| Basic Information | |
|---|---|
| Family ID | F043475 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALV |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.18 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.590 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.590 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.128 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.615 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF00581 | Rhodanese | 43.59 |
| PF01661 | Macro | 8.97 |
| PF01243 | Putative_PNPOx | 8.97 |
| PF03883 | H2O2_YaaD | 3.21 |
| PF11975 | Glyco_hydro_4C | 1.92 |
| PF02557 | VanY | 1.28 |
| PF02581 | TMP-TENI | 0.64 |
| PF01663 | Phosphodiest | 0.64 |
| PF00202 | Aminotran_3 | 0.64 |
| PF01872 | RibD_C | 0.64 |
| PF08402 | TOBE_2 | 0.64 |
| PF01547 | SBP_bac_1 | 0.64 |
| PF03588 | Leu_Phe_trans | 0.64 |
| PF12270 | Cyt_c_ox_IV | 0.64 |
| PF00005 | ABC_tran | 0.64 |
| PF13360 | PQQ_2 | 0.64 |
| PF04107 | GCS2 | 0.64 |
| PF00107 | ADH_zinc_N | 0.64 |
| PF00232 | Glyco_hydro_1 | 0.64 |
| PF00534 | Glycos_transf_1 | 0.64 |
| PF00294 | PfkB | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 8.97 |
| COG3022 | DNA-binding protein YaaA associated with the oxidative stress response | Replication, recombination and repair [L] | 3.21 |
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.28 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.28 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.64 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.64 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.64 |
| COG2360 | Leu/Phe-tRNA-protein transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.59 % |
| Unclassified | root | N/A | 6.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10495400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300000890|JGI11643J12802_12343762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300000956|JGI10216J12902_116157144 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300004114|Ga0062593_101795146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300004463|Ga0063356_101893566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 899 | Open in IMG/M |
| 3300004480|Ga0062592_101488679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300005168|Ga0066809_10000546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5043 | Open in IMG/M |
| 3300005354|Ga0070675_100186228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1796 | Open in IMG/M |
| 3300005447|Ga0066689_10317770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 968 | Open in IMG/M |
| 3300005471|Ga0070698_100951958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 805 | Open in IMG/M |
| 3300005536|Ga0070697_101401520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300005546|Ga0070696_100009445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6531 | Open in IMG/M |
| 3300005554|Ga0066661_10569789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 675 | Open in IMG/M |
| 3300005555|Ga0066692_10237478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300005615|Ga0070702_101552099 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005841|Ga0068863_100566523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1122 | Open in IMG/M |
| 3300005877|Ga0075296_1007638 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006047|Ga0075024_100756310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| 3300006224|Ga0079037_102217285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300006358|Ga0068871_101948272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300006572|Ga0074051_10012630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2144 | Open in IMG/M |
| 3300006573|Ga0074055_11502661 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300006575|Ga0074053_11964513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1991 | Open in IMG/M |
| 3300006577|Ga0074050_10645057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora elongata | 516 | Open in IMG/M |
| 3300006606|Ga0074062_12345040 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006853|Ga0075420_101153319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 666 | Open in IMG/M |
| 3300006871|Ga0075434_101755856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300006876|Ga0079217_11407318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300006876|Ga0079217_11461840 | Not Available | 538 | Open in IMG/M |
| 3300007076|Ga0075435_101894291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300009031|Ga0103682_10250556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300009082|Ga0105099_10550540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300009098|Ga0105245_10425094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1332 | Open in IMG/M |
| 3300009137|Ga0066709_103368973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300009162|Ga0075423_12341450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300009179|Ga0115028_11076547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300009503|Ga0123519_10317620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 954 | Open in IMG/M |
| 3300009810|Ga0105088_1086777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300009816|Ga0105076_1086756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300009816|Ga0105076_1114817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300009818|Ga0105072_1039611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
| 3300009836|Ga0105068_1031256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300009840|Ga0126313_11056265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
| 3300010040|Ga0126308_10201282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1279 | Open in IMG/M |
| 3300010041|Ga0126312_10504293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
| 3300011003|Ga0138514_100017303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1256 | Open in IMG/M |
| 3300011107|Ga0151490_1417889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300011119|Ga0105246_11826038 | Not Available | 581 | Open in IMG/M |
| 3300012039|Ga0137421_1231051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300012093|Ga0136632_10062946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1712 | Open in IMG/M |
| 3300012204|Ga0137374_10698872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300012204|Ga0137374_11159762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300012356|Ga0137371_10572105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300012359|Ga0137385_11633438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300012360|Ga0137375_10863467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300012680|Ga0136612_10458989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300012901|Ga0157288_10292281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300012964|Ga0153916_10669104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1117 | Open in IMG/M |
| 3300012976|Ga0134076_10141715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| 3300012976|Ga0134076_10226724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300013306|Ga0163162_10935539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
| 3300014299|Ga0075303_1099170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300014326|Ga0157380_11258324 | Not Available | 786 | Open in IMG/M |
| 3300014745|Ga0157377_11675820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. WL0053 | 512 | Open in IMG/M |
| 3300014829|Ga0120104_1091297 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300014968|Ga0157379_11357871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora elongata | 688 | Open in IMG/M |
| 3300015374|Ga0132255_102415019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300018028|Ga0184608_10429497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300018032|Ga0187788_10272544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300018052|Ga0184638_1194234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300018066|Ga0184617_1197796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300018067|Ga0184611_1267272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300018071|Ga0184618_10242379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
| 3300018074|Ga0184640_10161524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1003 | Open in IMG/M |
| 3300018078|Ga0184612_10007803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5370 | Open in IMG/M |
| 3300018078|Ga0184612_10599209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300018078|Ga0184612_10618568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300018422|Ga0190265_12581597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300018433|Ga0066667_11435987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300018469|Ga0190270_10146948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1907 | Open in IMG/M |
| 3300018469|Ga0190270_12106433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300018482|Ga0066669_10680984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300019767|Ga0190267_10448842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| 3300020003|Ga0193739_1006942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3023 | Open in IMG/M |
| 3300020006|Ga0193735_1106467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300020020|Ga0193738_1095588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 853 | Open in IMG/M |
| 3300021073|Ga0210378_10082864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1255 | Open in IMG/M |
| 3300021078|Ga0210381_10051169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1238 | Open in IMG/M |
| 3300021080|Ga0210382_10534752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300021082|Ga0210380_10476801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300022694|Ga0222623_10066053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1397 | Open in IMG/M |
| 3300022756|Ga0222622_11342459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300022898|Ga0247745_1044577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300025159|Ga0209619_10448515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300025313|Ga0209431_11193105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300025325|Ga0209341_10545274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
| 3300025327|Ga0209751_10399717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1140 | Open in IMG/M |
| 3300025917|Ga0207660_11680293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300025919|Ga0207657_11187592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300025942|Ga0207689_11190655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 641 | Open in IMG/M |
| 3300025945|Ga0207679_11693348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300026063|Ga0208656_1007880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300026071|Ga0208537_1019738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 856 | Open in IMG/M |
| 3300026075|Ga0207708_10907037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 763 | Open in IMG/M |
| 3300026090|Ga0208912_1073683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300026095|Ga0207676_12005428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora elongata | 577 | Open in IMG/M |
| 3300026121|Ga0207683_10515326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300026326|Ga0209801_1207272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300027209|Ga0209875_1044999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300027561|Ga0209887_1078350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
| 3300027577|Ga0209874_1116565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300027650|Ga0256866_1171068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300027695|Ga0209966_1165945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300027877|Ga0209293_10287061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
| 3300027882|Ga0209590_10649175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 677 | Open in IMG/M |
| 3300027909|Ga0209382_10758268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300028590|Ga0247823_11204350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300028592|Ga0247822_11789841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300028597|Ga0247820_10207789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1249 | Open in IMG/M |
| 3300028597|Ga0247820_11145105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300028711|Ga0307293_10224766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300028722|Ga0307319_10071586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
| 3300028744|Ga0307318_10087875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300028782|Ga0307306_10149568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300028784|Ga0307282_10282049 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300028784|Ga0307282_10651979 | Not Available | 510 | Open in IMG/M |
| 3300028791|Ga0307290_10374553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300028807|Ga0307305_10315389 | Not Available | 711 | Open in IMG/M |
| 3300028814|Ga0307302_10071933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
| 3300028876|Ga0307286_10001058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7934 | Open in IMG/M |
| 3300028878|Ga0307278_10236515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300028880|Ga0307300_10007876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2694 | Open in IMG/M |
| 3300028884|Ga0307308_10094331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300030006|Ga0299907_10021720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4842 | Open in IMG/M |
| 3300030006|Ga0299907_10562653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300030336|Ga0247826_10345567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300030336|Ga0247826_11536543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300030619|Ga0268386_10481184 | Not Available | 854 | Open in IMG/M |
| 3300031198|Ga0307500_10179613 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031226|Ga0307497_10037870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1619 | Open in IMG/M |
| 3300031226|Ga0307497_10581693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora elongata | 564 | Open in IMG/M |
| 3300031229|Ga0299913_11110189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300031538|Ga0310888_10878615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300031862|Ga0315280_10504258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300031965|Ga0326597_12032400 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031997|Ga0315278_11735031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300032012|Ga0310902_11003590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300032075|Ga0310890_10929968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300032156|Ga0315295_11515865 | Not Available | 646 | Open in IMG/M |
| 3300032174|Ga0307470_11851627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300032342|Ga0315286_11152847 | Not Available | 761 | Open in IMG/M |
| 3300032516|Ga0315273_10109887 | Not Available | 3770 | Open in IMG/M |
| 3300033407|Ga0214472_10623351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300033482|Ga0316627_100260092 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300033513|Ga0316628_102571375 | Not Available | 672 | Open in IMG/M |
| 3300033550|Ga0247829_10162058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1750 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.21% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.56% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.92% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.28% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.28% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.28% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.28% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.64% |
| Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.64% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.64% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.64% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005877 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009031 | Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009503 | Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026063 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026071 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026090 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_104954001 | 3300000550 | Soil | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVE |
| JGI11643J12802_123437621 | 3300000890 | Soil | VVDVEGARRALEDVLGAGEVLSDPLALRLYARDASMVEGGCALVAFPRSRN |
| JGI10216J12902_1161571441 | 3300000956 | Soil | VPDLDLARSELIAALGADAVLSDPLALRLYARDASMVE |
| Ga0062593_1017951462 | 3300004114 | Soil | MADVDAARRDLEAALGAGRVRADPLTRRLYARDASMVEGSC |
| Ga0063356_1018935663 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VPNLEAARTDLIDVLGVEAVLADPLALRLYARDASMVEGSAGLVVFVRSADDVVT |
| Ga0062592_1014886791 | 3300004480 | Soil | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRSRDDI |
| Ga0066809_100005468 | 3300005168 | Soil | VADVEGARRALEEAFGAGEVLSDPLALRLYARDASMVEGGCA |
| Ga0070675_1001862281 | 3300005354 | Miscanthus Rhizosphere | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRSRED |
| Ga0066689_103177701 | 3300005447 | Soil | VANLEAARTDLIDALGVEAVLADPLALRLYARDASMVEGG |
| Ga0070698_1009519581 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDADVDRARADLERSLGGARVLSDPAALRLYARDASMVEGGCALVVFPTSV |
| Ga0070697_1014015201 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRSRDDIVAC |
| Ga0070696_1000094451 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VPNPDAARTDLIAALGVEAVLADPLALRLYARDASMVEGS |
| Ga0066661_105697892 | 3300005554 | Soil | MTGVDDARRDLETALGPVEVLSDPLALRLYARDASMVEGSCGLV |
| Ga0066692_102374784 | 3300005555 | Soil | MTGVDDARRDLETALGPVEVLSDPLALRLYARDASMV |
| Ga0070702_1015520991 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDVDAARRALEEALGRSEVLSDPLALRLYARDASLVEGGCSLVAFPRKLEDV |
| Ga0068863_1005665233 | 3300005841 | Switchgrass Rhizosphere | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRTRDDIV |
| Ga0075296_10076383 | 3300005877 | Rice Paddy Soil | MADVEGARRALQDVLGSDEVLSDPLALRLYARDASMVEGGCALVAFPHSTEHIV |
| Ga0075024_1007563102 | 3300006047 | Watersheds | VSDLTAARHDLEATLGADAVLADPLALRLYARDASMVEGSAGLVVFPR |
| Ga0079037_1022172852 | 3300006224 | Freshwater Wetlands | MADVEAARGALEEALGAAEVLSDPLALALYGRDASMVEGGCALVAF |
| Ga0068871_1019482721 | 3300006358 | Miscanthus Rhizosphere | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALV |
| Ga0074051_100126301 | 3300006572 | Soil | VADVEGARRALEDALGAGEVLSDPLALRLYSRDAS |
| Ga0074055_115026613 | 3300006573 | Soil | MTDVDAARHALEDALGPGDVLSDPLSLKLYARDASMVEGGCALVAFP |
| Ga0074053_119645131 | 3300006575 | Soil | VPNLEAARTDLIDALGVEAVLADPLALRLYARDASMVEGSA |
| Ga0074050_106450572 | 3300006577 | Soil | MTDVDAARHALEDALGPGDVLSDPLSLKLYARDASMVEGGCALVAFPRSTD |
| Ga0074062_123450403 | 3300006606 | Soil | MTDVDGARRALEDALGPAEVLSDPLALKLYARDASMVEGGCALVAFPRSTE |
| Ga0075420_1011533191 | 3300006853 | Populus Rhizosphere | MTDVDVARRALEDALGPERVLSDTLALRLYAWDASMVEGGC |
| Ga0075434_1017558561 | 3300006871 | Populus Rhizosphere | VANLDAAHTDLIDALGDEAVIADPLALRLYARDASMV |
| Ga0079217_114073181 | 3300006876 | Agricultural Soil | MADVDAARRELEEALGADAVLSDPLALRLYARDASMVEGSAGLVVFP |
| Ga0079217_114618401 | 3300006876 | Agricultural Soil | MPDADGARLALERVLGASAVLADPLARRLYARDASM |
| Ga0075435_1018942912 | 3300007076 | Populus Rhizosphere | VTPDLAGARVELERVLGAEDVLSDPLARRLYARDASMVEGSA |
| Ga0103682_102505561 | 3300009031 | Groundwater | MADVEAARRALHDTLGPSEVLSDPLALALYARDASMV |
| Ga0105099_105505403 | 3300009082 | Freshwater Sediment | MADVDAARRALEEALGPAEVLSDPLALAVYGRDASMLEGGCALVAFPRERDHIVACVRVA |
| Ga0105245_104250944 | 3300009098 | Miscanthus Rhizosphere | VPNLDAARTDLIDALGVEAVLADPLALRLYARDAS |
| Ga0066709_1033689732 | 3300009137 | Grasslands Soil | MTDVGMARRALEEALGPDDVLTDPLALTLYRRDASMVEGGCAIVVFP |
| Ga0075423_123414502 | 3300009162 | Populus Rhizosphere | VPNLNAARTDLIDSLGVESVLADPLALRLYARDASMVEGSAGLVVFVRSA |
| Ga0115028_110765471 | 3300009179 | Wetland | MADVEAARRALEDALGPSEVLSDPLALALYARDASMVEGGCALVAFPRE |
| Ga0123519_103176201 | 3300009503 | Hot Spring | MADVDAARRALEQALGPAEVLSDPLALLLYARDSSMVEGSCALVAFPRRVEDIVACVR |
| Ga0105088_10867771 | 3300009810 | Groundwater Sand | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVATPRSRDDIVACV |
| Ga0105076_10867562 | 3300009816 | Groundwater Sand | MADVDAARLELEEALGTNEVLSDPLALTLYARDASMVEGGCALVAFPHTV |
| Ga0105076_11148171 | 3300009816 | Groundwater Sand | MADVDAARLELEEALGTTEVLSDPLALTLYARDASMVE |
| Ga0105072_10396111 | 3300009818 | Groundwater Sand | MTDVDAARRALEDALGPAEVLSDPLALRLYARDASMVEGGCALVAFPRSRDDIVTCI |
| Ga0105068_10312563 | 3300009836 | Groundwater Sand | MADVDAARLELEEALGTNEVLSDPLALTLYARDASMVEGGCALVAFPHTVE |
| Ga0126313_110562653 | 3300009840 | Serpentine Soil | MADVEGALRALEDVLGAGEVLSDSLALRLYARDASMVEGGC |
| Ga0126308_102012824 | 3300010040 | Serpentine Soil | VANVEGARRALEDALGAGEVLAEPLALRLYARDASMVEGGCALVAFPRSRDDIVACV |
| Ga0126312_105042931 | 3300010041 | Serpentine Soil | VADVQGARRALEAAFGTSEVLTDPLALRLYARDASMLEG |
| Ga0138514_1000173034 | 3300011003 | Soil | VPNLDAARTDLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVHS |
| Ga0151490_14178891 | 3300011107 | Soil | MADVDAARLELEATLGVAEVLSDPLARKLYSRDASL |
| Ga0105246_118260381 | 3300011119 | Miscanthus Rhizosphere | VSDLTAARRDLEATLGAEAVLADPLALRLYARDASMVEGSAGLVAFPRSAD |
| Ga0137421_12310511 | 3300012039 | Soil | MSDVTAARHALEDALGVEEVLSDPLALRLYARDASMVEGG |
| Ga0136632_100629461 | 3300012093 | Polar Desert Sand | MADVVAARRELEAALGPDAVLADPLALRLYARDASMVEG |
| Ga0137374_106988721 | 3300012204 | Vadose Zone Soil | MADVNAARLELEEALGTNEVLSDPLALTLYARDASMVEGGCALVA |
| Ga0137374_111597621 | 3300012204 | Vadose Zone Soil | MADVDAARLELEEALGTNEVLSDPLALTLYARDASMVEGGCALVA |
| Ga0137371_105721051 | 3300012356 | Vadose Zone Soil | MAGLDVARDELVAALGADAVLHDPLALRLYARDASMVEGSAG |
| Ga0137385_116334381 | 3300012359 | Vadose Zone Soil | MAELDAARDELVAALGADAVLHDPLALRLYAGDASMVEGSAGLVVFVRSADDVVT |
| Ga0137375_108634671 | 3300012360 | Vadose Zone Soil | MADVDAARLELEEALGTNEVLSDPLALTLYTRDASMVEGGCALVAFPHTVEDVVACVRVA |
| Ga0136612_104589891 | 3300012680 | Polar Desert Sand | MADVDAARRELEAELGSGAVLTDPLALRLYARDASMVEGECAIVAL |
| Ga0157288_102922811 | 3300012901 | Soil | VADVDVARRALEDALGPERVLSDPLALRLYARDASMVEGGCAFVAFPQTAE |
| Ga0153916_106691041 | 3300012964 | Freshwater Wetlands | MADVEAARRALEAALGPAEVLSDPLALALYGRDASLVEGGCALVAFPTELEHVVAC |
| Ga0134076_101417153 | 3300012976 | Grasslands Soil | MADVDAARRELEEALGTTEVLSDPLALTLYARDAAMVEGGCALV |
| Ga0134076_102267243 | 3300012976 | Grasslands Soil | VPDLDPARTELVAALGEGAVLTDPLALRLYARDASM |
| Ga0163162_109355393 | 3300013306 | Switchgrass Rhizosphere | MTDVDAARRALEAALGPDEVLSDPLALKLYARDASMVEGGCALVAFPRST |
| Ga0075303_10991701 | 3300014299 | Natural And Restored Wetlands | MADVDAARRALEDALGPAEVLSDPRALRLYARDGAMVEGGCALVAFPRTRADIVSCIRIAAE |
| Ga0157380_112583241 | 3300014326 | Switchgrass Rhizosphere | VTDLGGARQDLEAALGPGAVVDDPLERRLYARDAS |
| Ga0157377_116758202 | 3300014745 | Miscanthus Rhizosphere | MTDVEAARRALEAALGSDEVLSDPLALKLYARDAS |
| Ga0120104_10912973 | 3300014829 | Permafrost | MPDVGSARRALEDALGAAEILTEPTALKLYARDASLVEGSAALVAFPRTIDD |
| Ga0157379_113578711 | 3300014968 | Switchgrass Rhizosphere | MTDVDAARRALEAALGPDEVLSDPLALKLYARDASMV |
| Ga0132255_1024150191 | 3300015374 | Arabidopsis Rhizosphere | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRTR |
| Ga0184608_104294971 | 3300018028 | Groundwater Sediment | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAF |
| Ga0187788_102725443 | 3300018032 | Tropical Peatland | MAAVDEARRALEAALGPDEVLSDPLALKLYARDASMVEGGCALVAF |
| Ga0184638_11942343 | 3300018052 | Groundwater Sediment | VTDVEGARRSLEDALGPAEVLSDPLALRLYARDASMV |
| Ga0184617_11977961 | 3300018066 | Groundwater Sediment | VADVEGARRALEDALGAGEVLSDPLALRLYARDASM |
| Ga0184611_12672721 | 3300018067 | Groundwater Sediment | VPNLDAARTDLIDALGLEAVLADPLALRLYARDASMVEGSAGLVVFVHS |
| Ga0184618_102423791 | 3300018071 | Groundwater Sediment | MTDVDGARRALEEALGASEVLADPLALKLYARDASMVEGGCA |
| Ga0184640_101615243 | 3300018074 | Groundwater Sediment | MPDVEAARRALEVALGADEVLSDPLELRLYARDASMVEGGCALVAFPRTT |
| Ga0184612_100078031 | 3300018078 | Groundwater Sediment | MTDVDAARRALEDALGPAEVLSDPLALRLYARDASMVEGGCALV |
| Ga0184612_105992092 | 3300018078 | Groundwater Sediment | MADVDAARRELEEALGTSEVLSDPLALTLYARDASMVEGGCALVAFP |
| Ga0184612_106185681 | 3300018078 | Groundwater Sediment | VADVEGARRALEGALGPAEVLSDPLALRLYARDASMVEGGCALVAFPRS |
| Ga0190265_125815971 | 3300018422 | Soil | MADVEAARRALLEALGPDEVLSDPLALTLYARDASLVEGTCALVVFPRSVEDI |
| Ga0066667_114359871 | 3300018433 | Grasslands Soil | MADLDAARRELVDAFGADAVLADPLALQLYARDASMVEGTA |
| Ga0190270_101469485 | 3300018469 | Soil | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFP |
| Ga0190270_121064332 | 3300018469 | Soil | MADVEGARRALEDALGPAEVLSDPLALRLYARDASMVEGGCALVAFPRSRDDIVTC |
| Ga0066669_106809841 | 3300018482 | Grasslands Soil | MATLDAARDELVAALGADAVLHDPLALRLYARDASMVEGSAGL |
| Ga0190267_104488421 | 3300019767 | Soil | VVDVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCAL |
| Ga0193739_10069426 | 3300020003 | Soil | VADVEGARGALEDALGPAQVLSDPLALRLYARDASMVDGG |
| Ga0193735_11064671 | 3300020006 | Soil | VPNLDAARTDLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVYSAD |
| Ga0193738_10955881 | 3300020020 | Soil | VADVEGARGALEDALGPAQVLSDPLALRLYARDASMVDGGCAF |
| Ga0210378_100828644 | 3300021073 | Groundwater Sediment | MADVDAARLELEESLGTTEVLSDPLALTLYARDAS |
| Ga0210381_100511694 | 3300021078 | Groundwater Sediment | VPNLDAARTDLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVHSADDVVTC |
| Ga0210382_105347521 | 3300021080 | Groundwater Sediment | MADVDAARIALRGALGPAEVLSDPLSLRLYARDASMVEGGCALVAFPRRLEDIV |
| Ga0210380_104768012 | 3300021082 | Groundwater Sediment | MADVDAARRALEDALGAGEVLSDPLSLRLYARDASMVEGGCALVAF |
| Ga0222623_100660534 | 3300022694 | Groundwater Sediment | VADVEGARRSLEDALGPAEVLSDPLALRLYARDASMVEGGCALVAFPRSRDDIVRCIRVAAE |
| Ga0222622_113424592 | 3300022756 | Groundwater Sediment | MAAVDAARRALEDALGAGEVLSDPLALRLYSRDASMVEGGCALVAFPRTRDDIVACLNV |
| Ga0247745_10445771 | 3300022898 | Soil | VADVDVARRALEDALGPERVLSDPLALRLYARDASMVEGGCAFVAFPQTAEEI |
| Ga0209619_104485151 | 3300025159 | Soil | MADIDAARRALEEALGPAEVLSDPLALVLYGRDASMVEGGCALVAFPRELGQIVTCVRVA |
| Ga0209431_111931052 | 3300025313 | Soil | MADVDGARRALEDALGPTEVLSDPLALILYARDASMVEGGCALVAFPHSLEDIVECMRI |
| Ga0209341_105452741 | 3300025325 | Soil | MADVDGARRSLEDALGPTEVLSDPLALILYARDASMVEGQCA |
| Ga0209751_103997173 | 3300025327 | Soil | MADVDAARRALEDALGPAEVLSDPLALRLYARDGSMVEG |
| Ga0207660_116802931 | 3300025917 | Corn Rhizosphere | VPNPDAARTDLIAALGVEAVLADPLALRLYARDASM |
| Ga0207657_111875921 | 3300025919 | Corn Rhizosphere | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVA |
| Ga0207689_111906552 | 3300025942 | Miscanthus Rhizosphere | MADIEAARRDLVAALDADRVLADPLALRLYARDASMVEGGCA |
| Ga0207679_116933481 | 3300025945 | Corn Rhizosphere | MADVDAARRDLEAALGAGRVRADPLTRRLYARDASMVEGSCELVAFPA |
| Ga0208656_10078803 | 3300026063 | Natural And Restored Wetlands | MADVDAARRELEAALGPEAVLSDPLARRLYARDASMVEGGCALVALP |
| Ga0208537_10197381 | 3300026071 | Natural And Restored Wetlands | MADVDAARRELDAALGSRSVLSDPLALRLYARDASMVEGGCA |
| Ga0207708_109070371 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDLRAARRDLDAALGAQAVHSDPLAVKLYARDAS |
| Ga0208912_10736831 | 3300026090 | Natural And Restored Wetlands | MADVDAARRELDAALGSRSVLSDPLALRLYARDASMVEGGCALVALPTTTE |
| Ga0207676_120054282 | 3300026095 | Switchgrass Rhizosphere | MTDVDAARRALEAALGPDEVLSDPLALKLYARDASMVEGGCALVAFPRSTDDIV |
| Ga0207683_105153263 | 3300026121 | Miscanthus Rhizosphere | MPDVDAARRALEEALGRSEVLSDPLALRLYARDASLVEGECALVAF |
| Ga0209801_12072723 | 3300026326 | Soil | VANLEAARTDLIDALGVEAVLADPLALRLYARDASMVEGGA |
| Ga0209875_10449992 | 3300027209 | Groundwater Sand | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRSRDDIV |
| Ga0209887_10783503 | 3300027561 | Groundwater Sand | VADVEGARGALEGALGPAEVLSDPLALRLYARDASMAEGGC |
| Ga0209874_11165653 | 3300027577 | Groundwater Sand | MPDLDGARRALEEALGTSEVLSDPLALRLYARDASMVEGGCALVAFP |
| Ga0256866_11710682 | 3300027650 | Soil | MADVEAARRALEEALGRSEVLSDPLALRLYARDASLVEGGCALVTFPRRLP |
| Ga0209966_11659452 | 3300027695 | Arabidopsis Thaliana Rhizosphere | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRSR |
| Ga0209293_102870611 | 3300027877 | Wetland | MADVEAARRALEDALGPSEVLSDPLALALYARDASMVEGGCALVAFPREL |
| Ga0209590_106491751 | 3300027882 | Vadose Zone Soil | MTGVDDARRDLETALGPAEVLSDPLALRLYARDASMVEGSCGLVAFSRTVD |
| Ga0209382_107582681 | 3300027909 | Populus Rhizosphere | VTDVDDARRALEGALGPERVLSDPLALRLYARDASMVEGGCALVVFPESTDEIV |
| Ga0247823_112043502 | 3300028590 | Soil | MVDLDAARRALTDVLGADAVLADPLSLRLYARDASLVEGNASV |
| Ga0247822_117898412 | 3300028592 | Soil | MADIEAARRDLVAALDADRVLADPLALRLYARDASMVE |
| Ga0247820_102077894 | 3300028597 | Soil | MADVDAARRELEAALGPEAVLSDPLARRLYARDASMVEGGCA |
| Ga0247820_111451052 | 3300028597 | Soil | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALDA |
| Ga0307293_102247661 | 3300028711 | Soil | MADVDAARLELEEALGTTEVLSDPLALTLYARDASMVEGGCA |
| Ga0307319_100715861 | 3300028722 | Soil | MQDLHAARRELEAALGADAVLSDRLALRLYARDASMVEGSAGLVVFPLS |
| Ga0307318_100878751 | 3300028744 | Soil | MPDLDAARRDLEETLGADAVLSDPLALRLYARDASMVEGSAGLVVFPTSTD |
| Ga0307306_101495682 | 3300028782 | Soil | VPNLDAARTDLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVRSADDVV |
| Ga0307282_102820493 | 3300028784 | Soil | MTDVDGARRALEEALGPAEVLSDPLALKLYARDASMVE |
| Ga0307282_106519791 | 3300028784 | Soil | MADVDAARRELEAALGADRVMADPLTRRLYARDASMV |
| Ga0307290_103745532 | 3300028791 | Soil | MSDLDAARSELEEALGADAVLSDPLALRLYARDASMVEGSAGLV |
| Ga0307305_103153891 | 3300028807 | Soil | VPGRRDPPAGVERARRDLARVLGQDGVLAEPLARALYRRDASMLEGDCALVAFPRSR |
| Ga0307302_100719334 | 3300028814 | Soil | MADVDAARRALEDALGTGEVLSDPLALRLYARDASMVEGGCALVAFPRTRDDIVTCV |
| Ga0307286_100010581 | 3300028876 | Soil | VPNLDAARTHLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVHSADDVVTC |
| Ga0307278_102365153 | 3300028878 | Soil | MADIEAARRELEEALGASEVLSDPLALTLYARDASMVEGGCALVAFPHTVEDV |
| Ga0307300_100078766 | 3300028880 | Soil | VADVEGARRALEDALGAGEVLSDPLALRLYARDASMVEGGCALVAFPRSRE |
| Ga0307308_100943314 | 3300028884 | Soil | VPNLDAARTDLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVYSA |
| Ga0299907_100217207 | 3300030006 | Soil | MADLAAARRELEAALGSDRVLADALALRLYARDASMVQGSAGLVV |
| Ga0299907_105626531 | 3300030006 | Soil | MADVDAARRELEVALGSEGVLSDPLALRLYSRDASMVEGGCALVALPTT |
| Ga0247826_103455673 | 3300030336 | Soil | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVEGG |
| Ga0247826_115365431 | 3300030336 | Soil | VPNLDAARTDLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVHSADDVVTCM |
| Ga0268386_104811843 | 3300030619 | Soil | MADLAAARRELEAALGSDRVLADALALRLYARDASMVQGSAGLVVFPGST |
| Ga0307500_101796132 | 3300031198 | Soil | MTDVDGARRALEVALGSTEVLADPLALKLYARDAS |
| Ga0307497_100378701 | 3300031226 | Soil | VPNLDAARADLIDALGVEAVLADPLALRLYARDASMVEGSAGLVVFVHSAGDVVT |
| Ga0307497_105816931 | 3300031226 | Soil | MTDVEGARRALEETLGPAEVLSDPLALKLYARDASMVEGGCALVAFPRSTE |
| Ga0299913_111101891 | 3300031229 | Soil | MADVEAARRALIEALGPDEVLSDPLALTLYARDASLVEGACALVVFPRSVADTA |
| Ga0310888_108786151 | 3300031538 | Soil | MADVDAARRALEDALGAGEVLSDPLALRLYARDASMVEG |
| Ga0315280_105042581 | 3300031862 | Sediment | MADVKAARRALEDALGPAEVLSEPLALLLYARDSSMVEGGCALVAFP |
| Ga0326597_120324001 | 3300031965 | Soil | MANVQAARRELEDALGPSEVLSDPLALRLYARDASLVEGGCALV |
| Ga0315278_117350312 | 3300031997 | Sediment | MTATDAARAAISQALAPERVLSDPLELALYARDASMFEGGCSLVALPLSTQE |
| Ga0310902_110035902 | 3300032012 | Soil | MTKLEAARRELSAALGAEAVLVDPLALRLYARDASIVEGSAGLVA |
| Ga0310890_109299681 | 3300032075 | Soil | MADLDAARRDLVDALGADGVAADPLTRRLYARDAS |
| Ga0315295_115158652 | 3300032156 | Sediment | VGDLTAARRDLEAALGADAVLTDPLALRLYARDASMVEGS |
| Ga0307470_118516272 | 3300032174 | Hardwood Forest Soil | MADLDAARRALEAALGADDVLTDPLALRLYARDASMVEGSA |
| Ga0315286_111528472 | 3300032342 | Sediment | VSDLSAARRDLEAALGADAVLADPLALRLYARDASM |
| Ga0315273_101098871 | 3300032516 | Sediment | MADVDGAKRALEAALGLAEVLADPLSLKLYTRDASMVEGSCALVAFARSTDD |
| Ga0214472_106233511 | 3300033407 | Soil | MADVDGARRSLEDALGPTEVLSDPLALILYARDASMVEGGCALVVFPHF |
| Ga0316627_1002600924 | 3300033482 | Soil | MADVEAARRALEDALGPSEVLSDPLALALYARDASMVEGGCALVAFPRELEHIVAC |
| Ga0316628_1025713752 | 3300033513 | Soil | MADLDAARVDLDRALGSDAVFADPLALRLYGRDASMVEGEAGLVAL |
| Ga0247829_101620581 | 3300033550 | Soil | MADVDAARRELEAALGPEAVLSDPLARRLYARDASMVEGGCALVALPTT |
| ⦗Top⦘ |