| Basic Information | |
|---|---|
| Family ID | F043280 |
| Family Type | Metagenome |
| Number of Sequences | 156 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MATNIDKALYQQPTGIDALAQDEEAIEIEIVDPEEVNI |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 89.80 % |
| % of genes near scaffold ends (potentially truncated) | 94.23 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.692 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.949 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.410 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.76% β-sheet: 0.00% Coil/Unstructured: 74.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 83.33 |
| PF01726 | LexA_DNA_bind | 0.64 |
| PF13403 | Hint_2 | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.69 % |
| All Organisms | root | All Organisms | 42.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_107715744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 523 | Open in IMG/M |
| 3300001523|JGI1221J15618_1227390 | Not Available | 1049 | Open in IMG/M |
| 3300002307|JGI24890J29729_1050584 | Not Available | 760 | Open in IMG/M |
| 3300003375|JGI26470J50227_1015995 | Not Available | 1742 | Open in IMG/M |
| 3300003798|Ga0007842_1004619 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300003815|Ga0007856_1008320 | Not Available | 713 | Open in IMG/M |
| 3300004692|Ga0065171_1013132 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300004692|Ga0065171_1069673 | Not Available | 556 | Open in IMG/M |
| 3300004807|Ga0007809_10022847 | Not Available | 2181 | Open in IMG/M |
| 3300005662|Ga0078894_10956123 | Not Available | 740 | Open in IMG/M |
| 3300006105|Ga0007819_1045660 | Not Available | 955 | Open in IMG/M |
| 3300006114|Ga0007815_1044066 | Not Available | 949 | Open in IMG/M |
| 3300006119|Ga0007866_1063384 | Not Available | 691 | Open in IMG/M |
| 3300006805|Ga0075464_10832486 | Not Available | 574 | Open in IMG/M |
| 3300006863|Ga0075459_1010257 | Not Available | 1532 | Open in IMG/M |
| 3300006863|Ga0075459_1091043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 524 | Open in IMG/M |
| 3300006875|Ga0075473_10325590 | Not Available | 622 | Open in IMG/M |
| 3300006920|Ga0070748_1003695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6953 | Open in IMG/M |
| 3300006920|Ga0070748_1026592 | All Organisms → Viruses → Predicted Viral | 2394 | Open in IMG/M |
| 3300006920|Ga0070748_1094107 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300006920|Ga0070748_1196318 | Not Available | 739 | Open in IMG/M |
| 3300006920|Ga0070748_1297985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 574 | Open in IMG/M |
| 3300007344|Ga0070745_1125095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
| 3300007363|Ga0075458_10151152 | Not Available | 718 | Open in IMG/M |
| 3300007363|Ga0075458_10268604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 518 | Open in IMG/M |
| 3300007542|Ga0099846_1224258 | Not Available | 657 | Open in IMG/M |
| 3300007547|Ga0102875_1274478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 513 | Open in IMG/M |
| 3300007708|Ga0102859_1034653 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300007708|Ga0102859_1098227 | Not Available | 842 | Open in IMG/M |
| 3300008113|Ga0114346_1278450 | Not Available | 596 | Open in IMG/M |
| 3300008116|Ga0114350_1019682 | Not Available | 2821 | Open in IMG/M |
| 3300008120|Ga0114355_1231529 | Not Available | 559 | Open in IMG/M |
| 3300008259|Ga0114841_1213048 | Not Available | 681 | Open in IMG/M |
| 3300009037|Ga0105093_10320525 | Not Available | 829 | Open in IMG/M |
| 3300009082|Ga0105099_10006610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6120 | Open in IMG/M |
| 3300009082|Ga0105099_10549249 | Not Available | 704 | Open in IMG/M |
| 3300009151|Ga0114962_10218468 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
| 3300009155|Ga0114968_10559389 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 609 | Open in IMG/M |
| 3300009163|Ga0114970_10259046 | Not Available | 1003 | Open in IMG/M |
| 3300009165|Ga0105102_10751951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 551 | Open in IMG/M |
| 3300009165|Ga0105102_10863385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 519 | Open in IMG/M |
| 3300009168|Ga0105104_10071406 | All Organisms → Viruses → Predicted Viral | 1876 | Open in IMG/M |
| 3300009175|Ga0073936_10658022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 589 | Open in IMG/M |
| 3300009182|Ga0114959_10028186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3456 | Open in IMG/M |
| 3300009184|Ga0114976_10604816 | Not Available | 556 | Open in IMG/M |
| 3300009185|Ga0114971_10419057 | Not Available | 758 | Open in IMG/M |
| 3300010158|Ga0114960_10099839 | All Organisms → Viruses → Predicted Viral | 1617 | Open in IMG/M |
| 3300010885|Ga0133913_11333088 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300011011|Ga0139556_1021648 | Not Available | 933 | Open in IMG/M |
| 3300012348|Ga0157140_10008764 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300012352|Ga0157138_1006142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2006 | Open in IMG/M |
| 3300012667|Ga0157208_10003739 | All Organisms → Viruses → Predicted Viral | 2642 | Open in IMG/M |
| 3300012964|Ga0153916_12585464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 572 | Open in IMG/M |
| 3300014811|Ga0119960_1011320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300017701|Ga0181364_1029799 | Not Available | 883 | Open in IMG/M |
| 3300017723|Ga0181362_1032414 | Not Available | 1112 | Open in IMG/M |
| 3300017736|Ga0181365_1038574 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1202 | Open in IMG/M |
| 3300017747|Ga0181352_1063857 | Not Available | 1050 | Open in IMG/M |
| 3300017747|Ga0181352_1095629 | Not Available | 818 | Open in IMG/M |
| 3300017747|Ga0181352_1123529 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 696 | Open in IMG/M |
| 3300017754|Ga0181344_1070650 | Not Available | 1030 | Open in IMG/M |
| 3300017754|Ga0181344_1144939 | Not Available | 679 | Open in IMG/M |
| 3300017761|Ga0181356_1017074 | All Organisms → Viruses → Predicted Viral | 2692 | Open in IMG/M |
| 3300017766|Ga0181343_1123363 | Not Available | 728 | Open in IMG/M |
| 3300017777|Ga0181357_1020170 | All Organisms → Viruses → Predicted Viral | 2650 | Open in IMG/M |
| 3300017777|Ga0181357_1035411 | Not Available | 1966 | Open in IMG/M |
| 3300017777|Ga0181357_1207735 | Not Available | 696 | Open in IMG/M |
| 3300017777|Ga0181357_1293051 | Not Available | 554 | Open in IMG/M |
| 3300017780|Ga0181346_1138944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 918 | Open in IMG/M |
| 3300017784|Ga0181348_1251608 | Not Available | 611 | Open in IMG/M |
| 3300017785|Ga0181355_1139730 | Not Available | 982 | Open in IMG/M |
| 3300019784|Ga0181359_1067229 | Not Available | 1362 | Open in IMG/M |
| 3300019784|Ga0181359_1268644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 507 | Open in IMG/M |
| 3300020048|Ga0207193_1866356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 519 | Open in IMG/M |
| 3300020159|Ga0211734_11206806 | Not Available | 705 | Open in IMG/M |
| 3300020160|Ga0211733_10256157 | Not Available | 1515 | Open in IMG/M |
| 3300020161|Ga0211726_10994933 | Not Available | 754 | Open in IMG/M |
| 3300020172|Ga0211729_10489960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 510 | Open in IMG/M |
| 3300020733|Ga0214172_1043805 | Not Available | 643 | Open in IMG/M |
| 3300021519|Ga0194048_10234308 | Not Available | 672 | Open in IMG/M |
| 3300021961|Ga0222714_10167776 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300021961|Ga0222714_10323988 | Not Available | 837 | Open in IMG/M |
| 3300021961|Ga0222714_10427500 | Not Available | 694 | Open in IMG/M |
| 3300021962|Ga0222713_10116760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1886 | Open in IMG/M |
| 3300022190|Ga0181354_1012878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2516 | Open in IMG/M |
| 3300022190|Ga0181354_1078513 | Not Available | 1090 | Open in IMG/M |
| 3300022190|Ga0181354_1159029 | Not Available | 701 | Open in IMG/M |
| 3300022190|Ga0181354_1249953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
| 3300022407|Ga0181351_1115870 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300022407|Ga0181351_1205835 | Not Available | 653 | Open in IMG/M |
| 3300022747|Ga0228703_1020793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2119 | Open in IMG/M |
| 3300024506|Ga0255168_1067133 | Not Available | 566 | Open in IMG/M |
| 3300025316|Ga0209697_10568353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 505 | Open in IMG/M |
| 3300025379|Ga0208738_1033193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300025381|Ga0208871_1027615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 821 | Open in IMG/M |
| 3300025382|Ga0208256_1028383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 813 | Open in IMG/M |
| 3300025445|Ga0208424_1007631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1213 | Open in IMG/M |
| 3300025606|Ga0207954_1097737 | Not Available | 730 | Open in IMG/M |
| 3300025653|Ga0208428_1132095 | Not Available | 681 | Open in IMG/M |
| 3300025781|Ga0208386_1040361 | Not Available | 648 | Open in IMG/M |
| 3300025887|Ga0208544_10017849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3877 | Open in IMG/M |
| 3300027320|Ga0208923_1096438 | Not Available | 522 | Open in IMG/M |
| 3300027578|Ga0255075_1040651 | Not Available | 859 | Open in IMG/M |
| 3300027586|Ga0208966_1096308 | Not Available | 814 | Open in IMG/M |
| 3300027708|Ga0209188_1196749 | Not Available | 728 | Open in IMG/M |
| 3300027733|Ga0209297_1368520 | Not Available | 516 | Open in IMG/M |
| 3300027734|Ga0209087_1217503 | Not Available | 723 | Open in IMG/M |
| 3300027734|Ga0209087_1290836 | Not Available | 587 | Open in IMG/M |
| 3300027749|Ga0209084_1333874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 561 | Open in IMG/M |
| 3300027762|Ga0209288_10302209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 533 | Open in IMG/M |
| 3300027777|Ga0209829_10388014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 545 | Open in IMG/M |
| 3300027785|Ga0209246_10109911 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
| 3300027793|Ga0209972_10364193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300027896|Ga0209777_10528687 | Not Available | 865 | Open in IMG/M |
| 3300027896|Ga0209777_10910561 | Not Available | 608 | Open in IMG/M |
| 3300027976|Ga0209702_10129423 | Not Available | 1140 | Open in IMG/M |
| 3300031758|Ga0315907_10123934 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
| 3300031787|Ga0315900_10338005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1223 | Open in IMG/M |
| 3300031951|Ga0315904_10129529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2595 | Open in IMG/M |
| 3300031963|Ga0315901_10272508 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
| 3300031999|Ga0315274_10230057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2271 | Open in IMG/M |
| 3300032116|Ga0315903_10436406 | Not Available | 1055 | Open in IMG/M |
| 3300032116|Ga0315903_10575266 | Not Available | 871 | Open in IMG/M |
| 3300032116|Ga0315903_10816413 | Not Available | 679 | Open in IMG/M |
| 3300032116|Ga0315903_10921166 | Not Available | 622 | Open in IMG/M |
| 3300032117|Ga0316218_1202449 | Not Available | 710 | Open in IMG/M |
| 3300032156|Ga0315295_11272033 | Not Available | 718 | Open in IMG/M |
| 3300032173|Ga0315268_10443747 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| 3300032173|Ga0315268_11561938 | Not Available | 672 | Open in IMG/M |
| 3300032177|Ga0315276_12349604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 537 | Open in IMG/M |
| 3300032256|Ga0315271_11796669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 526 | Open in IMG/M |
| 3300032562|Ga0316226_1323597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 585 | Open in IMG/M |
| 3300032579|Ga0316228_1168139 | Not Available | 734 | Open in IMG/M |
| 3300032605|Ga0316232_1305262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 594 | Open in IMG/M |
| 3300033992|Ga0334992_0476936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 544 | Open in IMG/M |
| 3300034061|Ga0334987_0261445 | Not Available | 1173 | Open in IMG/M |
| 3300034062|Ga0334995_0090879 | All Organisms → Viruses → Predicted Viral | 2343 | Open in IMG/M |
| 3300034092|Ga0335010_0436368 | Not Available | 706 | Open in IMG/M |
| 3300034093|Ga0335012_0575044 | Not Available | 524 | Open in IMG/M |
| 3300034104|Ga0335031_0386572 | Not Available | 884 | Open in IMG/M |
| 3300034106|Ga0335036_0413689 | Not Available | 863 | Open in IMG/M |
| 3300034120|Ga0335056_0248269 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300034168|Ga0335061_0530521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 597 | Open in IMG/M |
| 3300034200|Ga0335065_0329132 | Not Available | 957 | Open in IMG/M |
| 3300034200|Ga0335065_0446053 | Not Available | 785 | Open in IMG/M |
| 3300034272|Ga0335049_0438532 | Not Available | 846 | Open in IMG/M |
| 3300034356|Ga0335048_0092156 | Not Available | 1839 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 12.18% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.13% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.49% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.21% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.56% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 1.28% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.64% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.64% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.64% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.64% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.64% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.64% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.64% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020712 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025403 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025487 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032579 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1077157441 | 3300001213 | Wetland | MATNIDKALYQQPQGIADAAENEEPIEIEIIDPEEVNIHAG |
| JGI1221J15618_12273902 | 3300001523 | Hypersaline | MATNIDRVLNQQPMGIEELAQNEEPIEIEIVDPEAVNISVGDL |
| JGI24890J29729_10505841 | 3300002307 | Lentic | MAIDKGLYQAPQGIEDLAQNEEPIEIEIIDPEEVDIHAGDT |
| JGI26470J50227_10159951 | 3300003375 | Freshwater | MATNIDKALYSDTQGAGPDQADEPIEIEIVDPEAVKIHAGDMEMELKPDGEGD |
| Ga0007846_10024822 | 3300003797 | Freshwater | LYQAPEGIDALAAKEQPLEIEVVNPEEVTIGMDGLEITLTPDX* |
| Ga0007842_10046191 | 3300003798 | Freshwater | MATNIDKALYSDNQGIAAAHSDEPIEIEVIDPEAVKIHAGDLDIEIKPD |
| Ga0007856_10083201 | 3300003815 | Freshwater | MATNIDKALYSDTQGIAAQHSDEPIEIEVIDPEAVHITAGDMELDIEKA |
| Ga0065171_10131323 | 3300004692 | Freshwater | MATNIDKALYSDTQGADPSHIDEPIEIEIVDPEAVKIHAG |
| Ga0065171_10696731 | 3300004692 | Freshwater | MATNIDKALYSDTQGADPSHVDEPIEIEIVDPEAVKIHAG |
| Ga0007804_11420861 | 3300004770 | Freshwater | MAIDKALYQAPEGIDALAAKEVPLEIEVVNPEEVTIGMDG |
| Ga0007809_100228473 | 3300004807 | Freshwater | MATNIDKALYSDTQGADPSHIDEPIEIEIVDPEAVKIHAGDL |
| Ga0078894_109561231 | 3300005662 | Freshwater Lake | MATNIDKALYQQPAGLDELAYHQEPIEIEIIDPEAVRIDMGDVEID |
| Ga0007819_10456603 | 3300006105 | Freshwater | MAIDKGLYQAPQGIEDLAQNEEPIEIEIIDPEEVDIHAG |
| Ga0007815_10440661 | 3300006114 | Freshwater | MAIDKGLYQAPQGIEDLAQNEEPIEIEIIDPEEVDIH |
| Ga0007866_10633844 | 3300006119 | Freshwater | MATNIDKALYSDTQGADPSHVDEPIEIEIVDPEAVKIHAGDL |
| Ga0007852_11189052 | 3300006123 | Freshwater | MAIDKALYQAPEGIDALAAKEVPLEIEVVNPEEVTIGMD |
| Ga0075464_108324861 | 3300006805 | Aqueous | MATNIDKALFQAPQGLESEAEGAEPIEIEIVDPEEVNISAGDL |
| Ga0075459_10102573 | 3300006863 | Aqueous | MATNIDKALFQAPQGLESEAEGAEPIEIEIVDPEEVNIS |
| Ga0075459_10910431 | 3300006863 | Aqueous | MATNIDKALYQNPQGIAGAAENEEPIEIEVIDPEQV |
| Ga0075473_103255901 | 3300006875 | Aqueous | MATNIDKALYQNPVGMEEAAQNEEPIEIEIVDPEAVNIHA |
| Ga0070748_10036951 | 3300006920 | Aqueous | MATNIDKALYQTPTGLEESMDAEPIEIEIVDPEEVTIGM |
| Ga0070748_10265921 | 3300006920 | Aqueous | MATNIDKALYQQPQGIDDLARGEPELEIEIVDPEE |
| Ga0070748_10941072 | 3300006920 | Aqueous | MATNIDKALYQAPMGLDDMGDEGIEIEIVDPESVKI |
| Ga0070748_11963181 | 3300006920 | Aqueous | MATNIYKALDQQPQGIDELGEQEEAVEIEIIDPEE |
| Ga0070748_12979852 | 3300006920 | Aqueous | MATNVDKALYQQPAGIDALAQDESPLEIEIVDPEEV |
| Ga0070745_11250951 | 3300007344 | Aqueous | MATNIDKALFQAPQGLESEAEGAEPIEIEIIDPEEVNISAGD |
| Ga0075458_101511522 | 3300007363 | Aqueous | MATNIDKALFQAPQGLESEAEGTEPIEIEIVDPEEVNISA |
| Ga0075458_102686041 | 3300007363 | Aqueous | MATNIDKALYQNPQGIAGAAENEEPIEIEVIDPEQ |
| Ga0099846_12242581 | 3300007542 | Aqueous | MATNIDKALYQQPLGIEELAQEESPLEIEIVDPEEVTIG |
| Ga0102875_12744782 | 3300007547 | Estuarine | MATNIDKALYQQPMGIDALGEQESPLEIEIVDPEEVTIGMDG |
| Ga0102859_10346531 | 3300007708 | Estuarine | MATNIDKALYQQPLGIDALGEQESPHEIEIVDPEEDT |
| Ga0102859_10982272 | 3300007708 | Estuarine | MATNIDKALFQQPQGMESLAQDEEAIEIEIVDPEAVN |
| Ga0114346_12784501 | 3300008113 | Freshwater, Plankton | MATNIDKALYQLPAGLDDGMEDESIEIEIEDPESVTVGLG |
| Ga0114350_10196824 | 3300008116 | Freshwater, Plankton | MATNIDKALYQQPMGIDAAAIKEEPIEIEIIDPEAVNIDMGGL |
| Ga0114355_12315292 | 3300008120 | Freshwater, Plankton | MATNIDKALFQQPTGIDAAGEAEEPIEIEIVDPEAVNIDMGD |
| Ga0114841_12130481 | 3300008259 | Freshwater, Plankton | MATNIDKALFQSPVGIADDAEGIEPIEIEIVDPEAVHIEAGDLEI |
| Ga0105093_103205252 | 3300009037 | Freshwater Sediment | MATNIDKALFQQPMGIDAAGEMEEPIEIEIVDPEAVHIDMGDVEIDIEK |
| Ga0105099_1000661010 | 3300009082 | Freshwater Sediment | MATNIDKALFQQPQGIESLAQDESPIEIEIVDPEAVHIDLGDTEIS |
| Ga0105099_105492491 | 3300009082 | Freshwater Sediment | MATNIDKALFQQPLGMEELAGEAEPIEIEIIDPEAVHIDLGDIEI |
| Ga0114962_102184681 | 3300009151 | Freshwater Lake | MATNVDKALYQQPAGIDSLGAEEAPLEIEIVDPEEVN |
| Ga0114968_105593891 | 3300009155 | Freshwater Lake | MATNIDKALYQQPQGMEELAQDEDAIEIEIIDPEAVNISIGDLEISM |
| Ga0114970_102590461 | 3300009163 | Freshwater Lake | MATNIDKALYQAPMGLGDMGEEAIEIEIVDPESVKIGIGGIE |
| Ga0105102_107519511 | 3300009165 | Freshwater Sediment | MATNIDKALYQQPVGIDALGEQETPLEIEIVDPEEVTIGMD |
| Ga0105102_108633851 | 3300009165 | Freshwater Sediment | LRKIPNMPTNIDKALYTAPTGIAAAAENEEPIEIEIIDPEEVNIQAG |
| Ga0105104_100714063 | 3300009168 | Freshwater Sediment | MATNIDKALYQQPMGLAATNEEPIEIEIIDPEAVNINMGDVEINIEKG |
| Ga0073936_106580221 | 3300009175 | Freshwater Lake Hypolimnion | MATNIDKALYSDTQGIASAHADEPIEIEVVDPEAVNIHAGDLDIE |
| Ga0114959_100281866 | 3300009182 | Freshwater Lake | MATSNFDKAIYQAPQGIDALAQEEEPLEIEIVDPEEV |
| Ga0114976_106048162 | 3300009184 | Freshwater Lake | MATNIDKALYQQPTGIDALAQNEDAIEIEIVDPEEVNIR |
| Ga0114971_104190571 | 3300009185 | Freshwater Lake | MATNIDKSLYRAPQGIDTLAAQEEPLEIEIVDPEA |
| Ga0114960_100998392 | 3300010158 | Freshwater Lake | MMATNIDKALYQQPQGIESLAQDEEPIEIEIIDPEAVNIHAGDLDIS |
| Ga0133913_113330883 | 3300010885 | Freshwater Lake | MATNIDKALYQQPQGIEELAQDQPEDFEIEIIDPEEV |
| Ga0139556_10216482 | 3300011011 | Freshwater | MATNIDKALYQAPMGLESAEEEAIEIEIIDPEEVN |
| Ga0157140_100087641 | 3300012348 | Freshwater | MATNIDKALFQQPTGIDALGQAEEPIEIEIIDPEAVNIHADGLD |
| Ga0157138_10061421 | 3300012352 | Freshwater | MATNIDKALFQQPIGMEELAGAAEPIEIEIIDPEAVHIDLG |
| Ga0157208_100037391 | 3300012667 | Freshwater | MSIDKALYQAPAGLDALAQDEEAIEIEIVDPEEVN |
| Ga0153916_125854642 | 3300012964 | Freshwater Wetlands | MATNIDKALYQQPAGLDDLAEAQEPIEIEIIDPEAVNIGIGDMEISIE |
| Ga0119960_10113201 | 3300014811 | Aquatic | MATNIDKALYQQPVGIDALGEQESPLEIEIVAPDRDWE |
| Ga0181364_10297992 | 3300017701 | Freshwater Lake | MATNIDKALYQQPQGIDELGEQEEAVEIEIIDPEEVNIEGPG |
| Ga0181362_10324142 | 3300017723 | Freshwater Lake | MATNVDKGLYQAPLGIDALAEDEEAIEIEIVDPEEV |
| Ga0181365_10385741 | 3300017736 | Freshwater Lake | MATNIDKALYQQPQGMEELAQDEDAIEIEIIDPEAVN |
| Ga0181352_10638572 | 3300017747 | Freshwater Lake | MATNIDKALYQAPVSIEELAQDEEPIEIEIIDPEQVNIHAGGLDLSITP |
| Ga0181352_10956291 | 3300017747 | Freshwater Lake | MATNIDKALFQSPVGIADDAEGIEPIEIEIVDPEAVHIEAGDLEIDIE |
| Ga0181352_11235293 | 3300017747 | Freshwater Lake | MATNIDKALYQQPQGMEELAQEEEAVEIEIVDPEA |
| Ga0181344_10706501 | 3300017754 | Freshwater Lake | MATNIDKALFQQPQGIDALAEDEQGIEIEIVDPESVSIEGPGFAIE |
| Ga0181344_11449392 | 3300017754 | Freshwater Lake | MMATNIDKALYQQPQGIESLAQDEEAIEIEIIDPEAVNIHAGDLDISI |
| Ga0181356_10170745 | 3300017761 | Freshwater Lake | MAIEKGLYQAPLGIEALAVEEEPIEIEIVDPEEINI |
| Ga0181343_11233631 | 3300017766 | Freshwater Lake | MATNIDKALFQSPVGIADDAEGIEPIEIEIVDPEAVHIE |
| Ga0181357_10201701 | 3300017777 | Freshwater Lake | VATNMDKALTQAPAGLEALAQDESAIEIEIVDPEAVHIGIG |
| Ga0181357_10354111 | 3300017777 | Freshwater Lake | MATNIDKALYQQPMGIDALGEQESPLEIEIVDPEEVTILFFP |
| Ga0181357_12077351 | 3300017777 | Freshwater Lake | MATNIDKALYQAPMGLDDMGEEAIEIEIVDPESVKIGIG |
| Ga0181357_12930511 | 3300017777 | Freshwater Lake | MDKALTQAPAGLEALAQDESAIEIEIVDPEAVHIGIG |
| Ga0181346_11389442 | 3300017780 | Freshwater Lake | MATNIDKALYQQPMEEDAAEAIEIEIIDPEEVNIGIGDLEIS |
| Ga0181348_12516082 | 3300017784 | Freshwater Lake | MATNVDKALFQPPMGLEAIEEEAIEIEIIDPEEVNIRAGDLEISIGKGED |
| Ga0181355_11397303 | 3300017785 | Freshwater Lake | MSVDKTLYQAPVGIEEAAVGPEIEIEIVDPEEVNI |
| Ga0181359_10672292 | 3300019784 | Freshwater Lake | MATNVDKALYQQPRGIDALAQDESPLEIEIIDPEEV |
| Ga0181359_12686442 | 3300019784 | Freshwater Lake | MATNIDKSLYQAPMGLDDMGDEAIEIEIVDPESVKIGI |
| Ga0207193_18663561 | 3300020048 | Freshwater Lake Sediment | MATNIDKALYQQPLGIEELAQEEAPLEIEIVDPEEV |
| Ga0211734_112068062 | 3300020159 | Freshwater | MATNIDKALYQNPVGIEDAALNEEAVEIEIIDPEQVNIHADGLDISI |
| Ga0211733_102561572 | 3300020160 | Freshwater | MATNIDKSLFQQPTGIDALGEMEEPIEIEIVDPEAVRIDMGDLEIELMKAEP |
| Ga0211726_109949331 | 3300020161 | Freshwater | MATNIDKALYQQPTGIDALAQDEEAIEIEIVDPEEVNI |
| Ga0211729_104899601 | 3300020172 | Freshwater | MATNIDKALFQSPQGLESESDGMEGIEIEIIDPEEVNISAGDLDISIKP |
| Ga0214255_10372271 | 3300020712 | Freshwater | MAIDKALYQAPEGIDALAAKEQPLEIEVVNPDEITIGMDGLEITLT |
| Ga0214172_10438053 | 3300020733 | Freshwater | MEKSVYQAPQGITGASQEPIEIEIVDPEEVNIHAGGLDI |
| Ga0194048_102343081 | 3300021519 | Anoxic Zone Freshwater | MATNIDKALYQNPQGIDALAQDEEPIEIEIVDPEAV |
| Ga0222714_101677762 | 3300021961 | Estuarine Water | MATNIDKALYQQPVGIDALGEQESPLEIEIVDPEE |
| Ga0222714_103239882 | 3300021961 | Estuarine Water | MATNIDKALFQQPTGIEALGEAEEPIEIEIVDPESVSIR |
| Ga0222714_104275001 | 3300021961 | Estuarine Water | LKEHMATNIDKSLYQAPMGLDDMGDEAIEIEIVDPESMKIG |
| Ga0222713_101167603 | 3300021962 | Estuarine Water | MATNIDKALYQQPQGIADAAENEEPIEIEIIDPEEVNIHAGDLELSI |
| Ga0181354_10128781 | 3300022190 | Freshwater Lake | MANIDKGLYQAPMGLEAMGMSEEPIEIEIIDPEAVNIRTGD |
| Ga0181354_10785132 | 3300022190 | Freshwater Lake | MATNIDKALYQAPSSMEEDALDEEPIEIEIIDPEAVNIHADG |
| Ga0181354_11590291 | 3300022190 | Freshwater Lake | MATNIDKALFQQPQGIDELAEDEQGIEIEIVDPESVSIEGPSSL |
| Ga0181354_12499532 | 3300022190 | Freshwater Lake | MATNIDKALYQAPVGMMGSQEPDIEIEIEDPESVKIG |
| Ga0181351_11158702 | 3300022407 | Freshwater Lake | MATNIDKALYQAPMGLDDMGEEAIEIEIVDPESVKIGI |
| Ga0181351_12058352 | 3300022407 | Freshwater Lake | MATNFMDKGLYQAPQGLEQEEAEPIEIEIVDPEEVSIHAGG |
| Ga0228703_10207933 | 3300022747 | Freshwater | MAIDKSLYQAPAGIDALAQEEEPIEIEIVDPEEVNIHAGDVD |
| Ga0255168_10671332 | 3300024506 | Freshwater | MATNIQKSLYEAPVGIEAAAEEIEPIEIEIVDPEEVNIDMG |
| Ga0209697_105683532 | 3300025316 | Freshwater Lake Hypolimnion | MATNIDKALYSDTQGIASAHADEPIEIEVVDPEAVNIHAGDLDIEI |
| Ga0208738_10331931 | 3300025379 | Freshwater | MAMDKGLYQAPQGIAGSPNEPPLEIEIVDPEAIHIG |
| Ga0208871_10276152 | 3300025381 | Freshwater | MTIAKSLYQAPQGLDSLDHEAVEIEIVDPEEVNIHAGGVDIHIGKEED |
| Ga0208256_10283832 | 3300025382 | Freshwater | MATNIDKALYQAPMGMGMDDGNPIEVEIEDPESVH |
| Ga0208251_10233112 | 3300025398 | Freshwater | MAIDKALYQAPEGIDALAEKEQPLEIEVVNPEEVTIGMDGLEI |
| Ga0208745_10073582 | 3300025403 | Freshwater | MAIDKALYQAPEGIDALAAKEQPLEIEVVNPDEMTIGMDGLEITLT |
| Ga0208424_10076313 | 3300025445 | Aqueous | MATNIDKALFQAPQGLESEAEGAEPIEIEIVDPEEVNISAGDLE |
| Ga0208497_10181781 | 3300025466 | Freshwater | MAIDKALYQAPEGIDALAEKEVPIEIEIVSIEEGG |
| Ga0208105_10703152 | 3300025487 | Freshwater | MAIDKALYQAPEGIDALAEKEQPLEIEVVDPKEVTIGM |
| Ga0207954_10977372 | 3300025606 | Freshwater | MATNIDKALYQQPQGIEDLAQDQPEDFEIEIIDPEAVNIH |
| Ga0208428_11320952 | 3300025653 | Aqueous | MATNIDKGLYQAPAGLESAATDVEPIEIEIEDPES |
| Ga0208386_10403611 | 3300025781 | Freshwater | MATNIDKALYSDNQGIAAAHSDEPIEIEVIDPEAVKIHAGDLD |
| Ga0208544_100178495 | 3300025887 | Aqueous | MATNMDKALRGHQTGIDALAQNEEPIEIEIIDPEEVNIDGPG |
| Ga0208923_10964381 | 3300027320 | Estuarine | MATNFDKALYEQPRSMDDLAQDEEAIEIEIIDPEAVNISIGDLEISM |
| Ga0255075_10406512 | 3300027578 | Freshwater | MATNIDKALYQAPMGLDDMGDEGIEIEIVDPEEVEI |
| Ga0208966_10963081 | 3300027586 | Freshwater Lentic | MATNIDKALYQQPQGIDELGEQEEPLEIEIIDPEEVNIEGPGFAMS |
| Ga0209188_11967492 | 3300027708 | Freshwater Lake | MATSNFDKAIYQAPQGIDALAQEEEPLEIEIVDPEEVNIHAGD |
| Ga0209297_13685201 | 3300027733 | Freshwater Lake | MATNVDKALYQQPAGIDALAEDESPLEIEIVDPEEVN |
| Ga0209087_12175031 | 3300027734 | Freshwater Lake | MATNIDKALYQQPMGIDALGEQESPLEIEIVDPEE |
| Ga0209087_12908362 | 3300027734 | Freshwater Lake | MATNIDKALYQQPQGIESLAQDEEPIEIEIIDPEAVNIDMGD |
| Ga0209084_13338742 | 3300027749 | Freshwater Lake | MATNIDKALFQQPQGMESMAQDEEPIEIEIVDPEAVN |
| Ga0209288_103022091 | 3300027762 | Freshwater Sediment | MATNIDKALFQQPTGIAAAAEAEEPIEIEIVDPEAVRIDMGDLEIEMLKAE |
| Ga0209829_103880142 | 3300027777 | Freshwater Lake | MATSNFDKAIYQAPQGIDALAQDEAPLEIEIVDPEEVSIK |
| Ga0209246_101099111 | 3300027785 | Freshwater Lake | MATNIDKALYQQPMGIDALGEQESPLEIEIVDPEEVTIG |
| Ga0209972_103641931 | 3300027793 | Freshwater Lake | MATNIDKALYQQPMGIDAAAIKEEPIEIEIIDPEAVNIDMG |
| Ga0209777_105286871 | 3300027896 | Freshwater Lake Sediment | MAIDKALYQAPEGIEALAEKESPLEIEIVDPEEVNI |
| Ga0209777_109105612 | 3300027896 | Freshwater Lake Sediment | MATNIDKALYQQPQGIDDLARGEPSMEIEIVDPEEVS |
| Ga0209702_101294232 | 3300027976 | Freshwater | MATNIDRVLNQQPTGIEELAQNEEPIEIEIVDPEAV |
| Ga0315907_101239341 | 3300031758 | Freshwater | MATNIDKALYQQPTGIAAAAEAEEPIEIEIVDPESVTIGMGDLEIELTPGE |
| Ga0315900_103380051 | 3300031787 | Freshwater | MATNIDKALFQAPQGLESEAEGAEPIEIEIIDPEEVNIQ |
| Ga0315904_101295291 | 3300031951 | Freshwater | MATNIDKALFQAPQGLESEAEGAEPIEIEIIDPEEVNI |
| Ga0315294_106549691 | 3300031952 | Sediment | MAIEKGLYQAPEGIEALAENETPMEIEIVNPEEVTI |
| Ga0315901_102725081 | 3300031963 | Freshwater | MATNIDKALFQQPMGIDAAGDMEETIEIEIVDPEEVSIRAG |
| Ga0315274_102300573 | 3300031999 | Sediment | MATNIDKALFQQPMGIAAAAEELDPIEIEIVDPEEVSIKVGDMEIE |
| Ga0315903_104364061 | 3300032116 | Freshwater | MATNIDKALFQQPRGIDALAEDEQGIEIEIVDPES |
| Ga0315903_105752661 | 3300032116 | Freshwater | MATNIDKALYQQPAGIDALAQDEDAIEIEIVDPEEVNIRAGD |
| Ga0315903_108164131 | 3300032116 | Freshwater | MATNIDKALYQAPSSMEEDALDEEPIEIEIIDPEAVNI |
| Ga0315903_109211662 | 3300032116 | Freshwater | MATNIDKALYPAPTGIEELAQAEPEIEIEIIDPEE |
| Ga0316218_12024492 | 3300032117 | Freshwater | MAIDKGLYQAPQGIEDLAQNEEPIEIEIIDPEEVDIHA |
| Ga0315295_112720331 | 3300032156 | Sediment | MATNVDKALYQAPEGIDDAAADESAIEIEVVDPEAIKIG |
| Ga0315268_104437472 | 3300032173 | Sediment | MATNIDKALYQQPLGIDALGEQESPLEIEIVDPEE |
| Ga0315268_115619382 | 3300032173 | Sediment | MATNIDKALYQQPQGIDELGEQEEAVEIEIIDPEEVNI |
| Ga0315276_123496042 | 3300032177 | Sediment | MATNVDKALYQQPRGIDALAQDEEALEIEIIDPEEVN |
| Ga0315271_117966693 | 3300032256 | Sediment | MATNIDKSLYQAPMGLDDMGEEAIEIEIVDPESVKI |
| Ga0316226_13235972 | 3300032562 | Freshwater | MATNIDKALYADTQGIAGAQDEEPLEIEIIDPEAV |
| Ga0316228_11681391 | 3300032579 | Freshwater | MATNIDKALYSDNQGIAAAHSDEPIEIEVIDPEAV |
| Ga0316232_13052622 | 3300032605 | Freshwater | MAIDKGLYQAPQGIEDLAQNEEPIEIEIIDPEEVDIHAGDTDISIKPG |
| Ga0334992_0476936_420_542 | 3300033992 | Freshwater | MATNIDKALYQQPQGIDELGEQEEAVEIEIIDPEEVNIEGP |
| Ga0334987_0261445_1050_1172 | 3300034061 | Freshwater | MATNIDKALYQQPQGIDALGEAEPELEIEIIDPEEVSIKGP |
| Ga0334995_0090879_2231_2341 | 3300034062 | Freshwater | MATNIDKALYQQPMGIDALGEQESPLEIEIVDPEEVT |
| Ga0335010_0436368_3_131 | 3300034092 | Freshwater | MATNIDKALFQQPTGIAAAAEELDPIEIEIVDPEAVRIDMGDM |
| Ga0335012_0575044_3_107 | 3300034093 | Freshwater | MATNIDKSLSQAPTGLEAMLGEPDIEIEIEDPESV |
| Ga0335031_0386572_746_883 | 3300034104 | Freshwater | MATNIDKALYQAPASIEELAQDEEPIEIEIIDPEQVNIHAGGLDLS |
| Ga0335036_0413689_744_863 | 3300034106 | Freshwater | MATNIDKALYQQPMGIDALGEQESPLEIEIVDPEEVTIGM |
| Ga0335056_0248269_902_1006 | 3300034120 | Freshwater | MATNIDKALYQQPTGIDALAQNEDAIEIEIVDPEE |
| Ga0335061_0530521_480_596 | 3300034168 | Freshwater | MATNIDKALYQQPQGIDALGGEEQGIEIEIVDPEEVSIR |
| Ga0335065_0329132_826_957 | 3300034200 | Freshwater | MATNIDKALYQQPTGIDALAQNEDAIEIEIVDPEEVNIKAGDLE |
| Ga0335065_0446053_644_784 | 3300034200 | Freshwater | MATNIDKALYQNPVGIDDAALNEEAIEIEIIDPEQVNIHAGDLDISI |
| Ga0335049_0438532_727_846 | 3300034272 | Freshwater | MATNIDKALYQSPTGIEELAEDESPIEIEIVDPEMVKIGI |
| Ga0335048_0092156_1733_1837 | 3300034356 | Freshwater | MATNIDKALYQSPMGLEAAEEEAIEIEIIDPEEVN |
| ⦗Top⦘ |