| Basic Information | |
|---|---|
| Family ID | F043385 |
| Family Type | Metagenome |
| Number of Sequences | 156 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MIIRKVSGLWIVEREHSGQIVFSHKNRMTCYEWMFKGINYA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.46 % |
| % of genes near scaffold ends (potentially truncated) | 41.67 % |
| % of genes from short scaffolds (< 2000 bps) | 76.92 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.051 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.385 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.744 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.49% β-sheet: 21.74% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 3.85 |
| PF00166 | Cpn10 | 1.28 |
| PF03796 | DnaB_C | 0.64 |
| PF01068 | DNA_ligase_A_M | 0.64 |
| PF01569 | PAP2 | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 3.85 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.28 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.64 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.64 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.64 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.05 % |
| All Organisms | root | All Organisms | 42.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 19.87% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.82% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 8.97% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 8.33% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.77% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.56% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.92% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.92% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.28% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.28% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.28% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.64% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.64% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.64% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.64% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.64% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.64% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876005 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_0503781 | 2236876005 | Marine Estuarine | INKDNMIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFNGISYA |
| DelMOSum2010_100951614 | 3300000101 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGVHYA* |
| DelMOSum2011_100197074 | 3300000115 | Marine | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFKGINYA* |
| DelMOSum2011_100810462 | 3300000115 | Marine | MVIRKVSGLWIVEREHSGQIVFSHKNRMTCYEWMFKGINYA* |
| DelMOSum2011_101048123 | 3300000115 | Marine | MIIRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGIHYA* |
| DelMOSum2011_101569913 | 3300000115 | Marine | MIIRKVKDLWIVQAKHSQQIVFSHKNRMTCYEWIFSGVNYA* |
| DelMOSum2011_101851372 | 3300000115 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFK |
| DelMOSpr2010_101255323 | 3300000116 | Marine | MIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGINYA* |
| DelMOSpr2010_101534813 | 3300000116 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGLHYA* |
| DelMOWin2010_100328293 | 3300000117 | Marine | MIIRKVSGLWIVEREHSGQIVFSHKNRMTCYEWMFKGINYA* |
| DelMOWin2010_100760094 | 3300000117 | Marine | MIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA* |
| DelMOWin2010_100811573 | 3300000117 | Marine | MVIRKVAGLWIVQAKHSQNIVFSHKNRMTCYEWIFNKYVHYA* |
| DelMOWin2010_100853803 | 3300000117 | Marine | MQIKIGIKNNNMIVRKVKDLWIVQTRHSQQIVFSHTNRMTCYEWMFKSVYYA* |
| DelMOWin2010_101473422 | 3300000117 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGINYA* |
| BBAY92_100950894 | 3300000947 | Macroalgal Surface | DGLWIVQREKCQQILFSHKKQMECYEWIFSKYVHYA* |
| JGI24006J15134_100775744 | 3300001450 | Marine | MIIRKVSGLWIVEREHSGQIVFSHKKRMTCYEWIFKSVNYA* |
| JGI24006J15134_101468073 | 3300001450 | Marine | MIIRKVKDLWIVQARHSQQIVFSHKNRMTCYEWIFKGINYA* |
| JGI24006J15134_101775961 | 3300001450 | Marine | NNMIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFNGISYA* |
| JGI24004J15324_100519004 | 3300001472 | Marine | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFNGISYA* |
| KVRMV2_1000787094 | 3300002231 | Marine Sediment | MIVRKVNELWIVQRKHSHQIVFSHKNVMKCYEWIFKSVNYA* |
| KVRMV2_1012694342 | 3300002231 | Marine Sediment | MIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWIFKSVNYA* |
| KVWGV2_103395802 | 3300002242 | Marine Sediment | MIIRKVSGLWIVEREHSGQIVFSXKNQMTCYEWIFKSVNYA* |
| Ga0068511_10627792 | 3300005057 | Marine Water | MIIRKVSGLWIVQRKHSHQIVFSHKNVMECYEYLFKSVNYA* |
| Ga0075466_10164428 | 3300006029 | Aqueous | MQIKIGIKNNNMIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGVHYA* |
| Ga0075466_11566361 | 3300006029 | Aqueous | NNMIIRKVSGLWIVERQHSGQIVFSHKKRMTCYEWIFKSVNYA* |
| Ga0070744_101926972 | 3300006484 | Estuarine | MIIRKVKDLWIVQARYSQQIVFSHKNRMTCYEWIFKGINYA* |
| Ga0098038_10914913 | 3300006735 | Marine | MIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGVHYA* |
| Ga0098038_11037683 | 3300006735 | Marine | MIIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINYA* |
| Ga0098038_12513381 | 3300006735 | Marine | NNNMIIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINYA* |
| Ga0098038_12899831 | 3300006735 | Marine | SKTIKIVRKVSGIWVVQRKHSQQIVFSHKNVMKAYEYLFKQVNYA* |
| Ga0098037_10149587 | 3300006737 | Marine | MIIRKVAGLWIVQRQHSQQIIFSHKSRMTCYEWIFKSVHYA* |
| Ga0098037_12722361 | 3300006737 | Marine | EDMIIRKVAGLWIVQRQHSHQIIFSHKSRMTCYEWIFKSVNYA* |
| Ga0098042_11134033 | 3300006749 | Marine | MIIRKVSGLWIVQRKHSQQIIFSHKSRMTCYEWIFKSVNY |
| Ga0098042_11249611 | 3300006749 | Marine | KVSGLWIVQRKHSQQIIFSHKSRMTCYEWIFKSVNYA* |
| Ga0098048_10631324 | 3300006752 | Marine | MIIRKVGGLWIVQKSYDQQIVFSHKNRMTCYEWIFKSVNYA* |
| Ga0098048_12082192 | 3300006752 | Marine | MIIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWIFKGINYA* |
| Ga0098044_10780733 | 3300006754 | Marine | MKVKCVGGLWIVQLNYSQQIVFSHKSEKECYEWVFKSVNYA* |
| Ga0098054_11186793 | 3300006789 | Marine | MIIRKVSGLWIVEREYSGQIIFSHKSRMTCYEWMFKGINYA* |
| Ga0098055_10411774 | 3300006793 | Marine | MIIRKVKDLWIVQAKHSQQIVFSHKNRMTCYEWLFKGINYA* |
| Ga0098055_11615671 | 3300006793 | Marine | MIIRKVSGLWIVQREHSGQIVFSHKKRMTCYEWIFKSVNY |
| Ga0098055_12998861 | 3300006793 | Marine | MIIRKVSGLWIVEREHSGQIIFSHKKRMTCYEWIFKGINYA* |
| Ga0098055_13631692 | 3300006793 | Marine | MIIRKVSGLWIVEREYSGQIVFSHKKRMTCYEWIFKSVNYA* |
| Ga0070750_100492335 | 3300006916 | Aqueous | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFNGINYA* |
| Ga0070750_101148722 | 3300006916 | Aqueous | MIIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFNGINYA* |
| Ga0070750_101610512 | 3300006916 | Aqueous | MIVRKVKDLWIVQAKHSQQIVFSHKNRMTCYEWMFKGINYA* |
| Ga0070750_102016552 | 3300006916 | Aqueous | MIVRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFKGINYA* |
| Ga0070746_102655453 | 3300006919 | Aqueous | MIIRKVAGLWIVQARHSQNIVFSHKNRMTCYEWIFSK |
| Ga0070746_103456773 | 3300006919 | Aqueous | NNNMIIRKVAGLWIVQARHSQNIVFSHKNRMTCYEWIFSKYVHYA* |
| Ga0070748_13328273 | 3300006920 | Aqueous | MQIKIGIKNNNMIVRKVKNLWIVQAKHSQQIVFSHKNRMTCYEWMFK |
| Ga0098060_10392865 | 3300006921 | Marine | MIIRKVGGLWIVQKEYDQQIVFSHKRRMVCYEWIFKGINYA* |
| Ga0098060_10854812 | 3300006921 | Marine | MIIRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFKGINYA* |
| Ga0098060_11183453 | 3300006921 | Marine | MIVRKVKDLWIVQAKHSQQIVFSHTNRITCYEWMFKGLHYA* |
| Ga0098045_10414433 | 3300006922 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGMHYA* |
| Ga0098041_13042272 | 3300006928 | Marine | MIIRKVGGLWIVQREKSQQILFSHKKQMECYEWIFTKYVHYA* |
| Ga0098046_11231361 | 3300006990 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKG |
| Ga0070752_13578013 | 3300007345 | Aqueous | RKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGINYA* |
| Ga0099847_10192211 | 3300007540 | Aqueous | MIIRKVSGLWIVERQHSGQIVFSHKNQMTCYEWMFKGINYA* |
| Ga0105746_10478473 | 3300007973 | Estuary Water | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFKGVHYA* |
| Ga0114904_10163742 | 3300008218 | Deep Ocean | MIIRKVNGLWIVERQHSKQIVFSHKNLMTCYEWMFKSINYA* |
| Ga0114905_10785763 | 3300008219 | Deep Ocean | MIIRKVGGIWIVQRQHSQQILFSHKKQMECYEWIFTKYVHYA* |
| Ga0114910_11255291 | 3300008220 | Deep Ocean | GLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA* |
| Ga0114909_11013901 | 3300009414 | Deep Ocean | INNNNMIIRKVSGLWIVEREHSGQILFSHKNQMTCYEWIFKGINYA* |
| Ga0115546_13061541 | 3300009435 | Pelagic Marine | MIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKG |
| Ga0115556_10759944 | 3300009437 | Pelagic Marine | MIIRKVKDLWIVQAKHSQQIVFSHKNRMTCYEWMFKGINYA* |
| Ga0114932_106651032 | 3300009481 | Deep Subsurface | MIIRKVGGIWIVQRQHSQQILFSHKKQMECYEWIFTKYV |
| Ga0114911_10890422 | 3300009603 | Deep Ocean | MIIRKVSGLWIVEREHSGQILFSHKNQMTCYEWIFKGINYA* |
| Ga0114906_10784111 | 3300009605 | Deep Ocean | VGGIWIVQRQHSQQILFSHKKQMECYEWIFTKYVHYA* |
| Ga0114906_11111281 | 3300009605 | Deep Ocean | NNMIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA* |
| Ga0114912_11347391 | 3300009620 | Deep Ocean | SGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA* |
| Ga0098049_12355681 | 3300010149 | Marine | MIIRKVGGLWIVQKSYDQQIVFSHKNRMTCYEWIFKSVNY |
| Ga0160423_1000867514 | 3300012920 | Surface Seawater | MIVRKVGGLWIVQAKTSQQIVFSHKSKTACYEWMFKDVHYA* |
| Ga0160423_100544974 | 3300012920 | Surface Seawater | MIIRKVGGIWIVQRQHSNQIIFSHKNRMTCYEWIFKSVHYA* |
| Ga0160423_100784645 | 3300012920 | Surface Seawater | MIVRKVAGLWIVQAKTSNQIVFSHKSKMACYEWMFKGVHYA* |
| Ga0160423_101020144 | 3300012920 | Surface Seawater | MIVRKVSGLWIVQTKHSKQIVFSHKNMMECYEWMFKSVNYA* |
| Ga0181377_10481592 | 3300017706 | Marine | MIVRKVKDLWIVQAKHSQQIVFSHKNRITCYEWMFKGINYA |
| Ga0181387_10968441 | 3300017709 | Seawater | RKVSGLWIVERQHSGQIVFSHKSRMTCYEWMFKGINYA |
| Ga0181391_11093541 | 3300017713 | Seawater | MIIRKVSGLWIVEREHSGQIVFSHKNRMTCYEWMFKGINYA |
| Ga0181412_10348831 | 3300017714 | Seawater | MIIRKVSGLWIVQRKHNHQIIFSHKNRMTCYEWIFKS |
| Ga0181398_10255671 | 3300017725 | Seawater | MIIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINY |
| Ga0181417_10136011 | 3300017730 | Seawater | MIIRKVGGLWIVQKEYDNQIVFSHKRRMVCYEWIFDKVNYA |
| Ga0181416_10020017 | 3300017731 | Seawater | MIIRKVAGLWIVQAQHSQNIVFSHKNRMTCYEWIFSKYVHYA |
| Ga0181433_11473931 | 3300017739 | Seawater | NNNNMIIRKVSGLWIVEREHSGQILFSHKNQMTCYEWMFKGINYA |
| Ga0181418_11233573 | 3300017740 | Seawater | LFRSGTEKINNMIIRKVSGLWIVEREHSGQILFSHKNQMTCYEWMFKGINYA |
| Ga0181421_11767092 | 3300017741 | Seawater | MIVRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFKGIN |
| Ga0181427_10132916 | 3300017745 | Seawater | MYIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA |
| Ga0181392_11673431 | 3300017749 | Seawater | MIIRKVKDLWIVQAKHSQQIVFSHKNRMTCYEWIFKG |
| Ga0181392_11835182 | 3300017749 | Seawater | MIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWLFKGINYA |
| Ga0181405_10073361 | 3300017750 | Seawater | MIIRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFKGINY |
| Ga0181400_11057264 | 3300017752 | Seawater | NNMIIRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFKGINYA |
| Ga0181400_11430592 | 3300017752 | Seawater | MIIRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFK |
| Ga0181411_11513191 | 3300017755 | Seawater | NNNNMIIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINYA |
| Ga0181382_11401051 | 3300017756 | Seawater | KVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINYA |
| Ga0181420_10815381 | 3300017757 | Seawater | IYINNNNNMIIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINYA |
| Ga0181409_10094254 | 3300017758 | Seawater | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFKGISYA |
| Ga0181414_11186541 | 3300017759 | Seawater | NNNNMIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA |
| Ga0181414_11655692 | 3300017759 | Seawater | MIIRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFKGI |
| Ga0181408_12044591 | 3300017760 | Seawater | MIVRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFK |
| Ga0181410_11220091 | 3300017763 | Seawater | MIIRKVKDLWIVQARHSQQIVFSHTNRITCYEWMFK |
| Ga0181410_11520491 | 3300017763 | Seawater | NMIIRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFKGINYA |
| Ga0181385_10968852 | 3300017764 | Seawater | MIIRKVGGLWIVQKSYDQQIVFSHKKRMVCYEWIFSKYVHYA |
| Ga0181413_10087184 | 3300017765 | Seawater | MKIRKVSGLWIVEREHSGQILFSHKNQMTCYEWMFKGINYA |
| Ga0181406_12341222 | 3300017767 | Seawater | RSKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA |
| Ga0187221_10117453 | 3300017769 | Seawater | MIIRKVSGLWIVEREHSGQIIFSHKSRMTCNEWQFKGINYA |
| Ga0181395_11029731 | 3300017779 | Seawater | IRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINYA |
| Ga0181423_10220926 | 3300017781 | Seawater | MIIRKVSGLWIVEREHSGQIVFSHKNRMTCYEWMFKGVHYA |
| Ga0181558_101316851 | 3300018417 | Salt Marsh | VSGLWIVEREHSGQIVFSHKSRMTCYEWIFKSVNYA |
| Ga0211653_1000243814 | 3300020421 | Marine | MIIRKVSGLWIVQRKHNHQIIFSHKSRMTCYEWIFKSVNYA |
| Ga0211521_100545424 | 3300020428 | Marine | MIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA |
| Ga0211577_101682012 | 3300020469 | Marine | MIIRKVSGLWIVEREHSGQIIFSHKSRMTCYEWMFKGINYA |
| Ga0206126_101510992 | 3300020595 | Seawater | MIIRKVSGLWIVERQHSGQIIFSHKNRMTCYEWMFKGINYA |
| Ga0213869_104687741 | 3300021375 | Seawater | MQIKIGIKNNNMIVRKVKDLWIVQTRHSQQIVFSHTNRMTCYEWMFKGVHYA |
| Ga0212021_11264572 | 3300022068 | Aqueous | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFK |
| Ga0196889_10049066 | 3300022072 | Aqueous | MIIRKVSGLWIVERQHSGQIVFSHKKRMTCYEWIFKSVNYA |
| Ga0196887_100627210 | 3300022178 | Aqueous | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFNGINYA |
| Ga0196887_10690812 | 3300022178 | Aqueous | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFKGINYA |
| Ga0196899_10226426 | 3300022187 | Aqueous | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGVHYA |
| (restricted) Ga0233432_100993043 | 3300023109 | Seawater | MIVRKIKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGIHYA |
| (restricted) Ga0255039_100500732 | 3300024062 | Seawater | MIVRKIKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGVHYA |
| Ga0209992_101442611 | 3300024344 | Deep Subsurface | MIIRKVGGLWIVQREKSQQILFSHKKQMECYEWIFTKYVHYA |
| Ga0209992_103054254 | 3300024344 | Deep Subsurface | IIRKVSGLWIVQRRHSHQIVFSHKNVMECYEWMFKTVNYA |
| Ga0208667_100438014 | 3300025070 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGMHYA |
| Ga0208667_10447982 | 3300025070 | Marine | MIIRKVGGLWIVQKSYDQQIVFSHKNRMTCYEWIFKSVNYA |
| Ga0208157_10128144 | 3300025086 | Marine | MIIRKVAGLWIVQRQHSQQIIFSHKSRMTCYEWIFKSVHYA |
| Ga0208157_10759002 | 3300025086 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGLHYA |
| Ga0208669_100793910 | 3300025099 | Marine | MIIRKVGGLWIVQKEYDQQIVFSHKRRMVCYEWIFKGINYA |
| Ga0208669_10421182 | 3300025099 | Marine | MIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGVHYA |
| Ga0208159_10538413 | 3300025101 | Marine | MIIRKVSGLWIVQRKHNHQIVFSHKNVMQCYEWIFKSV |
| Ga0208666_10379083 | 3300025102 | Marine | MIVRKVKDLWIVQARHSQQIVFSHTNRITCYEWMFKGLHYA |
| Ga0209535_10329458 | 3300025120 | Marine | MIIRKVSGLWIVERQHSGQIVFSHKNRMTCYEWMFNGISYA |
| Ga0209756_12087981 | 3300025141 | Marine | YIIRKVSGLWIVETTHSKQIVFSHKDLMTAYKWQFKQVAL |
| Ga0209645_10217552 | 3300025151 | Marine | MIIRKVSGLWIVQAKTSGQIVFSHKSKMACYEWTFKGVHYA |
| Ga0208029_10699594 | 3300025264 | Deep Ocean | MIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINY |
| Ga0208179_10495241 | 3300025267 | Deep Ocean | IYTDKINNMIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA |
| Ga0208030_100253615 | 3300025282 | Deep Ocean | MIIRKVSGLWIVEREHSGQILFSHKNQMTCYEWIFKGINYA |
| Ga0208030_11242761 | 3300025282 | Deep Ocean | VGGIWIVQRQHSQQILFSHKKQMECYEWIFTKYVHYA |
| Ga0208030_11587001 | 3300025282 | Deep Ocean | MIIRKVSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGIN |
| Ga0208450_10828251 | 3300025301 | Deep Ocean | VSGLWIVEREHSGQIVFSHKNQMTCYEWMFKGINYA |
| Ga0208643_10726771 | 3300025645 | Aqueous | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGV |
| Ga0208134_10622472 | 3300025652 | Aqueous | MIVRKVKDLWIVQAKHSQQIVFSHKNRMTCYEWMFKGINYA |
| Ga0208795_10560732 | 3300025655 | Aqueous | MIIRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGLH |
| Ga0209305_11317811 | 3300025712 | Pelagic Marine | NNMIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGINYA |
| Ga0208133_10251496 | 3300027631 | Estuarine | VRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGVHYA |
| Ga0256382_10523434 | 3300028022 | Seawater | MIIRKVDGLWIVQREKSQQILFSHKKQMECYEWIFTKYVHYA |
| Ga0183683_10172136 | 3300029309 | Marine | NNNMIVRKVSGLWIVQTKHSKQIVFSHKNMMECYEWMFKSVNYA |
| Ga0183683_10472461 | 3300029309 | Marine | NKNKVKLIELNNMIVRKVSGLWIVQTKHSKQIVFSHKNMMECYEWMFKSVNYA |
| Ga0183755_10091272 | 3300029448 | Marine | MIIRKVNGLWIVERQHSKQIVFSHKNLMTCYEWMFKSINYA |
| Ga0183755_10290092 | 3300029448 | Marine | MIIRKVGGIWIVQRQHSQQILFSHKKQMECYEWIFTKYVHYA |
| Ga0183755_10641442 | 3300029448 | Marine | MIIRKVSGLWIVEREYSGQIVFSHKNQMTCYEWMFKGINYA |
| Ga0183757_10104814 | 3300029787 | Marine | MIIRKVGGLWIVQREKSQQILFSHKKQMVCYEWMFKGINYA |
| Ga0315322_100407219 | 3300031766 | Seawater | MIIRKVSGLWIVEREHSGQIIFSHKKRMTCYEWIFKSVNYA |
| Ga0315332_104914943 | 3300031773 | Seawater | MIIRKVAGLWIVQAQHSQNIVFSHKNRMTCYEWIF |
| Ga0315316_100695426 | 3300032011 | Seawater | MIIRKVSGLWIVEREHSGQILFSHKNQMTCYEWMFKGINYA |
| Ga0315315_112917024 | 3300032073 | Seawater | IIRKVSGLWIVEREHSGQIVFSHKSRMTCYEWMFKGINYA |
| Ga0316203_11077721 | 3300032274 | Microbial Mat | INNMIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGVHYA |
| Ga0316202_101018481 | 3300032277 | Microbial Mat | MIVRKVKDLWIVQARHSQQIVFSHTNRMTCYEWMFKGINYA |
| Ga0348335_009434_5181_5339 | 3300034374 | Aqueous | MQIKIGIKNNNMIVRKVKDLWIVQARHSQQIVFSHKNRMTCYEWMFKGVHYA |
| ⦗Top⦘ |