| Basic Information | |
|---|---|
| Family ID | F043429 |
| Family Type | Metagenome |
| Number of Sequences | 156 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VSDRAVETEFVFGRHAATDLSVAYAILVPQRRARIVRAGQEG |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 50.64 % |
| % of genes near scaffold ends (potentially truncated) | 98.08 % |
| % of genes from short scaffolds (< 2000 bps) | 95.51 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.897 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.026 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.026 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF01402 | RHH_1 | 62.82 |
| PF13655 | RVT_N | 3.21 |
| PF00078 | RVT_1 | 2.56 |
| PF08240 | ADH_N | 0.64 |
| PF00239 | Resolvase | 0.64 |
| PF08388 | GIIM | 0.64 |
| PF03050 | DDE_Tnp_IS66 | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.64 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.64 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.18 % |
| Unclassified | root | N/A | 12.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_10071014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2126 | Open in IMG/M |
| 3300000550|F24TB_11162327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 590 | Open in IMG/M |
| 3300002568|C688J35102_118966090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300002568|C688J35102_119435862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300003351|JGI26346J50198_1025869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 582 | Open in IMG/M |
| 3300003989|Ga0055473_10207905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
| 3300005166|Ga0066674_10495678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300005467|Ga0070706_100840858 | Not Available | 849 | Open in IMG/M |
| 3300005541|Ga0070733_10873978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300005559|Ga0066700_11160044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 504 | Open in IMG/M |
| 3300005610|Ga0070763_10717269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300005617|Ga0068859_101737338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
| 3300005952|Ga0080026_10197180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 595 | Open in IMG/M |
| 3300006046|Ga0066652_101466139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300006102|Ga0075015_100021197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2878 | Open in IMG/M |
| 3300006358|Ga0068871_101540719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 629 | Open in IMG/M |
| 3300006804|Ga0079221_10066078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1673 | Open in IMG/M |
| 3300007076|Ga0075435_100804392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 818 | Open in IMG/M |
| 3300009098|Ga0105245_12632004 | Not Available | 556 | Open in IMG/M |
| 3300009522|Ga0116218_1561371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 507 | Open in IMG/M |
| 3300009523|Ga0116221_1373251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300009525|Ga0116220_10156237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
| 3300009805|Ga0105079_1038243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 535 | Open in IMG/M |
| 3300010036|Ga0126305_10148351 | Not Available | 1456 | Open in IMG/M |
| 3300010337|Ga0134062_10362714 | Not Available | 700 | Open in IMG/M |
| 3300010366|Ga0126379_12958223 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010379|Ga0136449_101344549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
| 3300010379|Ga0136449_103445297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300010379|Ga0136449_103834126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 565 | Open in IMG/M |
| 3300011270|Ga0137391_10183281 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300012045|Ga0136623_10247080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 760 | Open in IMG/M |
| 3300012093|Ga0136632_10176939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 977 | Open in IMG/M |
| 3300012096|Ga0137389_11483281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 574 | Open in IMG/M |
| 3300012183|Ga0136624_1251199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 556 | Open in IMG/M |
| 3300012184|Ga0136610_1102575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 1007 | Open in IMG/M |
| 3300012185|Ga0136619_10216631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 728 | Open in IMG/M |
| 3300012198|Ga0137364_11061305 | Not Available | 611 | Open in IMG/M |
| 3300012198|Ga0137364_11441579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 508 | Open in IMG/M |
| 3300012201|Ga0137365_10207154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1464 | Open in IMG/M |
| 3300012210|Ga0137378_10212630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1800 | Open in IMG/M |
| 3300012210|Ga0137378_10607163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1004 | Open in IMG/M |
| 3300012210|Ga0137378_11410727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 610 | Open in IMG/M |
| 3300012212|Ga0150985_113829106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300012285|Ga0137370_10693413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300012359|Ga0137385_11211355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 617 | Open in IMG/M |
| 3300012359|Ga0137385_11674631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 500 | Open in IMG/M |
| 3300012906|Ga0157295_10152453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 694 | Open in IMG/M |
| 3300012917|Ga0137395_10210806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1355 | Open in IMG/M |
| 3300012924|Ga0137413_11013748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 652 | Open in IMG/M |
| 3300013105|Ga0157369_11050472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 833 | Open in IMG/M |
| 3300013297|Ga0157378_11613168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 695 | Open in IMG/M |
| 3300014200|Ga0181526_10488161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300014501|Ga0182024_12061969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 629 | Open in IMG/M |
| 3300014838|Ga0182030_11061796 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 706 | Open in IMG/M |
| 3300016294|Ga0182041_11177785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300016371|Ga0182034_11270764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 641 | Open in IMG/M |
| 3300016445|Ga0182038_10997927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 741 | Open in IMG/M |
| 3300017821|Ga0187812_1197552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 643 | Open in IMG/M |
| 3300017925|Ga0187856_1255769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300017928|Ga0187806_1217595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 652 | Open in IMG/M |
| 3300017928|Ga0187806_1320197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 550 | Open in IMG/M |
| 3300017933|Ga0187801_10133783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 958 | Open in IMG/M |
| 3300017942|Ga0187808_10236921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
| 3300018053|Ga0184626_10225784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300018469|Ga0190270_11755032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300018482|Ga0066669_11737307 | Not Available | 574 | Open in IMG/M |
| 3300019767|Ga0190267_10789795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 629 | Open in IMG/M |
| 3300020581|Ga0210399_10950611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300021086|Ga0179596_10214074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 942 | Open in IMG/M |
| 3300021178|Ga0210408_10746289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300021439|Ga0213879_10188199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
| 3300021479|Ga0210410_11762529 | Not Available | 513 | Open in IMG/M |
| 3300025878|Ga0209584_10128839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
| 3300025898|Ga0207692_10621099 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300025898|Ga0207692_10897387 | Not Available | 583 | Open in IMG/M |
| 3300025906|Ga0207699_11190621 | Not Available | 564 | Open in IMG/M |
| 3300025928|Ga0207700_10297689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1392 | Open in IMG/M |
| 3300025928|Ga0207700_10655657 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300025929|Ga0207664_10256424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1528 | Open in IMG/M |
| 3300025929|Ga0207664_11467085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 603 | Open in IMG/M |
| 3300025934|Ga0207686_10005952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6548 | Open in IMG/M |
| 3300025938|Ga0207704_11624036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 555 | Open in IMG/M |
| 3300026041|Ga0207639_11014311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300026075|Ga0207708_11188416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 667 | Open in IMG/M |
| 3300026490|Ga0257153_1090214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 612 | Open in IMG/M |
| 3300027497|Ga0208199_1126485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 522 | Open in IMG/M |
| 3300027636|Ga0214469_1048997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1320 | Open in IMG/M |
| 3300027662|Ga0208565_1022784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2229 | Open in IMG/M |
| 3300027812|Ga0209656_10229416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300027825|Ga0209039_10158873 | Not Available | 937 | Open in IMG/M |
| 3300027873|Ga0209814_10045026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1839 | Open in IMG/M |
| 3300027875|Ga0209283_10596540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300028710|Ga0307322_10171433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 584 | Open in IMG/M |
| 3300028742|Ga0302220_10082088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
| 3300028759|Ga0302224_10341652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300028768|Ga0307280_10106045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300028778|Ga0307288_10485508 | Not Available | 510 | Open in IMG/M |
| 3300028808|Ga0302228_10420173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300030056|Ga0302181_10157293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
| 3300030339|Ga0311360_11144026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300030491|Ga0302211_10158944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300030509|Ga0302183_10434791 | Not Available | 502 | Open in IMG/M |
| 3300030521|Ga0307511_10449205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300030524|Ga0311357_11211628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. Llam0 | 652 | Open in IMG/M |
| 3300030580|Ga0311355_11569837 | Not Available | 566 | Open in IMG/M |
| 3300030706|Ga0310039_10180532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300030707|Ga0310038_10375676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
| 3300031028|Ga0302180_10048888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2563 | Open in IMG/M |
| 3300031525|Ga0302326_11020981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1159 | Open in IMG/M |
| 3300031525|Ga0302326_12159176 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 712 | Open in IMG/M |
| 3300031546|Ga0318538_10295949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 872 | Open in IMG/M |
| 3300031549|Ga0318571_10106984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
| 3300031572|Ga0318515_10284029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300031708|Ga0310686_118957738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
| 3300031715|Ga0307476_10794550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300031740|Ga0307468_101395464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 643 | Open in IMG/M |
| 3300031765|Ga0318554_10696738 | Not Available | 570 | Open in IMG/M |
| 3300031770|Ga0318521_10301342 | Not Available | 943 | Open in IMG/M |
| 3300031771|Ga0318546_10854733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 640 | Open in IMG/M |
| 3300031782|Ga0318552_10288336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 834 | Open in IMG/M |
| 3300031799|Ga0318565_10032261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2372 | Open in IMG/M |
| 3300031799|Ga0318565_10418587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 649 | Open in IMG/M |
| 3300031805|Ga0318497_10426580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 742 | Open in IMG/M |
| 3300031820|Ga0307473_10833757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300031833|Ga0310917_10856587 | Not Available | 612 | Open in IMG/M |
| 3300031860|Ga0318495_10415323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 592 | Open in IMG/M |
| 3300031890|Ga0306925_10709141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
| 3300031890|Ga0306925_11554473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 645 | Open in IMG/M |
| 3300031910|Ga0306923_12282678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 540 | Open in IMG/M |
| 3300031911|Ga0307412_11693193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 579 | Open in IMG/M |
| 3300031912|Ga0306921_10264308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2015 | Open in IMG/M |
| 3300031954|Ga0306926_11715656 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031954|Ga0306926_12238133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 607 | Open in IMG/M |
| 3300031981|Ga0318531_10371033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300031981|Ga0318531_10455114 | Not Available | 579 | Open in IMG/M |
| 3300031995|Ga0307409_101331941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300031995|Ga0307409_101951572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300032001|Ga0306922_11432934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300032001|Ga0306922_11741638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300032005|Ga0307411_11481452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
| 3300032005|Ga0307411_11786387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 570 | Open in IMG/M |
| 3300032008|Ga0318562_10170833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 1256 | Open in IMG/M |
| 3300032025|Ga0318507_10105195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1180 | Open in IMG/M |
| 3300032035|Ga0310911_10087529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1690 | Open in IMG/M |
| 3300032043|Ga0318556_10561632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 596 | Open in IMG/M |
| 3300032055|Ga0318575_10462114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 644 | Open in IMG/M |
| 3300032076|Ga0306924_11897775 | Not Available | 618 | Open in IMG/M |
| 3300032089|Ga0318525_10057341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1941 | Open in IMG/M |
| 3300032160|Ga0311301_12419575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300032180|Ga0307471_103218838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 579 | Open in IMG/M |
| 3300032783|Ga0335079_11968119 | Not Available | 564 | Open in IMG/M |
| 3300032828|Ga0335080_10862742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
| 3300033004|Ga0335084_12181969 | Not Available | 537 | Open in IMG/M |
| 3300033289|Ga0310914_10860638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 805 | Open in IMG/M |
| 3300033550|Ga0247829_11175543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus erythropolis group → Rhodococcus erythropolis | 636 | Open in IMG/M |
| 3300034065|Ga0334827_171633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.05% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.21% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.28% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.64% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.64% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.64% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.64% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.64% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.64% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.64% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.64% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.64% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.64% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.64% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.64% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.64% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.64% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012183 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06) | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_100710142 | 3300000443 | Soil | VNDRLVETEFVFDRHAATDLSVAYAILVPQRQVRIVRSGQEASLCHD* |
| F24TB_111623271 | 3300000550 | Soil | VSERAVESEYVFDRYAATDLSVAYAILGPHREARVRAGQEGTPP |
| C688J35102_1189660901 | 3300002568 | Soil | VNDRVVETQCVFDRHAATDLSVAYAILVPQRRARVLRAGQEGRPQ |
| C688J35102_1194358621 | 3300002568 | Soil | VNDRVVETRFVFDRHAATDLSVAYAILVPQRRTRAARAGQEGRPQH |
| JGI26346J50198_10258692 | 3300003351 | Bog Forest Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRRARLVRAGQE |
| Ga0055473_102079051 | 3300003989 | Natural And Restored Wetlands | VTGRVVQAEYMFDRHAATDLSVAYTILVPQRRARVQPASTEGGPRDDKRGNLC |
| Ga0066674_104956782 | 3300005166 | Soil | VSDRAVETEFVFGRHAATDLSVAYAILVPQRRARIVRAGQEG |
| Ga0070706_1008408581 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNRAVETQFVFGRHAAAELSVAYAILVPQRRARMSRAGQ |
| Ga0070733_108739781 | 3300005541 | Surface Soil | VTGKAVEAVFCFDRHAAADLSVAYAILVPARRARTG |
| Ga0066700_111600442 | 3300005559 | Soil | VKSKVVETEFVFDRHAASDLSLAYAILVPQRRARTGRAGQEG |
| Ga0070763_107172693 | 3300005610 | Soil | VSVRAVETESVFGRHAATELSVAYAILVPQRRARIVRAGQE |
| Ga0068859_1017373383 | 3300005617 | Switchgrass Rhizosphere | VVETLFVFDRHGAADVSAAFQVLVPQRRARIEWGAGKRS |
| Ga0080026_101971803 | 3300005952 | Permafrost Soil | VNDRVVGTEFVFDRHAATDLSVAYAILVPQRRARIRAGQEGRPPRD |
| Ga0066652_1014661393 | 3300006046 | Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIVRAGQEG |
| Ga0075015_1000211976 | 3300006102 | Watersheds | VSDRTVETESVFGRHAATELSVAYAILVPQRQARI |
| Ga0068871_1015407191 | 3300006358 | Miscanthus Rhizosphere | VVDSEFVFDRHAATDVSVAYAILVPQRRARIGRAGQEGRPRND |
| Ga0079221_100660784 | 3300006804 | Agricultural Soil | VSDRAVETEFVFGRHAATELPVAYAILAPRRQARIARPGQEG |
| Ga0075435_1008043924 | 3300007076 | Populus Rhizosphere | VSGREVETAFVFDRHAATDVSVAYAILVPQRRARLGRAGQEG |
| Ga0105245_126320042 | 3300009098 | Miscanthus Rhizosphere | VNDRVVETQFVFDSHAATGLSVDYTILVPQLRVRISR |
| Ga0116218_15613712 | 3300009522 | Peatlands Soil | VNDRVVGTEFVFGRHAAADLSVAYAILVPQRQARIVRAGQEGRPPR |
| Ga0116221_13732512 | 3300009523 | Peatlands Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIRAG |
| Ga0116220_101562373 | 3300009525 | Peatlands Soil | VNDRAVETEFVFGRHAATELSVAYAILAPQRQARIVRPGQ |
| Ga0105079_10382432 | 3300009805 | Groundwater Sand | VNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARS |
| Ga0126305_101483512 | 3300010036 | Serpentine Soil | MLTVNDRVVETQFVFDRHAATDLSVAYTILVPQRRA |
| Ga0134062_103627142 | 3300010337 | Grasslands Soil | VNARRIETRFVFDRHAAADLSVAYTILVPQRQARTRRAGPEGR |
| Ga0126379_129582232 | 3300010366 | Tropical Forest Soil | ETAFVFDRHAATDVSVAYVILVPQRRARLGRAGQEGTAGR* |
| Ga0136449_1013445491 | 3300010379 | Peatlands Soil | VNSRRVEAEFVFDRHAATDLSVAYAILVPQRRARTGRPGQEGHAD |
| Ga0136449_1034452973 | 3300010379 | Peatlands Soil | VSDRAVEAESVFGRHAAAELSVAYAILVPQRQARIVRAGQEGWPPRD |
| Ga0136449_1038341261 | 3300010379 | Peatlands Soil | VSDRAVEAEFVFGRHAATELTVAYAILVPQRQARI |
| Ga0137391_101832812 | 3300011270 | Vadose Zone Soil | VSDRAVETESVFGRHAVTELSVGCAILVRQRQAVIRPASNEGRP* |
| Ga0136623_102470801 | 3300012045 | Polar Desert Sand | LIGWHRLNNRAVEDEVVFDRHAATDLSVAYAILVPQRRARIRAGQEG |
| Ga0136632_101769391 | 3300012093 | Polar Desert Sand | VNNRAVEDEVVFDRHAATDLSVAYAILVPQRRARIRAGQEG |
| Ga0137389_114832811 | 3300012096 | Vadose Zone Soil | VNDRVVGTEFVFGRHAAADLSVAYAILVPQRQARIVR |
| Ga0136624_12511992 | 3300012183 | Polar Desert Sand | VSDRAVEGEFVFDRHAATDLSVAYAILVPQRRARIRAGQKGRPPD |
| Ga0136610_11025751 | 3300012184 | Polar Desert Sand | LIGWHRLNNRAVEDEVVFDRHAATDLSVAYAILVPQRRARIRAGQ |
| Ga0136619_102166313 | 3300012185 | Polar Desert Sand | VSDRAVEGEFVFDRHAATDLSVAYAILVPQRRARIRAGEKGRPPD |
| Ga0137364_110613052 | 3300012198 | Vadose Zone Soil | VNARRIETRFVFDRHAAADLSVAYTILVPQRQART |
| Ga0137364_114415792 | 3300012198 | Vadose Zone Soil | VKPARVEAEFVFDRHGASDLSLAYAILVPQRRARTGRAGQEG |
| Ga0137365_102071541 | 3300012201 | Vadose Zone Soil | VSDRAVETEFVFGRHAATDLSVAYAILVPQRRARIVRA |
| Ga0137378_102126301 | 3300012210 | Vadose Zone Soil | VNNRTVETESVFGRHAATELSVACAILVPQRRARI |
| Ga0137378_106071631 | 3300012210 | Vadose Zone Soil | VSDRAVGTEFVFDRHAATDLSVAYAILVPQRRARIV |
| Ga0137378_114107271 | 3300012210 | Vadose Zone Soil | VSGRAVETEFVFGRHGAAELSVAYAILVPQRRARI |
| Ga0150985_1138291061 | 3300012212 | Avena Fatua Rhizosphere | VNDWVVETRFVFDRHAATDLSVAYAILVPQRRVRAARAGQEG |
| Ga0137370_106934133 | 3300012285 | Vadose Zone Soil | VKSKVVETEFVFDRHAASDLSLAYAILVPQRRART |
| Ga0137385_112113552 | 3300012359 | Vadose Zone Soil | VTGRGVEVQYVFGRHAAAELSVAYGILVPQRRARIVRPGQE |
| Ga0137385_116746311 | 3300012359 | Vadose Zone Soil | VRDRAVEGEFVFGRHAATDLPVAYAILVPQRRARIVRPGQE |
| Ga0157295_101524533 | 3300012906 | Soil | VVDTEFVFDRHAATDLSVAYAILVPQRRARIGRAGQEGR |
| Ga0137395_102108061 | 3300012917 | Vadose Zone Soil | VNDRAVETESVFGRHAATELSVAYAILAPQRRARI |
| Ga0137413_110137483 | 3300012924 | Vadose Zone Soil | VNDRVVEAEFVFDRNAATDMSVAYAILVPARRARL |
| Ga0157369_110504723 | 3300013105 | Corn Rhizosphere | VNNRAVETESVFGRHAATELSVAYAILVPQRRARIARPG |
| Ga0157378_116131681 | 3300013297 | Miscanthus Rhizosphere | VNDRVVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEGP |
| Ga0181526_104881613 | 3300014200 | Bog | VNRRRVEAEFVFDRHAATDLSVAYAILVPQRRARIA |
| Ga0182024_120619693 | 3300014501 | Permafrost | VSDRVVGTEFVFGRHAATDLSVAYAILVPQRRARIRAGQ |
| Ga0182030_110617963 | 3300014838 | Bog | VNDRAVETESVFGRHAATELSVAYAILVPQRQARIRAGQEGRP |
| Ga0182041_111777852 | 3300016294 | Soil | VSSRPVEAEFVFGRHWAAELSAAYAILVPQRKARIPANH |
| Ga0182034_112707642 | 3300016371 | Soil | VNSRRVEAEFVFGRHQAAELPAAYAILVPQRKARIPDNHLE |
| Ga0182038_109979274 | 3300016445 | Soil | VSGRAVEAVFVFDRHAATDLSVAYAILVPARRARMGRAG |
| Ga0187812_11975521 | 3300017821 | Freshwater Sediment | VSGRAVEAEFVFGRHAATELSVAYAILVPQRQARIVR |
| Ga0187856_12557692 | 3300017925 | Peatland | VSDRAVGTEYVFGRHAATDLSVAYAILVQQRRARIRAGQEGRPP |
| Ga0187806_12175951 | 3300017928 | Freshwater Sediment | VNDRTVEAEFVFGRHAATELSVAYAILVPQRQARIVR |
| Ga0187806_13201972 | 3300017928 | Freshwater Sediment | VTGREVEAVFVSGRHAAADLSVAYAILVPQRRARTSRAGQEG |
| Ga0187801_101337834 | 3300017933 | Freshwater Sediment | VNGRKVEAQFVFDRHAATDLSLAYAILVPQRRARIARDGQEGR |
| Ga0187808_102369211 | 3300017942 | Freshwater Sediment | VSGRRVETQFVSGRQAATDLSVAYGILVPQRRARTSRDGQEGQA |
| Ga0184626_102257841 | 3300018053 | Groundwater Sediment | VNDRLVQTEFVFDRHAATDLSVAYAILVPQRRVRIARSGQEASRCHDE |
| Ga0190270_117550321 | 3300018469 | Soil | VSDRLVETESVFDRHAATDLSVAYAILVPQRRARIARAGQE |
| Ga0066669_117373072 | 3300018482 | Grasslands Soil | VNARRIETRFVFDRHAAADLSVAYTILVPQRQARTRRAGP |
| Ga0190267_107897951 | 3300019767 | Soil | VNDRVVETQFVFDRHAATDLSVAYTILVPQRRVRIARAGQ |
| Ga0210399_109506113 | 3300020581 | Soil | VSGRQVETQFVFDRHAATDLSVAYAILVPQRRARIG |
| Ga0179596_102140743 | 3300021086 | Vadose Zone Soil | VSDRAVEMQFVFGRHAATDLSVAYAILVPQRRARIRAGQEGR |
| Ga0210408_107462893 | 3300021178 | Soil | VSGRQVETQFVFDRHAATDLSVAYGILVPQRRARTSRGGQEGQAD |
| Ga0213879_101881991 | 3300021439 | Bulk Soil | VNDRVVTTEYVFDRHAATDLSVAYTILVPQRRARVQQ |
| Ga0210410_117625291 | 3300021479 | Soil | VNNRAVETESVFGRHAATELSVAYAILVPQRRARIARPGQE |
| Ga0209584_101288393 | 3300025878 | Arctic Peat Soil | MPVVETEFVFDRHAATDLSVAYAILVPQRRARTRAGQEGEPQ |
| Ga0207692_106210991 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDRVVETQFVFDRHAATDLSVAYAILVPPRRARLVRAGQE |
| Ga0207692_108973871 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRQRVEAEFVFDRHAATDLSVAYAILVPQRRARIARDG |
| Ga0207699_111906211 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRQRVEAEFVFDRHAATDLSVAYAILVPQRRARIA |
| Ga0207700_102976891 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGRQVETQFVFDRHAATDLSVAYGILVPQRRARTSRGG |
| Ga0207700_106556571 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRQQVETEFVFDRHAASDLSVAYAILVPQRRARIA |
| Ga0207664_102564241 | 3300025929 | Agricultural Soil | VSGRQVETQFVFDRHAATDLSVAYGILVPRRRARTSRGGQEGQ |
| Ga0207664_114670851 | 3300025929 | Agricultural Soil | VNNRAVETESVFGRHAATELSVAYAILVPQRRARIARPGQEGRPQH |
| Ga0207686_100059527 | 3300025934 | Miscanthus Rhizosphere | VVDTEFVFDRHAATDLSVAYAILVPQRRARIGRAGQEGRP |
| Ga0207704_116240361 | 3300025938 | Miscanthus Rhizosphere | VNDRVVETQFVFDRHAATDLSVAYAILVPPRRARL |
| Ga0207639_110143113 | 3300026041 | Corn Rhizosphere | VVDSEFVFDRHAATDLSVAYAILVPQRRARIGRAGQEGRPRNDQC |
| Ga0207708_111884161 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEGPRNDK |
| Ga0257153_10902141 | 3300026490 | Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRRARL |
| Ga0208199_11264851 | 3300027497 | Peatlands Soil | VNDRVVEAEFVFGRHAAADLSVAYAILVPQRQARIA |
| Ga0214469_10489973 | 3300027636 | Soil | MVAGEFVFDRHAAADVSVAYAILVPQRRARIGRPGQEGVS |
| Ga0208565_10227841 | 3300027662 | Peatlands Soil | VSGRAVGTEFVFDRHAAADLSVAYAILVPQRRARIRA |
| Ga0209656_102294163 | 3300027812 | Bog Forest Soil | VNRRRVEAEFVFDRRAATDLSVAYAILVPQRRARIARAGQEGR |
| Ga0209039_101588734 | 3300027825 | Bog Forest Soil | VNRRRVEAEFVFDQRAATDLSVAYAILVPQRRARIAR |
| Ga0209814_100450265 | 3300027873 | Populus Rhizosphere | VNDRLVETEFVFDRHAAADLSVAYAILVPQRRVRIARSGQEASLC |
| Ga0209283_105965403 | 3300027875 | Vadose Zone Soil | VSRRDVEAVFVFDRHAATDLSVAYAILVPQRRARL |
| Ga0307322_101714333 | 3300028710 | Soil | VNERVVETQFVFDRYAATDLSVAYTILVPQRRARV |
| Ga0302220_100820884 | 3300028742 | Palsa | VNGRAVEAVFVFGRHSAADLSVAYAILVPQRRARAA |
| Ga0302224_103416522 | 3300028759 | Palsa | VSDRAVETESVFGRHAATELPVAYAILVPQRQARIVRPGQEGR |
| Ga0307280_101060453 | 3300028768 | Soil | VNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARSG |
| Ga0307288_104855082 | 3300028778 | Soil | VSERAVESEYVFDRYAATDLSVAYAILGPQRQARVRAGQEGTPP |
| Ga0302228_104201731 | 3300028808 | Palsa | VSDRAVETESVFGRHAATELPVAYAILVPQRQARIVRPGQEG |
| Ga0302181_101572931 | 3300030056 | Palsa | VSDRTVETESVFGRHAAAELPVAYAILVPQRRARIVRPGQE |
| Ga0311360_111440261 | 3300030339 | Bog | VSERAVEMVFVFDRLAGTDLSVAYALLLPERRARRAAAQEGRS |
| Ga0302211_101589443 | 3300030491 | Fen | VSERAVEMVFVFDRLAGTDLSVAYAILLPERRARRAAAQ |
| Ga0302183_104347912 | 3300030509 | Palsa | VSDRAVETEFVFGRHAATELSVAYAILVPQRQARIVRPGQEG |
| Ga0307511_104492052 | 3300030521 | Ectomycorrhiza | VSGRLVETEAVFDRHAAADLSAAYAVLVPQRRARVRA |
| Ga0311357_112116281 | 3300030524 | Palsa | VSDRTVETESVFGRHAAAELPVAYAILVPQRRARIVRP |
| Ga0311355_115698371 | 3300030580 | Palsa | VSDRTVETESVFGRHAAAELPVAYAILVPQRRARIVRPGQ |
| Ga0310039_101805323 | 3300030706 | Peatlands Soil | VSDRAVEAEFVFGRHAATELTVAYAILVPQRQARIARPGQEGRPQH |
| Ga0310038_103756761 | 3300030707 | Peatlands Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRQARIVR |
| Ga0302180_100488885 | 3300031028 | Palsa | VNGRKVEVQFVFDRHAATDLSVAYAILVPQRRARTGR |
| Ga0302326_110209811 | 3300031525 | Palsa | VKDRAVETESVFGRHAATELSVAYAILVPQRQARIRAGQEGRPP |
| Ga0302326_121591763 | 3300031525 | Palsa | VNDRAVETESVFGRHAATELSVAYAILVPQRQARIRAGQEGRPP |
| Ga0318538_102959494 | 3300031546 | Soil | VNRRRVETQCVFDRHAATDLSVAYAILVPQRRARIGRA |
| Ga0318571_101069843 | 3300031549 | Soil | VNDRAVEAESVFGRHAAAELSVAYAILVPQRQARIARAGQE |
| Ga0318515_102840291 | 3300031572 | Soil | VNRRRVETQCVFDRHAATDLSVAYAILVPQRRARI |
| Ga0310686_1189577381 | 3300031708 | Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIARA |
| Ga0307476_107945501 | 3300031715 | Hardwood Forest Soil | VSTRAVEAEFVFGRHAASDLSVAYAILVPQRRARIAGAGQKGQ |
| Ga0307468_1013954642 | 3300031740 | Hardwood Forest Soil | VVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEGP |
| Ga0318554_106967381 | 3300031765 | Soil | VNGRRVETEFVFGRHWAADLSAAYAILVPQRKARISARVEKGR |
| Ga0318521_103013421 | 3300031770 | Soil | VNGRPVGAEFVFDRHAAAVLSAAYAILVPQRRARTGRAGQ |
| Ga0318546_108547332 | 3300031771 | Soil | VNGRPVGAEFVFDRHAAAVLSAAYAILVPQRRARTGRAGQEGR |
| Ga0318552_102883361 | 3300031782 | Soil | VNRQQVETKFVFDRHAATDLSVAYAILVPQRQARIARPGQEGQ |
| Ga0318565_100322611 | 3300031799 | Soil | VSSRPVETAFVFDRHAATDLSVAYSILVPQRRGPPGGG |
| Ga0318565_104185871 | 3300031799 | Soil | VKPARVEAEFVFDRHGASDLSLAYAILVPQRRARTSRAGQEGE |
| Ga0318497_104265802 | 3300031805 | Soil | VKPARVEAEFVFDRHGASDLSLAYAILVPQRRARTSRAGREGER |
| Ga0307473_108337572 | 3300031820 | Hardwood Forest Soil | VNDRPVETESVFGRHAATELSVAYAILVPQRQARIAGPGQEG |
| Ga0310917_108565871 | 3300031833 | Soil | VNRQQVETKFVFDRHAATDLSVAYAILVPQRQARIARPGQ |
| Ga0318495_104153233 | 3300031860 | Soil | VNGRPVETEFVFGRHWAAELSAAYAILVPQRKARIPDNHL |
| Ga0306925_107091414 | 3300031890 | Soil | VSGREVETQFVFDRHAATDLSVAYGILVPQRRARTGRAGQEGQ |
| Ga0306925_115544732 | 3300031890 | Soil | VNDRVIETEFVFDRHAATDLSVAYAILVPQRRVRIERADEEG |
| Ga0306923_122826782 | 3300031910 | Soil | VSGRAVEAVFVFDRHAATDLSVAYAILVPARRARMGRAGQE |
| Ga0307412_116931933 | 3300031911 | Rhizosphere | VNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARSGQ |
| Ga0306921_102643084 | 3300031912 | Soil | VTGRAVEAVFCFDRHAASDLSVAYAILVPARRARTGRAGQEG |
| Ga0306926_117156562 | 3300031954 | Soil | VSGRAVEAVFCFDRHAATDLSVAYAILVPARRARTGRAGQE |
| Ga0306926_122381332 | 3300031954 | Soil | VSSRRVEAEFVFGRHWAAELSAAYAILVPQRKARIP |
| Ga0318531_103710333 | 3300031981 | Soil | VNRRRVETQCVFDRHAATDLSVAYAILVPQRRARIGRAGQE |
| Ga0318531_104551141 | 3300031981 | Soil | VNGRRVETEFVFGRHWAAELSAAYAILVPQRKARIPDN |
| Ga0307409_1013319411 | 3300031995 | Rhizosphere | VSERAVESEYVFDRYAATDLSVAYAILGPQRQVRVRAGQE |
| Ga0307409_1019515721 | 3300031995 | Rhizosphere | VNDRLVETEFVFDRHAATDLSVAYAILVPQRRVRIARSGQEASLC |
| Ga0306922_114329341 | 3300032001 | Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRRARIARAGQ |
| Ga0306922_117416381 | 3300032001 | Soil | VNDRAVEAESVFGRHAAAELSVAYAILVPQRQARIARAGQEGRP |
| Ga0307411_114814521 | 3300032005 | Rhizosphere | VTDRVVETESVFDRHAATDLSVAYAILVPQRRARVLRAGQEGR |
| Ga0307411_117863871 | 3300032005 | Rhizosphere | VNERVVETQFVFDRHAATDLSVAYTILVPQRRARVD |
| Ga0318562_101708333 | 3300032008 | Soil | VNDRAVEAEFVFGRHAATELSVAYAILVPQRQARIARAGQEG |
| Ga0318507_101051951 | 3300032025 | Soil | VSSRPVETAFVFDRHAATDLSVAYSILVPQRRARLG |
| Ga0310911_100875293 | 3300032035 | Soil | VSGRAVEAVFCFDRHAATDLSVAYAILVPARRARTGRAGQEGRLPHD |
| Ga0318556_105616322 | 3300032043 | Soil | VKSARVEAEFVFDRHGASDLSLAYAILVPQRRARTSRAGQEGVR |
| Ga0318575_104621141 | 3300032055 | Soil | VNRRRVETQCVFDRHAATDLSVAYAILVPQRRARIGRAGQEGPAHD |
| Ga0306924_118977752 | 3300032076 | Soil | VSGRQVETQFVFDRHAATDLSVAYGILVPQRRARTSRGGQEGQADDE |
| Ga0318525_100573414 | 3300032089 | Soil | VSSRRVEAEFVFGRHWAAELSAAYAILVPQRKARIPAN |
| Ga0311301_124195751 | 3300032160 | Peatlands Soil | VSDRAVEAEFVFGRHAATELSVAYAILVPQRRARNRAGQ |
| Ga0307471_1032188382 | 3300032180 | Hardwood Forest Soil | VNDRVVETEFVFDRHAATDLSVAYTILVPQRRARIERAGKEEG |
| Ga0335079_119681191 | 3300032783 | Soil | VSSRRVEAEFVFGRHWAAELSAAYAILVPQRKARI |
| Ga0335080_108627424 | 3300032828 | Soil | VNRRQVEAEFVFDRHAASDLSVAYAILVPQRRARIA |
| Ga0335084_121819691 | 3300033004 | Soil | VTGRSVEMVFVFDRLVGTDLSVAYAILVPERRARRAAAQKGRS |
| Ga0310914_108606381 | 3300033289 | Soil | VNRQQVETKFVFDRHAATDLSVAYAILVPQRQARIAR |
| Ga0247829_111755431 | 3300033550 | Soil | VNDRVVETQFVFDRHTATDLSVAYTILVPQRRVRIDRAGQEGRPQ |
| Ga0334827_171633_524_661 | 3300034065 | Soil | MSDRVVGTEFVFGRHAATDLSVAYAILVPQRRARIRAGQEGRPPRD |
| ⦗Top⦘ |