Open in IMG/M |
| 3300027867|Ga0209167_10188115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300027895|Ga0209624_10209134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1296 | Open in IMG/M |
| 3300028015|Ga0265353_1029104 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028759|Ga0302224_10427194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 539 | Open in IMG/M |
| 3300029636|Ga0222749_10162778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300029910|Ga0311369_10601921 | Not Available | 917 | Open in IMG/M |
| 3300029910|Ga0311369_11467055 | Not Available | 513 | Open in IMG/M |
| 3300029915|Ga0311358_11197669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300029999|Ga0311339_10242821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1989 | Open in IMG/M |
| 3300029999|Ga0311339_10654002 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300030053|Ga0302177_10071161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2059 | Open in IMG/M |
| 3300030503|Ga0311370_10691783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1199 | Open in IMG/M |
| 3300030580|Ga0311355_10464237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1223 | Open in IMG/M |
| 3300030580|Ga0311355_11587780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300031231|Ga0170824_124141931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 556 | Open in IMG/M |
| 3300031234|Ga0302325_11138145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1046 | Open in IMG/M |
| 3300031234|Ga0302325_13001466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300031236|Ga0302324_100723400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 1400 | Open in IMG/M |
| 3300031525|Ga0302326_13110359 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031543|Ga0318516_10381524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 813 | Open in IMG/M |
| 3300031564|Ga0318573_10036920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2322 | Open in IMG/M |
| 3300031708|Ga0310686_100896015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 704 | Open in IMG/M |
| 3300031708|Ga0310686_106237774 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300031708|Ga0310686_113671988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4630 | Open in IMG/M |
| 3300031708|Ga0310686_114688823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 625 | Open in IMG/M |
| 3300031708|Ga0310686_116328131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1884 | Open in IMG/M |
| 3300031718|Ga0307474_11522752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031720|Ga0307469_10625396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 966 | Open in IMG/M |
| 3300031945|Ga0310913_10857938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300031962|Ga0307479_10056286 | All Organisms → cellular organisms → Bacteria | 3788 | Open in IMG/M |
| 3300032059|Ga0318533_10857641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 666 | Open in IMG/M |
| 3300032067|Ga0318524_10087332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
| 3300032076|Ga0306924_10185839 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300032076|Ga0306924_10734125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300032076|Ga0306924_10852869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300032160|Ga0311301_10009029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 32549 | Open in IMG/M |
| 3300032805|Ga0335078_11428841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 779 | Open in IMG/M |
| 3300032828|Ga0335080_10101589 | All Organisms → cellular organisms → Bacteria | 3191 | Open in IMG/M |
| 3300032895|Ga0335074_10278517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1935 | Open in IMG/M |
| 3300032898|Ga0335072_10926322 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300032898|Ga0335072_11668972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300033513|Ga0316628_101479212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 905 | Open in IMG/M |
| 3300034163|Ga0370515_0435203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.21% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.28% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.28% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.64% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.64% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.64% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_101200401 | 3300004080 | Bog Forest Soil | MNAKVSGRESLNGAAEPGRDLLEMDVFDGTKSVRAKNRCNASRL |
| Ga0062385_108071591 | 3300004080 | Bog Forest Soil | MNAKVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLETAD |
| Ga0062389_1014116711 | 3300004092 | Bog Forest Soil | MNAKVSGRESLNGAAEPGRDLLEMDVFDGTKSVRAKNRCNA |
| Ga0062389_1043187952 | 3300004092 | Bog Forest Soil | VFSVDNMKASLSGRESLNGAAESGRDLLEIDVFDSTKSVRAK |
| Ga0062589_1004510232 | 3300004156 | Soil | MLRMNHMKTSLAGREPFDAAAEPGPDLPEIDVFDVTKSVRAKNRR |
| Ga0066687_108309391 | 3300005454 | Soil | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKFVRAKNRCN |
| Ga0070698_1012724411 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VFSVDNMNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKN |
| Ga0070733_107954162 | 3300005541 | Surface Soil | MDNVHTKVPGRESLNGAAEPGSNLLEIDVFDGTKS |
| Ga0070762_108531772 | 3300005602 | Soil | MNAKVSGRESLDAATEPGRDLLEIDVFDGAKSVRAK |
| Ga0070762_108956212 | 3300005602 | Soil | VLSVDNMNTSVSGRESLNGAAEPGRDLLEIDVFDGTKS |
| Ga0066905_1009973771 | 3300005713 | Tropical Forest Soil | VLSVDNMKTSLSGREPLNGAAEPGPNLLEIDVFDVTESVRTKN |
| Ga0066905_1014029932 | 3300005713 | Tropical Forest Soil | MKTSLSGREPLNGAAEPGRNLLEIDVFDVTESVRTKNRCN |
| Ga0066903_1048791592 | 3300005764 | Tropical Forest Soil | VDNMKTKLSGCESLDGVAEPGRDLLEIDVFDVTESVRAK |
| Ga0066903_1061883272 | 3300005764 | Tropical Forest Soil | VLSVYNMKPSLSGRESLNDMAESGRDLLEIDVFDVRKSVRAKNR |
| Ga0070766_109809231 | 3300005921 | Soil | VLSVDNMNTKVSGRESLNGAAEPGCDLLEIDVFDGTKSVRAKNR |
| Ga0070765_1018532431 | 3300006176 | Soil | MPERPRRESLNGATEPGFHFLEVDVLDVGKSVRAKSRCNASRLET |
| Ga0068871_1016537522 | 3300006358 | Miscanthus Rhizosphere | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKN |
| Ga0099792_112171472 | 3300009143 | Vadose Zone Soil | MNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASR |
| Ga0105242_130088622 | 3300009176 | Miscanthus Rhizosphere | MNGSVAGRESLNGVAEPGHDLLEIDVFDGTKSVRAKN |
| Ga0116129_12474022 | 3300009633 | Peatland | MNASVSGRESLNGAAEPGRDLLEIDVLDGTKSVRAKNRRNARRFEAA |
| Ga0116121_11557192 | 3300009644 | Peatland | MKAGVAGRESLNGAAEPGRDFLEIDVFDGTKSVRAKNRCNA |
| Ga0116135_14901322 | 3300009665 | Peatland | MLSVDNMSAGVPWREPLNGAAEPGCDLLEIDVFDGTK |
| Ga0126374_108424972 | 3300009792 | Tropical Forest Soil | MLRMDDMNARLSRREPLNVAAELGRDLLEAEIFDIPKSVRAKNRSN |
| Ga0126384_107615583 | 3300010046 | Tropical Forest Soil | VLSVDNMKTSLSGREPLNGAAEPGPNLLEIDVFDVT |
| Ga0126384_124385041 | 3300010046 | Tropical Forest Soil | MKTSLSGRESLNGAAEPGPDLLEIDVFDVTKSVRVKNRCNASRLETA |
| Ga0126382_116810871 | 3300010047 | Tropical Forest Soil | MKTSLSGREPLNGLAESGSDLLEIDVLDVAESVRAKNRFNASRLETA |
| Ga0126373_103731713 | 3300010048 | Tropical Forest Soil | VLSVDNMNTKVSGCESLNLAPEPGRDLLEIDVFDGTKAVRA |
| Ga0126373_106311982 | 3300010048 | Tropical Forest Soil | MKTSLSGREPMNGVAEPGPDLLEIDVFDVTESVRAKNRGNASRLETAGPTF |
| Ga0126373_128808731 | 3300010048 | Tropical Forest Soil | MKPSLFVREPLNGAAEPGSDLLEIDVFDVTKSVRA |
| Ga0126372_126091581 | 3300010360 | Tropical Forest Soil | MKTSLSGRQPLNSVAESGPDLQEINVFDIRKPVRAKNR |
| Ga0126378_100277448 | 3300010361 | Tropical Forest Soil | MKTSLSGREPLNGATEPGRDLLEIDVFDVRESVRAKNRCNAS |
| Ga0126379_104664062 | 3300010366 | Tropical Forest Soil | MKTSLSWREPLNGAAEPGLDLLEIDVFDVTKSVRAKNRCNASR |
| Ga0126381_1001243651 | 3300010376 | Tropical Forest Soil | MDDMNAGLSCRESLNVTAEPGRDLLETDIFDVTKSVRAKNR |
| Ga0126383_104830911 | 3300010398 | Tropical Forest Soil | MKTSLSGREPLNGAAEPGRDLLEIDVFDVRKSVRA |
| Ga0126383_111240062 | 3300010398 | Tropical Forest Soil | MKSSLFGRREPLNCVAEPGPDLLEIDVFDFMKSVRAKNRSNASRLE |
| Ga0134123_108204013 | 3300010403 | Terrestrial Soil | MNASVSGRESLNGAAELGRDLLEIDVFDGTKSVRAKNRC |
| Ga0150983_164070551 | 3300011120 | Forest Soil | MNASVSGRESLNGAAEPGRDLLEIDVFDGAKSVRAKNRCNAVRLEA |
| Ga0137391_101325853 | 3300011270 | Vadose Zone Soil | MNTKVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLE |
| Ga0137391_104729262 | 3300011270 | Vadose Zone Soil | MKASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLE |
| Ga0137382_106847912 | 3300012200 | Vadose Zone Soil | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLEMA |
| Ga0137360_117558112 | 3300012361 | Vadose Zone Soil | MNASVSWRESLNGAAESGRDLLEIDVFDGTKSVRAKNRCNASRL |
| Ga0137413_113237952 | 3300012924 | Vadose Zone Soil | MNASVSGRESLNGAAESGRDLLEIDVYDGTKSVRTKNRCNASRL |
| Ga0137404_101036353 | 3300012929 | Vadose Zone Soil | MNTKVSGRESLNGAAEPGRDLMEIDVFDGTKSVRVKNRCNA |
| Ga0126369_113246633 | 3300012971 | Tropical Forest Soil | MKTSLSGREPLNGAAEPRRDLLEIDVFDVTKSVRAKNRCNAS |
| Ga0126369_120444672 | 3300012971 | Tropical Forest Soil | MKTSLSGREPLNGAAEPGLDLLEIDVFDFRKPVRA |
| Ga0126369_129843351 | 3300012971 | Tropical Forest Soil | MKTSMSRREPLNGAAEPGRDFLEIDVFDVTESVRTKNRCNASRLET |
| Ga0164305_118454701 | 3300012989 | Soil | MFSVNNMNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCN |
| Ga0181517_103799342 | 3300014160 | Bog | MNDPIQLLLGVDNMKTSVSGRESLNGAAEPGRDFLEIEVFDLTK |
| Ga0181538_103958512 | 3300014162 | Bog | MDNMNASVSGRESLNGAAEAGRDLLEIDVFDGTKSVRAKNRCNASRLETADR |
| Ga0182015_104612513 | 3300014495 | Palsa | MNAGVSGRESLNGSAEPGRDLLEIDVFDGTKSVRAKNRCNA |
| Ga0182024_121152332 | 3300014501 | Permafrost | MNAKLSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLE |
| Ga0181525_101921131 | 3300014654 | Bog | MNTSVSGRESLNGAVEPGRDLLEIDVFDGTKSVRAKNRCNASRLETAD |
| Ga0181522_100163461 | 3300014657 | Bog | MKASVSGRESLNGVAEPGRDLLEIDVFEVAKSVRAKNRCNAG |
| Ga0157376_107450592 | 3300014969 | Miscanthus Rhizosphere | MNASVSGRESFNGAAEPGRDLLEIDVFDGTKSVRAKIRRNASRLETAD |
| Ga0137412_1000520413 | 3300015242 | Vadose Zone Soil | MSTSMSGRESLNGAAEPGCDLLEIDVFDGTKSVRAKNRCNASRL |
| Ga0137412_100139648 | 3300015242 | Vadose Zone Soil | MNTKVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRL |
| Ga0137403_102386494 | 3300015264 | Vadose Zone Soil | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRL |
| Ga0132255_1027651412 | 3300015374 | Arabidopsis Rhizosphere | MNTSVSGSESLNGAAELGRDLLESDVFDGTKSVRA |
| Ga0182035_110719712 | 3300016341 | Soil | MKTGLSRREPLNGAAEPGLDLLEIDVFDVRESVRAKNRCNASRLETA |
| Ga0182035_113030441 | 3300016341 | Soil | VDNMKTSLYEREPLNGTAEPGRDLLVIDVFDVRRSVRAKKRCNACR |
| Ga0182032_104115101 | 3300016357 | Soil | VLSVDNMKTSLSGREPLNGAAEPGRDLLEIDVFDV |
| Ga0182034_100863731 | 3300016371 | Soil | VLSVDNMKTSLSGREPLNGAAEPGRDLLEIDVFDVTKS |
| Ga0182037_104058472 | 3300016404 | Soil | VDNMKTSLYEREPLNGTAEPGRDLLVIDVFDVRKSV |
| Ga0182037_112475851 | 3300016404 | Soil | MDHMKTSLCGREPLNAAAEPGPDLLEIDVFDARKSVGAQNR |
| Ga0187817_104000712 | 3300017955 | Freshwater Sediment | VLSVDNMDASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRA |
| Ga0181520_106921142 | 3300017988 | Bog | MKASVSGREPLNGAAEPGRDLLEIDVFDFRESVQAKNRCHASRLE |
| Ga0187810_102791631 | 3300018012 | Freshwater Sediment | MDNMSAKVPGREPLNGGAEPGRDLLETDVFDGTKSVRAKNRCHA |
| Ga0187881_104032581 | 3300018024 | Peatland | VVGVDNMKTSLSGSESLNGAAEPGRDLLEIDVFDGAKSVRAKNRCNA |
| Ga0187862_108896101 | 3300018040 | Peatland | MNASVSGRESLNGAAEAGRDLLEIDVFDGTKSVRAKNRCNGS |
| Ga0187887_100067981 | 3300018043 | Peatland | MDAKLSGREPSDGAAEPGPDLLEINIFDVRESVRAKNRWNASR |
| Ga0182025_13243944 | 3300019786 | Permafrost | MNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLETAD |
| Ga0210407_1000252015 | 3300020579 | Soil | VLSVDNMNTKVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLET |
| Ga0210407_114045811 | 3300020579 | Soil | MNASVFWRESLNGAAEPGRDLLEIDVFDRTESVRAKNRSKCQPARNG |
| Ga0210403_107319782 | 3300020580 | Soil | MNARVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKYRCNASRLETAVGGDYLI |
| Ga0210403_110233731 | 3300020580 | Soil | MNASVSGRESLNGVAEPGRDLPEMDVFDGTKSVRAKN |
| Ga0210399_101608943 | 3300020581 | Soil | MNTSVSGSESLNGAAEPGRDLLEIDVFDGTKSVRAKN |
| Ga0210399_108900233 | 3300020581 | Soil | MNASVSGSESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRLETA |
| Ga0210406_100315491 | 3300021168 | Soil | VLSVDNMNTSMSGRESLNGAAEPGRDLLEIDVFDGTKS |
| Ga0210406_101972572 | 3300021168 | Soil | MNASVSGSESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASR |
| Ga0210408_100438627 | 3300021178 | Soil | MLSVDNMNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKN |
| Ga0210396_107338081 | 3300021180 | Soil | MNASVSGRESLNGAAEFGRDLLETDVFDGTKSVRAKNRCYASRLETAVR |
| Ga0210396_109004121 | 3300021180 | Soil | MYAKVSGRESLDGVAEPGRDLLEIDVFDGTKSVRAKNRRNASRLE |
| Ga0210396_109699721 | 3300021180 | Soil | MNASVSGRESLNGVAKPGRDLLEIDVFDGTKSVRA |
| Ga0210396_115460611 | 3300021180 | Soil | VLSVDNMNACVSWRESLNGVAEPGCDLLEIDVFDSNKSV |
| Ga0210393_100403016 | 3300021401 | Soil | MNTCVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAEDRCNASRIET |
| Ga0210389_102925012 | 3300021404 | Soil | MKTSVSGSEPLNGAAEPGRDLLEIDVFDGTKSVRAKNRCHAGRL |
| Ga0210387_101992903 | 3300021405 | Soil | VFSVDNMNAKVSGRESLNGATEPGRDLLEIDVFDGTKSVRAKNRRNAGGLETA |
| Ga0210387_104067511 | 3300021405 | Soil | MNAKVSGRKSLNGGAEPGRDLLEIDVFDGTKSVRAKNR |
| Ga0210383_100886265 | 3300021407 | Soil | MLSVDNMNAKVSGRESLNGVAKPGRDLPEMDVFDGTKSVRAKNRCN |
| Ga0210383_113629121 | 3300021407 | Soil | VDNMKAGESGRESLNGAAEPGRDLLETDVFDGTKSVRAKNRCHASRLETAV |
| Ga0210394_103483403 | 3300021420 | Soil | VLSVDNMNARVSGRESLNGTAEPARDFLEIDVFDGTKSMRAKNRCNA |
| Ga0210394_117392021 | 3300021420 | Soil | VLSVDNMNTRVSGRESLNGAAEPGRDLPEIDVFDG |
| Ga0210384_109276023 | 3300021432 | Soil | VLSVDNMNASVSWRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCN |
| Ga0210384_110658221 | 3300021432 | Soil | MNASVSGREPLNGAAKPVRDLLEIDVFDGTKSVRA |
| Ga0210391_109441671 | 3300021433 | Soil | VLGVDNMNASVSGRESLNGAAEPGRDFLETDVFDGTKSVRAK |
| Ga0210392_100025351 | 3300021475 | Soil | ESLNGAAEPGRDLLEIDVFDGTKSVRAKYRCNASRLETAVGGDYLI |
| Ga0210392_105474472 | 3300021475 | Soil | MNARVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKYR |
| Ga0210398_100597744 | 3300021477 | Soil | VLSVDNMNTSVSGRESLNGAAEPGRDLLEIDVFDGTK |
| Ga0210398_102456483 | 3300021477 | Soil | MLSVDNMNAKASWRESLNGVAEPGRDLPEMDVFDGTKSV |
| Ga0210398_106326441 | 3300021477 | Soil | VLSVDNVNASVSGREPLNGAAEPGPDLLEIDVFDVTKSVGAKNRCHASRL |
| Ga0210409_110858501 | 3300021559 | Soil | MNAKVSGRKSLNGGAEPGRDLLEIDVFDGTKSVRAKNRRNASGLETADR |
| Ga0222756_10307422 | 3300022709 | Soil | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNR |
| Ga0242657_11928852 | 3300022722 | Soil | VLSVDDMNAKVSGRKPLNGVAEPGRDLLEIDVFDGSKSVRAKNRCHASRLETADR |
| Ga0224564_10097731 | 3300024271 | Soil | MNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSARAKNRCNASRLETADR |
| Ga0179589_106248001 | 3300024288 | Vadose Zone Soil | MNTKVSGRESLNGAAEPRRDLLEIDVFDGTKSVRVKNRCNAS |
| Ga0207685_102933963 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSVDNMNASVSGRESLNGAAEPGRDLLEMDVFDGTKSVRAKN |
| Ga0207667_120641912 | 3300025949 | Corn Rhizosphere | MNANVPGSESLNGMAEPGRDRLEAEVFDGTESVRAKNLRHAVR |
| Ga0207703_102509382 | 3300026035 | Switchgrass Rhizosphere | VLSVDNMNGSVAGRESLNGVAEPGHDLLEIDVFDGT |
| Ga0257178_10398141 | 3300026446 | Soil | VLSVDNMNTKVSGRESLNGAAEPGRDLLEIDVFDGTKSVRVK |
| Ga0207806_10145251 | 3300027049 | Tropical Forest Soil | VLSVDNMKTSLSGREPLNGAAEPGRDLLEIDVFDVRKSVRAKNRCNASRLETA |
| Ga0208990_10312751 | 3300027663 | Forest Soil | MNTKVSGRESLNGAAEPGRDLLEIDVFDGTKSVRVKNRCNASRLET |
| Ga0209773_102713371 | 3300027829 | Bog Forest Soil | MNGRVSGRESLNGAAEPGHDLLEIEVFNVRKSVRAKNPRNASRL |
| Ga0209274_104685812 | 3300027853 | Soil | MLVLCVDNMKASVSGRESLHGAAEPGRDLLEIDVFDGTK |
| Ga0209167_101881153 | 3300027867 | Surface Soil | VLSVDNMNAKVSGRESLNGAAESGGDLLEMDVFDG |
| Ga0209624_102091343 | 3300027895 | Forest Soil | MKASVSGRESLNGAAVFGRDLLEIDVFDGTESVRMKNCCNASRLET |
| Ga0265353_10291042 | 3300028015 | Soil | MDNMNAKVSRRESLNGAAEPGRDLLETDVFDGAKSVRAKNRSN |
| Ga0302224_104271942 | 3300028759 | Palsa | MNAGVSGRESLNAAAEPGHDLLEIDVFDGTKSVRTKHRCNARRIETAVHT |
| Ga0222749_101627781 | 3300029636 | Soil | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCN |
| Ga0311369_106019211 | 3300029910 | Palsa | MKTSLSGREPLNGAAEPGPDLLEIDVFDVTKSVRAKNRCDASRLETAGP |
| Ga0311369_114670552 | 3300029910 | Palsa | VLSVDNMNAGVSGRESLNGAPEPGRNLLEIDVFDGTKSVRAKNRCN |
| Ga0311358_111976692 | 3300029915 | Bog | VLGVDDMKASVPGRESLNAAPEPGPDLLEIDVFEVAKSV |
| Ga0311339_102428211 | 3300029999 | Palsa | VLSVDNMNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCN |
| Ga0311339_106540021 | 3300029999 | Palsa | MLSVGNMNASMSGCQSLNGVADPGRDLLEIDVFDGTKSVRAKNRCNAS |
| Ga0302177_100711611 | 3300030053 | Palsa | MKTSLSGSEPLNGVAEPGLDLLEMDVFDVRKSVRAKNRCNARRLETAGP |
| Ga0311370_106917831 | 3300030503 | Palsa | VLSVDNMNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAK |
| Ga0311355_104642371 | 3300030580 | Palsa | VLSVDNMNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNAS |
| Ga0311355_115877802 | 3300030580 | Palsa | MNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCHASR |
| Ga0170824_1241419311 | 3300031231 | Forest Soil | MLSVDNMNTKVSGRESLNGAAEPGGDLLEIDVFDDIKSVRAKNRCNASRL |
| Ga0302325_111381451 | 3300031234 | Palsa | MNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRL |
| Ga0302325_130014662 | 3300031234 | Palsa | VLSVDNMNASVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKNRCNASRL |
| Ga0302324_1007234001 | 3300031236 | Palsa | MNASVSGRESLNGVAEPGRDLLEIDVFDGTKSVRAKNRCNA |
| Ga0302326_131103591 | 3300031525 | Palsa | MKTSVSGRKSLNGTAEPGLDLLERDVFDGRKPVRAKPLSNTT |
| Ga0318516_103815241 | 3300031543 | Soil | VLSVDNMKTGLSGREPLYEAAEPGLDLLEIDVFDVRESVR |
| Ga0318573_100369203 | 3300031564 | Soil | VLRVNNMKTRLSGREPLNGAAEPGLYLLETDVFDLAK |
| Ga0310686_1008960151 | 3300031708 | Soil | MSAKVSGRETLNSVAKPGRNLLEIDVFDGTKSVRAKNRCNAGRLETG |
| Ga0310686_1062377743 | 3300031708 | Soil | MLSVGNMNASMSGCQSLNGVAEPGRDLLEIDVFDGTKSVRAK |
| Ga0310686_1136719883 | 3300031708 | Soil | MNASVSGRETLNGAAEPGRDLLEIDVFDGTKSVRAK |
| Ga0310686_1146888231 | 3300031708 | Soil | MLSVDNMKTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVR |
| Ga0310686_1163281312 | 3300031708 | Soil | MNAKVSGCESLNGAAEPGRDFLEIDVLDGTQSVRAKNRCNASRLELVSERSPIFLSC |
| Ga0307474_115227521 | 3300031718 | Hardwood Forest Soil | VDNMKASVSGHESLNGVAESRCDLLKIDVFDGFKS |
| Ga0307469_106253962 | 3300031720 | Hardwood Forest Soil | MNTSVSGRESLNGAAEPGRDLLEIDVFDDTKSVRAKNRCNASRL |
| Ga0310913_108579381 | 3300031945 | Soil | VDNMKTSLYEREPLNGTAEPGRDLLVIDVFDVRKSVRAKNRCH |
| Ga0307479_100562867 | 3300031962 | Hardwood Forest Soil | VLSVDNMNASVSWRESLNGAAEPGRDLLETDVFDGTKSV |
| Ga0318533_108576411 | 3300032059 | Soil | VLSVDNMNAKVSGRESLNGASESGRDLLEIDVFDGTKSV |
| Ga0318524_100873323 | 3300032067 | Soil | VLRVNNMKTRLSGREPLNGAAEPGLYLLETDVFDLAKTERAKNRCN |
| Ga0306924_101858393 | 3300032076 | Soil | VLSVDNMKTSLSGREPLNGAAEPGRDLLEIDVFDLTKS |
| Ga0306924_107341251 | 3300032076 | Soil | MKTSLSGREPLNGAAEPGPDLLEIDVFDVTKSVRAKNRCNA |
| Ga0306924_108528691 | 3300032076 | Soil | VLRVNNMKTRLSGREPLNGAAEPGLYLLETDVFDL |
| Ga0311301_1000902937 | 3300032160 | Peatlands Soil | MNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAKN |
| Ga0335078_114288412 | 3300032805 | Soil | MNACLSGRESLNGVAEPGRDLLESDVFDLAKSVRAKNRCDAG |
| Ga0335080_101015891 | 3300032828 | Soil | MNAGVSGCESLNGVAEPGRDLLEIDVFEVTESVRAKKRRHT |
| Ga0335074_102785171 | 3300032895 | Soil | MLSVDNMNTSVSGRESLNGAAEPGRDLLEIDVFDGTKSVRAK |
| Ga0335072_109263221 | 3300032898 | Soil | MDNMNAGVSGRESMNEAAEPGRDLLVTNVFDVRKSVRAQKRCNGRRL |
| Ga0335072_116689721 | 3300032898 | Soil | MNASVSGREPLNRVAEPGRDLLEIDVFDGTKSVRAKNRCNT |
| Ga0316628_1014792123 | 3300033513 | Soil | VLSVDNMNASVSGRESFNGAAEPGRDLLEIDVFDGTKSVR |
| Ga0370515_0435203_2_127 | 3300034163 | Untreated Peat Soil | MDNMKASVSRRESLNGATEPGHDLLEIDVFEVAKSVRAKNRC |
| ⦗Top⦘ |