Metagenome Family F043214

Overview

Basic Information

• Family ID: F043214
• Family Type: Metagenome
• Number of Sequences: 156
• Average Sequence Length: 46 residues
• Representative Sequence: RVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTRKQREER
• Number of Associated Samples: 44
• Number of Associated Scaffolds: 156

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 34.72 %
• % of genes near scaffold ends (potentially truncated): 71.15 %
• % of genes from short scaffolds (< 2000 bps): 67.31 %
• Associated GOLD sequencing projects: 31
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (60.256 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (54.487 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 28.77%
  β-sheet: 0.00%
  Coil/Unstructured: 71.23%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 156 Family Scaffolds
PF01391	Collagen	1.92
PF02338	OTU	0.64
PF13087	AAA_12	0.64
PF00041	fn3	0.64
PF00665	rve	0.64
PF01436	NHL	0.64
PF00078	RVT_1	0.64
PF00001	7tm_1	0.64
PF08399	VWA_N	0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 156 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.64
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.64
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.64
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.64

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
All Organisms	root	All Organisms	39.74 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
cellular organisms	root	All Organisms → cellular organisms	38.46 %
Viruses	superkingdom	All Organisms → Viruses	1.28 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	26.28 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	12.18 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	26.28 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	12.18 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	26.28 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	26.28 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	5.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	26.28 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	5.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.64 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	26.28 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	3.21 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.64 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	26.28 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	2.56 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.64 %
Hexacorallia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia	0.64 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	26.28 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	2.56 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.64 %
Scleractinia	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia	0.64 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	26.28 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	2.56 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %
Astrocoeniina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina	0.64 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	2.56 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	0.64 %
Pocilloporidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae	0.64 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	2.56 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Stylophora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora	0.64 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	0.64 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	2.56 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Branchiopoda	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda	2.56 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	1.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Phyllopoda	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda	2.56 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	1.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Diplostraca	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca	2.56 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	1.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Cladocera	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera	2.56 %
Teleostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei	1.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Anomopoda	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda	2.56 %
Osteoglossocephalai	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai	1.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae	2.56 %
Clupeocephala	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala	1.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Euteleosteomorpha	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha	1.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Neoteleostei	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Eurypterygia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Ctenosquamata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Acanthomorphata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Euacanthomorphacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Percomorphaceae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 28

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Eupercaria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 29

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Eupercaria incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Eupercaria incertae sedis	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 30

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Sciaenidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Eupercaria incertae sedis → Sciaenidae	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 31

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Collichthys	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Eupercaria incertae sedis → Sciaenidae → Collichthys	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Level 32

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.26 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	26.28 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.28 %
Collichthys lucidus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Eupercaria incertae sedis → Sciaenidae → Collichthys → Collichthys lucidus	0.64 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.64 %
Stylophora pistillata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	0.64 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001734|JGI24668J20090_10021686	Not Available	1369
3300001734|JGI24668J20090_10104464	Not Available	752
3300001734|JGI24668J20090_10177903	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	599
3300001734|JGI24668J20090_10222170	Not Available	541
3300001734|JGI24668J20090_10256541	Not Available	506
3300001741|JGI24671J20093_10046279	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	911
3300001741|JGI24671J20093_10158529	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	579
3300001741|JGI24671J20093_10160112	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	577
3300001742|JGI24673J20094_10016952	Not Available	1464
3300001742|JGI24673J20094_10119844	Not Available	715
3300001742|JGI24673J20094_10124262	Not Available	704
3300001742|JGI24673J20094_10128250	All Organisms → cellular organisms → Eukaryota → Opisthokonta	695
3300001742|JGI24673J20094_10269363	Not Available	500
3300001744|JGI24669J20092_10171869	Not Available	510
3300001746|JGI24672J20091_10068641	Not Available	711
3300001746|JGI24672J20091_10120862	Not Available	582
3300002181|JGI24670J26820_11219472	Not Available	529
3300002181|JGI24670J26820_11236780	Not Available	541
3300002181|JGI24670J26820_11298999	Not Available	589
3300002181|JGI24670J26820_11304474	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593
3300002181|JGI24670J26820_11496879	Not Available	860
3300002181|JGI24670J26820_11496938	Not Available	861
3300003772|Ga0049094_10090606	Not Available	1262
3300003772|Ga0049094_10187470	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	830
3300003772|Ga0049094_10266211	Not Available	645
3300003772|Ga0049094_10266702	Not Available	644
3300003772|Ga0049094_10304401	All Organisms → cellular organisms → Eukaryota → Opisthokonta	578
3300003774|Ga0049095_10061988	All Organisms → cellular organisms → Eukaryota → Opisthokonta	981
3300003774|Ga0049095_10213531	Not Available	582
3300003774|Ga0049095_10275257	All Organisms → cellular organisms → Eukaryota → Opisthokonta	507
3300003801|Ga0056138_1074802	Not Available	503
3300003829|Ga0056137_1014037	Not Available	871
3300004085|Ga0066187_1013320	Not Available	3582
3300004085|Ga0066187_1027682	Not Available	2601
3300004098|Ga0065184_10019741	Not Available	2170
3300004122|Ga0065185_10130080	Not Available	922
3300004122|Ga0065185_10196721	Not Available	746
3300004626|Ga0066188_1151680	Not Available	831
3300004632|Ga0049107_10425459	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	743
3300005652|Ga0056135_10066153	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1983
3300005652|Ga0056135_10310486	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	836
3300005653|Ga0056133_10027126	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3078
3300005653|Ga0056133_10031608	Not Available	2905
3300005653|Ga0056133_10208223	Not Available	1159
3300008215|Ga0056108_1008177	Not Available	4886
3300008215|Ga0056108_1094310	Not Available	1941
3300008215|Ga0056108_1206825	Not Available	1213
3300008215|Ga0056108_1285032	Not Available	953
3300010290|Ga0126333_1220601	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	833
3300010292|Ga0126326_1189192	Not Available	962
3300010292|Ga0126326_1338746	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	591
3300010292|Ga0126326_1373599	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	539
3300010294|Ga0126332_10005698	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	5406
3300010294|Ga0126332_10080150	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1880
3300010295|Ga0126334_10125840	Not Available	1383
3300010295|Ga0126334_10133547	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1331
3300010295|Ga0126334_10164252	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1156
3300010298|Ga0126325_10219154	Not Available	947
3300010298|Ga0126325_10244192	Not Available	873
3300010314|Ga0126331_1044131	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2330
3300010315|Ga0136654_1010690	Not Available	3965
3300010315|Ga0136654_1094570	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1580
3300010315|Ga0136654_1242980	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	797
3300010315|Ga0136654_1298409	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	654
3300010315|Ga0136654_1336028	Not Available	582
3300010377|Ga0126328_10023385	Not Available	3047
3300010378|Ga0126330_10053735	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2168
3300010378|Ga0126330_10060251	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2054
3300010378|Ga0126330_10355829	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593
3300011190|Ga0126327_10155373	Not Available	1142
3300011190|Ga0126327_10224747	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	873
3300012273|Ga0126329_10117027	All Organisms → Viruses → Predicted Viral	1417
3300012273|Ga0126329_10354585	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	622
3300012273|Ga0126329_10356039	Not Available	620
3300027377|Ga0209363_1037875	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	3301
3300027377|Ga0209363_1040436	Not Available	3181
3300027377|Ga0209363_1051221	Not Available	2757
3300027377|Ga0209363_1093692	Not Available	1762
3300027377|Ga0209363_1111945	Not Available	1494
3300027389|Ga0209780_1020872	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	5502
3300027389|Ga0209780_1078466	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Eupercaria incertae sedis → Sciaenidae → Collichthys → Collichthys lucidus	2171
3300027389|Ga0209780_1082002	Not Available	2079
3300027389|Ga0209780_1090671	Not Available	1877
3300027389|Ga0209780_1092483	Not Available	1839
3300027389|Ga0209780_1100100	Not Available	1686
3300027389|Ga0209780_1133703	Not Available	1152
3300027389|Ga0209780_1138094	Not Available	1099
3300027389|Ga0209780_1157329	Not Available	888
3300027389|Ga0209780_1160051	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	861
3300027540|Ga0209791_1113251	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1130
3300027540|Ga0209791_1247459	Not Available	727
3300027551|Ga0209338_1031524	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2861
3300027551|Ga0209338_1140500	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1362
3300027551|Ga0209338_1362048	Not Available	592
3300027556|Ga0209743_1035807	Not Available	2091
3300027556|Ga0209743_1154850	All Organisms → Viruses → Predicted Viral	1088
3300027556|Ga0209743_1231792	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	850
3300027556|Ga0209743_1275081	Not Available	747
3300027564|Ga0209428_1002938	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	5089
3300027564|Ga0209428_1006246	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4150
3300027564|Ga0209428_1024551	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2719
3300027564|Ga0209428_1101519	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1507
3300027564|Ga0209428_1143309	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata	1243
3300027564|Ga0209428_1216771	Not Available	951
3300027564|Ga0209428_1228445	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	916
3300027564|Ga0209428_1371084	Not Available	593
3300027584|Ga0209637_1028645	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2723
3300027584|Ga0209637_1192995	Not Available	1064
3300027584|Ga0209637_1361671	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha	623
3300027585|Ga0209150_1052922	Not Available	1644
3300027585|Ga0209150_1145968	Not Available	1042
3300027585|Ga0209150_1207550	Not Available	855
3300027613|Ga0209122_1009919	Not Available	3268
3300027613|Ga0209122_1015951	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2816
3300027613|Ga0209122_1036299	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	2127
3300027613|Ga0209122_1153029	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1105
3300027613|Ga0209122_1293917	Not Available	709
3300027615|Ga0209678_1000518	Not Available	12212
3300027626|Ga0209149_1005774	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	8138
3300027626|Ga0209149_1010462	Not Available	6673
3300027626|Ga0209149_1016744	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	5613
3300027626|Ga0209149_1035726	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4070
3300027626|Ga0209149_1052289	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	3363
3300027626|Ga0209149_1056767	Not Available	3215
3300027626|Ga0209149_1101692	Not Available	2244
3300027626|Ga0209149_1138205	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1776
3300027626|Ga0209149_1165658	Not Available	1514
3300027626|Ga0209149_1179682	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1399
3300027626|Ga0209149_1207631	Not Available	1204
3300027626|Ga0209149_1237799	Not Available	1033
3300027626|Ga0209149_1247481	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	984
3300027626|Ga0209149_1347705	Not Available	599
3300027632|Ga0209339_1044891	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3172
3300027632|Ga0209339_1053130	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2921
3300027632|Ga0209339_1068246	Not Available	2564
3300027632|Ga0209339_1172900	Not Available	1394
3300027632|Ga0209339_1233575	Not Available	1067
3300027632|Ga0209339_1268967	Not Available	926
3300027632|Ga0209339_1284873	Not Available	871
3300027632|Ga0209339_1329752	Not Available	728
3300027632|Ga0209339_1372262	Not Available	619
3300027658|Ga0209259_1009646	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4592
3300027661|Ga0209459_10377964	All Organisms → cellular organisms → Eukaryota → Opisthokonta	605
3300027661|Ga0209459_10407579	Not Available	557

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	73.08%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	26.92%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	73.08%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	26.92%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	54.49%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	26.92%
Marine Gutless Worms	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms	18.59%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001734	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1	Host-Associated
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated
3300001744	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2	Host-Associated
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated
3300002181	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3	Host-Associated
3300003772	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.2	Host-Associated
3300003774	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3	Host-Associated
3300003801	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1	Host-Associated
3300003829	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI	Host-Associated
3300004085	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.1	Host-Associated
3300004098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2)	Host-Associated
3300004122	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2)	Host-Associated
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300004632	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1	Host-Associated
3300005652	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1	Host-Associated
3300005653	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1	Host-Associated
3300005970	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.2	Host-Associated
3300008215	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.1	Host-Associated
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated
3300027377	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3 (SPAdes)	Host-Associated
3300027389	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.2 (SPAdes)	Host-Associated
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated
3300027556	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes)	Host-Associated
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated
3300027615	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.1 (SPAdes)	Host-Associated
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated
3300027658	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1 (SPAdes)	Host-Associated
3300027661	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24668J20090_100216863	3300001734	Marine Gutless Worms Symbiont	MRVLSGVVYMTKRIGPRTEPWGTPQRQVSKEERFLLHLTRKQREDR*
JGI24668J20090_101044641	3300001734	Marine Gutless Worms Symbiont	RVLSGVVYMTKSRGPRTEPWGTPQRQVCGEEKLLLHLTRKQQENR*
JGI24668J20090_101779032	3300001734	Marine Gutless Worms Symbiont	MRVLSGVVYMTKRRGSRTEPWGTPQRQVYREERLLLHLTRKQREDR
JGI24668J20090_102221701	3300001734	Marine Gutless Worms Symbiont	KERDETRVLSGVVYMTKSRGPRTEPWGTPKRQVCGEEKSLLHLTRKQREEK*
JGI24668J20090_102565412	3300001734	Marine Gutless Worms Symbiont	MRSVVEHLQERDKTRVSSGVVYMTKSRGLRTEPWGTPQRQVCGEEKSLLHLTRKQREER*
JGI24671J20093_100462791	3300001741	Marine Gutless Worms Symbiont	VLSGVVYMTKSRGPRTEPWGTPQKQVCEEEKSLLHLTRKQREER*
JGI24671J20093_101585292	3300001741	Marine Gutless Worms Symbiont	MTVLSGVVYMTKSRGPRSEPWGTPQREVCREERLLLHLTRIQRGQ
JGI24671J20093_101601121	3300001741	Marine Gutless Worms Symbiont	MRVLSGVVYMTKRRGPRTEPWGTPQRQVCGEERLLLHLTRKQREDR*
JGI24673J20094_100169521	3300001742	Marine Gutless Worms Symbiont	DETRVLSGVVYMTKSKWPRTEPWGTPQRQVCEEEKSLLHLKRKQREER*
JGI24673J20094_101198441	3300001742	Marine Gutless Worms Symbiont	RVLSGVVYMTKNRGPRTEPLGTPQRQVCREERLLLHLTRKQVQREDR*
JGI24673J20094_101242621	3300001742	Marine Gutless Worms Symbiont	VFKERDETRVLSGVVYTTKSRVPRTEPWGTPQSQVCEEEKSLLHLTRKQRDGR*
JGI24673J20094_101282501	3300001742	Marine Gutless Worms Symbiont	VLSGVVYMTKSRGPRTEPWGTPQRQVCGEEKSLLIPLTSGVP*
JGI24673J20094_102693631	3300001742	Marine Gutless Worms Symbiont	KERDETRVLSGVVYMTKSRGPRTEPWGTPQRKVGEEKSLLHLSRKQREER*
JGI24669J20092_101718691	3300001744	Marine Gutless Worms Symbiont	KERDETRVLSGVVYMTKSRGPRTEPWGTPQREVCGEEKSLLHLTRKQREER*
JGI24672J20091_100359931	3300001746	Marine Gutless Worms Symbiont	VYMTKSRGSRTERWGTLQRQVCTEEKLLMHLTRKQRDDK*
JGI24672J20091_100686412	3300001746	Marine Gutless Worms Symbiont	MRVLSGVVYMTKSREPRIEPWGTPQIQVCREMLLLYWTQKQREYR*
JGI24672J20091_101208621	3300001746	Marine Gutless Worms Symbiont	LSGVVYMTKSRGPRTEPWGTPQREVCGEEKSLLHLTRKQREER*
JGI24670J26820_112194721	3300002181	Marine Gutless Worms Symbiont	SGVVYMTKSRGPRTEPWGTPQRQVCEEEKLLLHLT*
JGI24670J26820_112367802	3300002181	Marine Gutless Worms Symbiont	GVVYMTKSRGPRTEPWGTPQRQVCGEEKSLLHLTQKQREER*
JGI24670J26820_112989992	3300002181	Marine Gutless Worms Symbiont	ETRVLSGVVYMTKSRGPRTEPWGTPQRKVGEEKSLLHLSRKQREER*
JGI24670J26820_113044741	3300002181	Marine Gutless Worms Symbiont	LGSIHDMMTKTRGPRTEPWGTPQRQVCEEEKSLLHLTRKQ
JGI24670J26820_114968792	3300002181	Marine Gutless Worms Symbiont	RDETRVLSGVVYMTKSRGPRTEPWGTPQREVCGEEKSLLHLTRKQREER*
JGI24670J26820_114969381	3300002181	Marine Gutless Worms Symbiont	TRVLSGVVYMTKSRGPRTEPWGTPQRQVCGEDKSLLHLTREQREER*
Ga0049094_100906063	3300003772	Marine Gutless Worms Symbiont	MEEIRVLRGVVYMTKSGGPRTEPWGTPQEEVWKEERLLSHLARKERDDNKT*
Ga0049094_101874701	3300003772	Marine Gutless Worms Symbiont	VVEGKKEIRVLRGVVYMTKSRRPITEPWGTPQEEVLKEERLSSHLTRKEQDDK*
Ga0049094_102662111	3300003772	Marine Gutless Worms Symbiont	VLRGVVYMTKSRGPRTEPWGTPQEEVWKEERLSLHLTRKERDDK*
Ga0049094_102667022	3300003772	Marine Gutless Worms Symbiont	RKVVYTTKSRGPRTDPWGTPQEEEFKKERLSSHLTRKERDDK*
Ga0049094_103044011	3300003772	Marine Gutless Worms Symbiont	GVVYMTKSRGPRTDRWGTPQEEVWKEERLSSHLTRKERYDK*
Ga0049095_100619881	3300003774	Marine Gutless Worms Symbiont	SREREEIRVLRGVVYMTKSRGPRTEPWGMPQEEVWKEERLSSHLIQKERDDK*
Ga0049095_102135311	3300003774	Marine Gutless Worms Symbiont	REEIRVLRGVVYMTKSRGPRTEPWGTPQEKVWKEERLSSHLT*
Ga0049095_102752571	3300003774	Marine Gutless Worms Symbiont	EIRVLRGVVYMTKSRGPRTDPWGTPQEEVWKEERLSSHLTQKERDDK*
Ga0056138_10748022	3300003801	Marine Gutless Worms Symbiont	KERDVTRVLSGVVYMTKSRLPEPWGTPQRQVCGEEKSLLHLTRKQR*
Ga0056137_10140371	3300003829	Marine Gutless Worms Symbiont	MRVLSGVVYMTKRRGPKTEPWGTPQKQMCREERLLLHLTRKQRKDR*
Ga0066187_10133202	3300004085	Marine Gutless Worms Symbiont	MRVLRGVVYMMKSRGTRTEPWGTPQEEVCKEERLISHLTRKERDDK*
Ga0066187_10276825	3300004085	Marine Gutless Worms Symbiont	MEREEIRVLRGVMYMVKSKGPKTEPRGTPQEEVCKEDSRLSRFIRKQQDDK*
Ga0066187_11561581	3300004085	Marine Gutless Worms Symbiont	RENIRVLRGVVYMIESRGLGTEPRGTPQEEVCKEERLILHLTRKERDDK*
Ga0065184_100197412	3300004098	Marine Gutless Worms Symbiont	MRVLTKSRGPRTEPWGKPQRQVCREEMLLLHLTRKQRDNSLEQCHECQTKRTDE*
Ga0065184_102157431	3300004098	Marine Gutless Worms Symbiont	MRVLSGVVYITKSRGPRTEPWGTPQRQVCTEERLLLHLTR
Ga0065185_101300801	3300004122	Marine Gutless Worms Symbiont	DEMRVLSGVVYMTKSRGPRTKLWETPQTQVCREERLLLHLTRKQRLQIEPKPV*
Ga0065185_101967212	3300004122	Marine Gutless Worms Symbiont	FKERDETRVLSGVVYMTKSRGLGTESWGTPQRQICGEQKSLLHLT*
Ga0066188_11516801	3300004626	Marine Gutless Worms Symbiont	SEEIRVLSGVVYITKSRGPRTEP*GTPQEELYAEEKSLSYLILKEQDDK*
Ga0049107_104254591	3300004632	Marine Gutless Worms Symbiont	MRVLSGVVYRIKSSGPRTEPWGTPKRQVWREEKVLLHFTR
Ga0056135_100399493	3300005652	Marine Gutless Worms Symbiont	MRVLRGVVYMMKSRGPRTEPWGTPQEEVLKDEKVLLHLTRKERDDK*
Ga0056135_100661533	3300005652	Marine Gutless Worms Symbiont	MRVLKGVVYTMKSMGPRMEPWGTTQEEVHKDEKVLLHLTRKDRDHK*
Ga0056135_103104861	3300005652	Marine Gutless Worms Symbiont	LSEREEMRVLRGVVYMIKSRGPRTDPWETPQDEVHKDEKVLLHLTRKERDDK*
Ga0056133_100271262	3300005653	Marine Gutless Worms Symbiont	MRVLRGVAYMIKSSGPRTEPWGTPQEEVHKDEKALLHLTRKDRDDK*
Ga0056133_100316086	3300005653	Marine Gutless Worms Symbiont	MTKSRGPRTEPWGTPQEEVHKDEKVLLHLTQKERDDR*
Ga0056133_102082231	3300005653	Marine Gutless Worms Symbiont	MLRGVVYMMRSRGPRKKPWGTLQEEVQKDEKALLHLKRKERDDK*
Ga0056134_100585403	3300005970	Marine Gutless Worms Symbiont	MRVLRGVVYMMKSRGPRTEPWGTPQEEIHKEEKVLLHLTQKERDDK*
Ga0056108_10081773	3300008215	Marine Gutless Worms Symbiont	MRVLRGVVYMTKSRGPRTEPWGTPQEEVHKEEKALLHLTRKERDDK*
Ga0056108_10943101	3300008215	Marine Gutless Worms Symbiont	VLRGVVYIMKSRGPRTEIWGTPQDEVHKDEKLLLHLTRKERDD*
Ga0056108_12068252	3300008215	Marine Gutless Worms Symbiont	MRVLRGVVYMMESSGPRTEPWGTPQEEVHKVEKVLLHLTRKELKRD*
Ga0056108_12850321	3300008215	Marine Gutless Worms Symbiont	VYMMKSRGPRTEPWGTPQEEVDKDEKVLLHLTRKDRDDK*
Ga0126333_12206013	3300010290	Marine Gutless Worms	MRVLREVVNMTKSSDSRTEPWGTPQEDVYQEDRSVSHLTRKQRDDK
Ga0126326_11891921	3300010292	Marine Gutless Worms	RGVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSHFTRKQRDAASLFLLLD*
Ga0126326_13387461	3300010292	Marine Gutless Worms	MRVLRGVVYITKSSGPRTEPWGTPQEDVYQEDRSVSHLTRKQRDDRYDLNQ
Ga0126326_13735991	3300010292	Marine Gutless Worms	MRVLIGVVYMMKSSGPRTEPWGTPQEDVYQEDRSVSHLTRKQRDD
Ga0126332_100056986	3300010294	Marine Gutless Worms	MRVLRGVVYMTKSNGPRTEPWGTPQEDVCQEDRSASHLSA*
Ga0126332_100801504	3300010294	Marine Gutless Worms	MRVLRGVVYMTKSSGPKTEPWGTPQEDVCQEDRSVSHFTRKK
Ga0126334_101258401	3300010295	Marine Gutless Worms	RVLRGVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSHFTRKQRDDR*
Ga0126334_101335471	3300010295	Marine Gutless Worms	MVVRGVVYMTKSRGPRTEPWGTPQEDVYQEDRSVSHLTWK
Ga0126334_101642522	3300010295	Marine Gutless Worms	MTKSRGPRTEPWGTPQEDVYQEDRSVSHLTRKQRDDRYDLNQLR
Ga0126334_101770121	3300010295	Marine Gutless Worms	VLRGVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSQFTRKQQDDI*
Ga0126325_102191541	3300010298	Marine Gutless Worms	REQGEMRVLRGVVYMTKSSGPRTEPWGTPQEHMRQEDRSVTHLTRKG*
Ga0126325_102441921	3300010298	Marine Gutless Worms	VVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHLTRKQRDDR*
Ga0126331_10441312	3300010314	Marine Gutless Worms	VLRLVVYMTKSSGPKTEPWGTPQEDVCQEDKSVTHLIWKERMTDMI*
Ga0136654_10106904	3300010315	Marine Gutless Worms	EQEEMRVLRGVVYMTKSSGSRTEPWGTLQEDVYQEDRSVSHLTRKQRDDRTS*
Ga0136654_10945701	3300010315	Marine Gutless Worms	GVVYMTKSSGPRTEPWGTLQEDVCQEDRSVSHFTRKQRDDMI*
Ga0136654_12429802	3300010315	Marine Gutless Worms	MRVLRGVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSRFTRKQRDDR*
Ga0136654_12984091	3300010315	Marine Gutless Worms	MRVLKEMVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHLTR
Ga0136654_13112812	3300010315	Marine Gutless Worms	MRALRGVVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHLTRKQR
Ga0136654_13360281	3300010315	Marine Gutless Worms	VLRGVVYMMKSSGPRTEPWGTPQEDVYQEDRSVSHLTRKQ*
Ga0126328_100233851	3300010377	Marine Gutless Worms	EMRVLRGVVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHFTRKQRDDR*
Ga0126330_100537351	3300010378	Marine Gutless Worms	EMRVLRGVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSHFTRKQRDGDEIQL*
Ga0126330_100602513	3300010378	Marine Gutless Worms	MRVLGGVVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHLTRKQRDD
Ga0126330_103558293	3300010378	Marine Gutless Worms	VRGVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSHFTR
Ga0126330_103841921	3300010378	Marine Gutless Worms	MRALRGVVYMTKSSGPRTEPWGTPQEDVYQEDRSVSYVTRKQ
Ga0126327_101553731	3300011190	Marine Gutless Worms	RVLRGVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSHFTRKLRDDR*
Ga0126327_102247471	3300011190	Marine Gutless Worms	MRVLRGVVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHLTR
Ga0126329_101170273	3300012273	Marine Gutless Worms	MRVLREVVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHLTRKQRD
Ga0126329_103545852	3300012273	Marine Gutless Worms	GVVYMTKSSGPRTEPWGTPQEEVCQEDRSVSHFTRKQRDDIYDLN*
Ga0126329_103560391	3300012273	Marine Gutless Worms	EEMRVLRGVVYMTKSSGPRTEPWGTPQEDVYQEDRSVSHLIRKQRDDR*
Ga0209363_10093502	3300027377	Marine Gutless Worms Symbiont	MTKSRGPRTEPWGMPQEEVWKEERLSSHLIQKERDDK
Ga0209363_10378753	3300027377	Marine Gutless Worms Symbiont	REEIRVLRGVVYITKSRGPRTDPWGTPQEEVWKEERFSSHLTRKERDDK
Ga0209363_10404363	3300027377	Marine Gutless Worms Symbiont	MEREEIRVLRGVMYMVKSKGPKTEPRGTPQEEVCKEDSRLSRFIRKQQDDK
Ga0209363_10512212	3300027377	Marine Gutless Worms Symbiont	MEEIRVLRGVVYMTKSGGPRTEPWGTPQEEVWKEERLLSHLARKERDDNKT
Ga0209363_10936922	3300027377	Marine Gutless Worms Symbiont	REREEIRVLRGVVYMTKSRGPRTDPWGTPQEEVWKEERLSSHLTRKERDDK
Ga0209363_11119452	3300027377	Marine Gutless Worms Symbiont	EEIRVLRGVVYMTKSRGPRTEPWGTPQEEVWKEERLSSHLTQKQRDDK
Ga0209780_10208725	3300027389	Marine Gutless Worms Symbiont	MTKRRGPRTDPWGTPQEEIWKEERLSSHLTRKERDDK
Ga0209780_10458224	3300027389	Marine Gutless Worms Symbiont	MTKSRGPRTDPWGTAQEEVWKEERLSSHLIRKERDDK
Ga0209780_10784661	3300027389	Marine Gutless Worms Symbiont	RGVVYMTKSRGPRTDPWGTPQEEVWKEERLSSHLTRKERDDR
Ga0209780_10820021	3300027389	Marine Gutless Worms Symbiont	IRVLRGVVYMTKSRGPRTDPWGTPQEEVWKEERLSSHLTRKERDDK
Ga0209780_10906711	3300027389	Marine Gutless Worms Symbiont	REEIRVLRGVVYMTKSRGPRTDPWGTPQEEVWKEERLSSHSTRKERDDK
Ga0209780_10924832	3300027389	Marine Gutless Worms Symbiont	RKRRDKSVRGVVYMTKSRGPRTDPWGTPQEKVWKEERLSSHLT
Ga0209780_11001001	3300027389	Marine Gutless Worms Symbiont	RVLRGVVYMTKSRGPRTEPWGTPQEEVWKEERLSSHLTQKQRDDK
Ga0209780_11337032	3300027389	Marine Gutless Worms Symbiont	RKREEIRVLRGVVYMTKSRGPRTDPWGTPQEKVWKEERLSSHLTRKERDDK
Ga0209780_11380941	3300027389	Marine Gutless Worms Symbiont	VKVVVRKREEIRVLRGVVYTTKSRGPRTDPWGTPQEEVWKEERLSSHLTRKERDDK
Ga0209780_11573291	3300027389	Marine Gutless Worms Symbiont	VLRGVVYMTKSRGPRTDPWGTPQEEVWKEERLSSHLTRKERDDK
Ga0209780_11600512	3300027389	Marine Gutless Worms Symbiont	SREREEIRVLRGVVYMTKSRGPRTDPWGTPQEEVWKEERFSSHLTRKERDHK
Ga0209791_10090043	3300027540	Marine Gutless Worms Symbiont	MRVCSGVVYMTKSRGSRTERWGTLQRQVCTEEKLLMHLTRKQRDDK
Ga0209791_11132511	3300027540	Marine Gutless Worms Symbiont	KDETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTRKQREER
Ga0209791_12474591	3300027540	Marine Gutless Worms Symbiont	KERDETRVLSGVVYMTKSRGPRTEHWGTPQRQVCGEEKSLLHLTRKQRDER
Ga0209338_10315242	3300027551	Marine Gutless Worms Symbiont	MIVLSGVVYTIKSRGPRTEPCGTPQRQVRREVKLLLHLTRRQREVHVCQEERQSV
Ga0209338_11405001	3300027551	Marine Gutless Worms Symbiont	KERDETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLGI
Ga0209338_13620481	3300027551	Marine Gutless Worms Symbiont	RDETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKLLLHLT
Ga0209743_10358072	3300027556	Marine Gutless Worms Symbiont	DKTRVLSGVVYMTKSRGPRTEPWGTSQRQVCEEEKSLLHLTRKQREER
Ga0209743_11548501	3300027556	Marine Gutless Worms Symbiont	ERDEKRVLSGVVYMTKSRGPRTEPWGTPQRQVCGEEKSLLHLTQKQRDEL
Ga0209743_12317921	3300027556	Marine Gutless Worms Symbiont	KERDETRVLSGVVYMTKSRGPRTEPWETPQRQVCEEEKTLLHLTRKQREER
Ga0209743_12750812	3300027556	Marine Gutless Worms Symbiont	KDIDEMRVLSGVVYMTKSKEPRTESWGTPQRQVCREERLLLHLTRKQRQDR
Ga0209428_10029383	3300027564	Marine Gutless Worms Symbiont	MRVLSGVVYMTKSRGPRTEPWGTPKRQVCREERLLLHLTRKQREDR
Ga0209428_10062466	3300027564	Marine Gutless Worms Symbiont	MRVLSGVVYMTKSRGPRTEPWGTPERQVCREGRLLLHLTQKQREDR
Ga0209428_10245513	3300027564	Marine Gutless Worms Symbiont	ERDETRVLSEVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTRKQREESQRVSALSIK
Ga0209428_11015191	3300027564	Marine Gutless Worms Symbiont	ERDETRVLSGVVYMTKSRGPRTEPWGTPQKQVCEEEKSLLHLTRKQREER
Ga0209428_11433092	3300027564	Marine Gutless Worms Symbiont	SGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTGPKPV
Ga0209428_12167711	3300027564	Marine Gutless Worms Symbiont	ERDETRVLSGVVYMTKSRGPRTEPWRTPQIQVCEEEKSLLHLTRKQQDEK
Ga0209428_12284453	3300027564	Marine Gutless Worms Symbiont	VGLYTFLDEIRVLSGVVYMTKSRGPRTEPWGTPQRQVCREERLLLHLTRKQR
Ga0209428_13710842	3300027564	Marine Gutless Worms Symbiont	MIEPTGAVYVTESRGPRTEPWGTPQRHLCREERLLLHLTRKQRED
Ga0209637_10286451	3300027584	Marine Gutless Worms Symbiont	VVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTRKQREER
Ga0209637_11929951	3300027584	Marine Gutless Worms Symbiont	KSRGPRTEPWGTPQRQVCEEEKSLLHLTRKQREER
Ga0209637_13616711	3300027584	Marine Gutless Worms Symbiont	ETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTRKEREER
Ga0209150_10529223	3300027585	Marine Gutless Worms Symbiont	EDIDEMRVLSGVVYMTKSRGPRTEHCGTPQRQVCREERLLLHLTRKQREDK
Ga0209150_11459682	3300027585	Marine Gutless Worms Symbiont	VVYMTKSRGPRTEPWGTPQKQVCEEEKSLLHLTRKQREER
Ga0209150_12075501	3300027585	Marine Gutless Worms Symbiont	RVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTRKQREER
Ga0209122_10099191	3300027613	Marine Gutless Worms Symbiont	FKDIDEMKVLSGVVYMTKSRGPRTEPWGTPQRQVCREERLLLHLTQKQRQDR
Ga0209122_10159515	3300027613	Marine Gutless Worms Symbiont	RDETRVLSGVVYMTKSRGPRTEPWGTPQRQECGEEKSLLHLTRKQRDER
Ga0209122_10362991	3300027613	Marine Gutless Worms Symbiont	ERDETRVLSGVVYMTKSRGLRTEPWGTPQRQSCGEEKSLLHLTRKHAMEKIPLSLWYL
Ga0209122_11530292	3300027613	Marine Gutless Worms Symbiont	MTVLSGVVYMTKSRGPRSEPWGTPQREVCREERLLLHLTRIQRGQIGPKPV
Ga0209122_12939171	3300027613	Marine Gutless Worms Symbiont	MRVLPVYMTKSRGPRTEPWGTPQRQVCREERLLLHLTQKQRKDR
Ga0209678_10005187	3300027615	Marine Gutless Worms Symbiont	MRVLSGVVYMTNSRGPRTEPWGTPQIEVCREERLLLHLTRKQREDR
Ga0209149_10057742	3300027626	Marine Gutless Worms Symbiont	MRVLSGVVYMIKSRGPRTEPWGTPQRQVCREERLLLHLTRKQREDR
Ga0209149_10104627	3300027626	Marine Gutless Worms Symbiont	MRVLTKSRGPRTEPWGKPQRQVCREEMLLLHLTRKQRDNSLEQCHECQTKRTDE
Ga0209149_10167443	3300027626	Marine Gutless Worms Symbiont	MRVLSGVVYMTKSRGPRTEPWGTPERQVCREGRLLLHLTRKQREDR
Ga0209149_10321583	3300027626	Marine Gutless Worms Symbiont	MRVCSGVVYMTKSRGSRTEPWGTLQRQVCTEEKLLMHLTRKQRDDK
Ga0209149_10357268	3300027626	Marine Gutless Worms Symbiont	VSSAYRWRFKERDETRVLTKSKGPRTEPWGTPQRQVCGEEKSLLHLTR
Ga0209149_10522893	3300027626	Marine Gutless Worms Symbiont	MRVLSGVVHMTKSRGPRTELWGTPQRQVCREERLLLHLTQKQREDR
Ga0209149_10567673	3300027626	Marine Gutless Worms Symbiont	RDETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTGPKPV
Ga0209149_11016922	3300027626	Marine Gutless Worms Symbiont	MRVLSGVVYMTKSRGPRTEPWGTPQRQVYREERLLLHLTRKQGEDG
Ga0209149_11382051	3300027626	Marine Gutless Worms Symbiont	ETRVLSGVVYMTKSRGPRTEPWGTPQKQVCEEEKSLLHLTRKQREER
Ga0209149_11656581	3300027626	Marine Gutless Worms Symbiont	KSTEWVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHLTRKQREER
Ga0209149_11796821	3300027626	Marine Gutless Worms Symbiont	KERDETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEKEKSLLHLTR
Ga0209149_12076311	3300027626	Marine Gutless Worms Symbiont	DIDEIRVLSGVVYMTKSRGPRTEPWGTPQRQVCREERLLLHLTRKQREDR
Ga0209149_12377991	3300027626	Marine Gutless Worms Symbiont	ERDETRVLSVVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHSTRKQRDER
Ga0209149_12474813	3300027626	Marine Gutless Worms Symbiont	VGLYTFLDEIRVLSGVVYMTKSRGPRTEPWGTPQKQMCREERLLLHLTRKQRKDR
Ga0209149_13477051	3300027626	Marine Gutless Worms Symbiont	RVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKLLLHLT
Ga0209339_10448914	3300027632	Marine Gutless Worms Symbiont	MRVLSGVVDMTKSRGPRTEPWGTPQRQVCREERLLLHLTRKQRENR
Ga0209339_10531301	3300027632	Marine Gutless Worms Symbiont	MRVLSGVVYMTKSRGPRTEPWGTPQRQVRREERLLLHLTRKQGEDR
Ga0209339_10682461	3300027632	Marine Gutless Worms Symbiont	DETRLLSGVVYMTKSRGPRTEPWGTPQRQVCGEEKSLLHLTRKQQEER
Ga0209339_11729002	3300027632	Marine Gutless Worms Symbiont	ERDETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLHFTRKQREEI
Ga0209339_12335751	3300027632	Marine Gutless Worms Symbiont	FKERDETRVLSGVVYMTKSRGPRTEPWGTPQRQVCEEEKSLLVAIQS
Ga0209339_12689673	3300027632	Marine Gutless Worms Symbiont	VGLYTFLDEIRVLSGVVYMTKSRGPRTEPWGTPQRQVCREERLL
Ga0209339_12848731	3300027632	Marine Gutless Worms Symbiont	TDEMRVLSGVVYMNMTKRRGPRTEPWGTPQRQVCREERLLLHLTRKQ
Ga0209339_13297521	3300027632	Marine Gutless Worms Symbiont	LSGVVYMTKSRGPRTEPLGTPQRQVCEEEKSLLHLTRKQREER
Ga0209339_13722621	3300027632	Marine Gutless Worms Symbiont	FKERDEIRVLSGVVYMTKSRGPITESWVTPQRQVCGEEKSLLHLTRKQLEER
Ga0209259_10096464	3300027658	Marine Gutless Worms Symbiont	MRVLRGVAYMIKSSGPRTEPWGTPQEEVHKDEKALLHLTRKDRDDK
Ga0209459_103779641	3300027661	Marine Gutless Worms Symbiont	TKSRVPRTEPWGTPQEEVQKDEKVLLHLTQKERDDR
Ga0209459_104075792	3300027661	Marine Gutless Worms Symbiont	MMRSRGPRKEPWGTLQEEVQKDEKALLHLKRKERDDK