NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F043200

Metagenome Family F043200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043200
Family Type Metagenome
Number of Sequences 156
Average Sequence Length 40 residues
Representative Sequence MLFLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Number of Associated Samples 22
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 11.54 %
% of genes near scaffold ends (potentially truncated) 12.82 %
% of genes from short scaffolds (< 2000 bps) 48.08 %
Associated GOLD sequencing projects 22
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (80.128 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(68.590 % of family members)
Environment Ontology (ENVO) Unclassified
(99.359 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(73.718 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 45.59%    Coil/Unstructured: 54.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF14291DUF4371 2.56
PF03732Retrotrans_gag 1.92
PF08284RVP_2 1.28
PF00069Pkinase 1.28
PF08263LRRNT_2 0.64
PF13855LRR_8 0.64
PF14380WAK_assoc 0.64
PF01535PPR 0.64
PF12776Myb_DNA-bind_3 0.64
PF03600CitMHS 0.64
PF00931NB-ARC 0.64
PF00646F-box 0.64
PF03140DUF247 0.64
PF00078RVT_1 0.64
PF13961DUF4219 0.64
PF07727RVT_2 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 5.13

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.13 %
UnclassifiedrootN/A19.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009156|Ga0111538_12352965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa669Open in IMG/M
3300028786|Ga0307517_10036765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5493Open in IMG/M
3300028786|Ga0307517_10057525All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3764Open in IMG/M
3300028786|Ga0307517_10060166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3622Open in IMG/M
3300028786|Ga0307517_10074201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3003Open in IMG/M
3300028786|Ga0307517_10083541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2698Open in IMG/M
3300028786|Ga0307517_10084265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2677Open in IMG/M
3300028786|Ga0307517_10088557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2557Open in IMG/M
3300028786|Ga0307517_10101936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2254Open in IMG/M
3300028786|Ga0307517_10109111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2119Open in IMG/M
3300028786|Ga0307517_10121000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1935Open in IMG/M
3300028786|Ga0307517_10182437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1351Open in IMG/M
3300028786|Ga0307517_10192832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1289Open in IMG/M
3300028786|Ga0307517_10265346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa992Open in IMG/M
3300028786|Ga0307517_10314799Not Available869Open in IMG/M
3300028786|Ga0307517_10346633Not Available808Open in IMG/M
3300028786|Ga0307517_10383214Not Available750Open in IMG/M
3300028786|Ga0307517_10390297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa740Open in IMG/M
3300028786|Ga0307517_10402780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa723Open in IMG/M
3300028786|Ga0307517_10436453Not Available682Open in IMG/M
3300028794|Ga0307515_10013004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa15592Open in IMG/M
3300028794|Ga0307515_10015240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae14179Open in IMG/M
3300028794|Ga0307515_10016668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13439Open in IMG/M
3300028794|Ga0307515_10020203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11903Open in IMG/M
3300028794|Ga0307515_10027991All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9599Open in IMG/M
3300028794|Ga0307515_10120457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2976Open in IMG/M
3300028794|Ga0307515_10130987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2762Open in IMG/M
3300028794|Ga0307515_10135668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2678Open in IMG/M
3300028794|Ga0307515_10160728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2292Open in IMG/M
3300028794|Ga0307515_10168283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2198Open in IMG/M
3300028794|Ga0307515_10174945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2121Open in IMG/M
3300028794|Ga0307515_10197577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1898Open in IMG/M
3300028794|Ga0307515_10203557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1847Open in IMG/M
3300028794|Ga0307515_10212675All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1773Open in IMG/M
3300028794|Ga0307515_10228813All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1657Open in IMG/M
3300028794|Ga0307515_10253590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1507Open in IMG/M
3300028794|Ga0307515_10259864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1474Open in IMG/M
3300028794|Ga0307515_10264947All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1448Open in IMG/M
3300028794|Ga0307515_10495653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa832Open in IMG/M
3300028794|Ga0307515_10541904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa773Open in IMG/M
3300028794|Ga0307515_10674907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa647Open in IMG/M
3300030521|Ga0307511_10001843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta22262Open in IMG/M
3300030521|Ga0307511_10025926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5389Open in IMG/M
3300030521|Ga0307511_10046113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3590Open in IMG/M
3300030521|Ga0307511_10054872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3135Open in IMG/M
3300030521|Ga0307511_10061452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2862Open in IMG/M
3300030521|Ga0307511_10062889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2811Open in IMG/M
3300030521|Ga0307511_10071533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2529Open in IMG/M
3300030521|Ga0307511_10084750All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2196Open in IMG/M
3300030521|Ga0307511_10126778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1553Open in IMG/M
3300030521|Ga0307511_10273698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa787Open in IMG/M
3300030521|Ga0307511_10284918Not Available760Open in IMG/M
3300030521|Ga0307511_10293094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa741Open in IMG/M
3300030521|Ga0307511_10311175Not Available703Open in IMG/M
3300030521|Ga0307511_10401889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa562Open in IMG/M
3300030521|Ga0307511_10448776Not Available511Open in IMG/M
3300030522|Ga0307512_10083444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2278Open in IMG/M
3300030522|Ga0307512_10238076All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa925Open in IMG/M
3300031456|Ga0307513_10146192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2281Open in IMG/M
3300031456|Ga0307513_10179255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1984Open in IMG/M
3300031456|Ga0307513_10359869All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1200Open in IMG/M
3300031456|Ga0307513_10474684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa971Open in IMG/M
3300031456|Ga0307513_10730742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa695Open in IMG/M
3300031456|Ga0307513_10849187Not Available619Open in IMG/M
3300031456|Ga0307513_10871022All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa607Open in IMG/M
3300031507|Ga0307509_10009839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11835Open in IMG/M
3300031507|Ga0307509_10017184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8334Open in IMG/M
3300031507|Ga0307509_10025412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6613Open in IMG/M
3300031507|Ga0307509_10035006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5515Open in IMG/M
3300031507|Ga0307509_10100616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2928Open in IMG/M
3300031507|Ga0307509_10247911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1567Open in IMG/M
3300031507|Ga0307509_10705369Not Available675Open in IMG/M
3300031507|Ga0307509_10752971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa639Open in IMG/M
3300031507|Ga0307509_10806009Not Available603Open in IMG/M
3300031616|Ga0307508_10017217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6570Open in IMG/M
3300031616|Ga0307508_10122656Not Available2201Open in IMG/M
3300031616|Ga0307508_10429093Not Available913Open in IMG/M
3300031616|Ga0307508_10458889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa867Open in IMG/M
3300031616|Ga0307508_10478229Not Available839Open in IMG/M
3300031616|Ga0307508_10670927Not Available643Open in IMG/M
3300031649|Ga0307514_10178445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1373Open in IMG/M
3300031649|Ga0307514_10206067Not Available1228Open in IMG/M
3300031649|Ga0307514_10223385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1151Open in IMG/M
3300031649|Ga0307514_10231753Not Available1118Open in IMG/M
3300031649|Ga0307514_10235839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1102Open in IMG/M
3300031649|Ga0307514_10310323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa875Open in IMG/M
3300031649|Ga0307514_10391424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa715Open in IMG/M
3300031730|Ga0307516_10134652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2247Open in IMG/M
3300031730|Ga0307516_10232531Not Available1546Open in IMG/M
3300031730|Ga0307516_10341105All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1165Open in IMG/M
3300031730|Ga0307516_10352306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1137Open in IMG/M
3300031730|Ga0307516_10525193Not Available837Open in IMG/M
3300031730|Ga0307516_10546439Not Available812Open in IMG/M
3300031730|Ga0307516_10641709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa716Open in IMG/M
3300031730|Ga0307516_10808369Not Available599Open in IMG/M
3300031730|Ga0307516_10827419Not Available588Open in IMG/M
3300031838|Ga0307518_10001221Not Available19273Open in IMG/M
3300031838|Ga0307518_10073194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2480Open in IMG/M
3300031838|Ga0307518_10099146Not Available2088Open in IMG/M
3300031838|Ga0307518_10125310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1812Open in IMG/M
3300031838|Ga0307518_10311722Not Available947Open in IMG/M
3300031838|Ga0307518_10356877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa846Open in IMG/M
3300031838|Ga0307518_10396040Not Available773Open in IMG/M
3300031838|Ga0307518_10428917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa720Open in IMG/M
3300032354|Ga0325403_1000142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus40183Open in IMG/M
3300032354|Ga0325403_1001202All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta21107Open in IMG/M
3300032354|Ga0325403_1001888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae18057Open in IMG/M
3300032354|Ga0325403_1002920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa15364Open in IMG/M
3300032354|Ga0325403_1003417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus14487Open in IMG/M
3300032354|Ga0325403_1004135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13444Open in IMG/M
3300032354|Ga0325403_1004154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13430Open in IMG/M
3300032354|Ga0325403_1004788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta12638Open in IMG/M
3300032354|Ga0325403_1007151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus10672Open in IMG/M
3300032354|Ga0325403_1009961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9062Open in IMG/M
3300032354|Ga0325403_1015848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7010Open in IMG/M
3300032354|Ga0325403_1015900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6994Open in IMG/M
3300032354|Ga0325403_1021162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5853Open in IMG/M
3300032354|Ga0325403_1022365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5654Open in IMG/M
3300032354|Ga0325403_1060400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2384Open in IMG/M
3300032354|Ga0325403_1072941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1887Open in IMG/M
3300032354|Ga0325403_1076690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1765Open in IMG/M
3300032354|Ga0325403_1080369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1655Open in IMG/M
3300032354|Ga0325403_1102426Not Available1140Open in IMG/M
3300032355|Ga0325401_1023470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5671Open in IMG/M
3300032355|Ga0325401_1066412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2464Open in IMG/M
3300032355|Ga0325401_1179574Not Available759Open in IMG/M
3300032374|Ga0325400_1002085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta17217Open in IMG/M
3300032374|Ga0325400_1065992All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2757Open in IMG/M
3300032374|Ga0325400_1068583All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2667Open in IMG/M
3300032374|Ga0325400_1132562Not Available1409Open in IMG/M
3300032374|Ga0325400_1143841Not Available1290Open in IMG/M
3300032374|Ga0325400_1147061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1259Open in IMG/M
3300032374|Ga0325400_1271723Not Available640Open in IMG/M
3300032389|Ga0325405_1000245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida51429Open in IMG/M
3300032389|Ga0325405_1002396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae19272Open in IMG/M
3300032389|Ga0325405_1002906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta17689Open in IMG/M
3300032389|Ga0325405_1004051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15042Open in IMG/M
3300032389|Ga0325405_1004373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus14456Open in IMG/M
3300032389|Ga0325405_1017620All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6429Open in IMG/M
3300032389|Ga0325405_1039067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3311Open in IMG/M
3300032390|Ga0325404_1002607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae19281Open in IMG/M
3300032390|Ga0325404_1009176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae10090Open in IMG/M
3300032390|Ga0325404_1010756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides9146Open in IMG/M
3300032390|Ga0325404_1032955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3915Open in IMG/M
3300032735|Ga0325410_1037367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3537Open in IMG/M
3300032740|Ga0325411_1000465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida42544Open in IMG/M
3300032740|Ga0325411_1004825All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15046Open in IMG/M
3300032741|Ga0325414_1044530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3175Open in IMG/M
3300033179|Ga0307507_10172952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1564Open in IMG/M
3300033180|Ga0307510_10004906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa15825Open in IMG/M
3300033180|Ga0307510_10163987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1814Open in IMG/M
3300033180|Ga0307510_10525555Not Available627Open in IMG/M
3300034389|Ga0325419_000565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae39750Open in IMG/M
3300034389|Ga0325419_003055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta18831Open in IMG/M
3300034389|Ga0325419_006393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12863Open in IMG/M
3300034389|Ga0325419_015862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7271Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza68.59%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem27.56%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf3.21%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0111538_1235296513300009156Populus RhizosphereMLFLHENKLEVEKDFQGVEILVVQNFSYKGGAIVIVDF*
Ga0307517_1003676513300028786EctomycorrhizaMLFLHENKLEVEKDFQGMKILVVQNFSYKGRATVIVDFEP
Ga0307517_1005752513300028786EctomycorrhizaMLFLHENKLEVENDFQGIKILIAQNFSYKEGAIVIVDFKP
Ga0307517_1006016623300028786EctomycorrhizaMMLFLHENKLEVEKDIQGMKILVVQNFSYKGGAIMIVNFEP
Ga0307517_1007420113300028786EctomycorrhizaMLFMHENKLKVEKDFQGMKIVVVQNFSYKEGVLVIVNFES
Ga0307517_1008354113300028786EctomycorrhizaMLFRHENKLEVEKDFQGMKILVVQNFSYKGGAIMIDDFEP
Ga0307517_1008426523300028786EctomycorrhizaMHEHKLKVEKDFQGMKILVVQIFSYKGGVIVIVDFEF
Ga0307517_1008855713300028786EctomycorrhizaENKLEVEKDFQRMKILVVQNFTYKGGAIVIVDFEP
Ga0307517_1010193623300028786EctomycorrhizaMTLNNVVLHENNLEVEKDFQGMKILILQNFSYKEEAIVIIDFEP
Ga0307517_1010911133300028786EctomycorrhizaMTLDMLLLHENKLEVEEDFQGIKILVVQNFSYKEGAVVIVDFES
Ga0307517_1012100013300028786EctomycorrhizaMLFLHENKLEVEKDFQGMKILVVQNFTYKGGAIVIVDFEP
Ga0307517_1018243723300028786EctomycorrhizaMMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFGP
Ga0307517_1019283213300028786EctomycorrhizaMHENKLEVEKNFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307517_1026534613300028786EctomycorrhizaMILDELFLHENKLEVEKDFQGMKILVVQNFSYKGVAIVIVDFEP
Ga0307517_1031479913300028786EctomycorrhizaMLLMHENKLEVEKNFQGIKILVVQNFSYKGGAIVIIDFKP
Ga0307517_1034663313300028786EctomycorrhizaMHENKLEVEKDFQWMKILVGQNFSYKGGAIVIVDFEP
Ga0307517_1038321413300028786EctomycorrhizaMLFLHENKLEVEKDFQGTEILVVQNFSCKGGAIVIVDF
Ga0307517_1039029713300028786EctomycorrhizaPWMMLFLHENKLEVEKDFQGMEILVVQNFSYKEGAIVIVDF
Ga0307517_1040278013300028786EctomycorrhizaMLFLHENKLEVENDIQRMKILVVQNFSYKGGAIMIVDFEP
Ga0307517_1043645313300028786EctomycorrhizaMFLLHENKLEVEKDFQGMKILVVQNFSYKERAVVIVDFEP
Ga0307515_1001300483300028794EctomycorrhizaMLFLDENKLEVEKDIQGMKVLIVQNFSYKGGAIMIVDFEL
Ga0307515_1001524083300028794EctomycorrhizaMHEHKLKVENDFQGMKILVVQIFSYKEGVIVIVDLELIFS
Ga0307515_1001666813300028794EctomycorrhizaMMLFLHENKLEVEKDFQGVEILVVQNFSYKGGAIVIVDF
Ga0307515_1002020343300028794EctomycorrhizaMTLNNVVLHENNLEVEKDFQGMKILILQNFSYKEEAIVIVDFES
Ga0307515_1002799143300028794EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFEP
Ga0307515_1012045713300028794EctomycorrhizaMMLFLHENKLEVEKDFQGMEILVVQNFSYKEGAIVIVDF
Ga0307515_1013098713300028794EctomycorrhizaMMLFLHENKLEVEKDFQGMKILVVQNFSYKGGTIVIVDFNP
Ga0307515_1013566813300028794EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVILSLKTK
Ga0307515_1016072813300028794EctomycorrhizaMLFIHENKLKVEKDFQGMKIIVVQNFSYKEGVLVIVNFES
Ga0307515_1016828313300028794EctomycorrhizaMHENKLEVEKDFQWMKILVGQNFSYKGGAIVIIDFEP
Ga0307515_1017494513300028794EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVD
Ga0307515_1019757723300028794EctomycorrhizaMLHMHENKLEVEKDFQGMKILVVQNFSYEGEAIIIVDFES
Ga0307515_1020355723300028794EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVIIDFEP
Ga0307515_1021267513300028794EctomycorrhizaMLFLHEIKLEVEKDFQRMKILVVQNFSYKGGAIVIVDFEP
Ga0307515_1022881313300028794EctomycorrhizaMLFLRENKLEVEKDFQGMKILVVQNFSYKGGPIVIVDFEP
Ga0307515_1025359013300028794EctomycorrhizaMMLFLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDVEP
Ga0307515_1025986413300028794EctomycorrhizaMTLDNVMHENKLKVEKDFQGMKILVVQNFSYKGGVIVIVDFES
Ga0307515_1026494713300028794EctomycorrhizaMLLMHENKLEVEKDFQWMKILVGQNFSYKGGAIVIVDFEP
Ga0307515_1049565313300028794EctomycorrhizaMLFLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307515_1054190413300028794EctomycorrhizaMLFLHENKLEVEKDIQGMKILIVQNFSYKGGAIMIVNFEP
Ga0307515_1067490723300028794EctomycorrhizaMLFLHENKLEVEKDFQGMKILVVQNFSYKRGAIVIVDFEP
Ga0307511_10001843243300030521EctomycorrhizaMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVD
Ga0307511_1002592613300030521EctomycorrhizaWIMLFMHENKLEVEKDFQGMKILVVQNFNYKGGAIMIVDFEP
Ga0307511_1004611313300030521EctomycorrhizaMLHMHENKLEVEKDFKGMKILVVQNFSYEGEAIMIVDFEP
Ga0307511_1005487213300030521EctomycorrhizaMHENKLEVEKNFQGIKILVVQNFSYKGGAIVIIDFKP
Ga0307511_1006145223300030521EctomycorrhizaMLFIYENKLEVEKDFQGMKTLIVKKFSYKGGAIVIVDFEP
Ga0307511_1006288923300030521EctomycorrhizaMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFGP
Ga0307511_1007153343300030521EctomycorrhizaMTLDNVMHENKLKVEKDFQGMKILVVQNFSYKGGIIVIVDFES
Ga0307511_1008475013300030521EctomycorrhizaWMMLFLHENKLEVEKDFQGMKILVVQNFSYKGGTIVIVDFNP
Ga0307511_1012677823300030521EctomycorrhizaMMLFLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307511_1027369813300030521EctomycorrhizaMMLFLHETKLEVENDIQRMKILVVQNFSYKGGAIMIVDFEP
Ga0307511_1028491823300030521EctomycorrhizaMLFLHENKLEVEKDFQRMKILVVQNFTYKGGAIVIVDFEP
Ga0307511_1029309413300030521EctomycorrhizaFNDAKXPWMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIMIVDFEP
Ga0307511_1031117513300030521EctomycorrhizaMMLFLHEIKLEVEKDFQRMKILVVQNFSYKGGAIVIVDFEP
Ga0307511_1040188913300030521EctomycorrhizaMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFEP
Ga0307511_1044877613300030521EctomycorrhizaMLFLHENKLEVEKDFQGMKIVVVQNFSYKGGAIMIVDFDP
Ga0307512_1008344413300030522EctomycorrhizaMLFLHENKLEVEKDFQGMKILVVQNFSYKGGTIVIVDFNP
Ga0307512_1023807613300030522EctomycorrhizaMLFLHENKLEVEKDIQGMKILVVQNFSYKGGAIMIVDFEP
Ga0307513_1014619233300031456EctomycorrhizaMLFLHENKLEVEKDIQGMKILIVQNFSYKGGAIMIVDFEP
Ga0307513_1017925513300031456EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVLVDFEP
Ga0307513_1035986913300031456EctomycorrhizaMLILHENKLEVEKDFQGMKILVVQTFSYKEGAIVIVDFESSN
Ga0307513_1047468413300031456EctomycorrhizaMLLLHENKLEVEKDFQGMKILIVQNFSYKEGAIVIVDFGP
Ga0307513_1073074223300031456EctomycorrhizaDELFLHENKLEVEKDFQGMKILVVQNFSYKGVAIVIVDFEP
Ga0307513_1084918713300031456EctomycorrhizaPWIMLFLHENKLEVENDFQGIKILIAQNFSYKEGAIVIVDFKP
Ga0307513_1087102213300031456EctomycorrhizaMLFLHENKLEVEKDFQGMEILVVQNFSYKEGAIVIVDF
Ga0307509_1000983963300031507EctomycorrhizaMMLFLHENKLEVENDIQRMKILVVQNFSYKGGAIMIVDFEP
Ga0307509_1001718413300031507EctomycorrhizaMMLFLRENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307509_1002541283300031507EctomycorrhizaMLFMHENKLKVEKDFQGMKILVVQNFNYKGGAIMIVDFEP
Ga0307509_1003500673300031507EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFKP
Ga0307509_1010061623300031507EctomycorrhizaMLFRHENKLEVEKGFQGMKILVVQNFSYKGGVIMIDDFEP
Ga0307509_1024791113300031507EctomycorrhizaMHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307509_1070536913300031507EctomycorrhizaMTLDMLLLHENKLEVEEDFQGIKILVVQNFSYKEGAVVIVD
Ga0307509_1075297113300031507EctomycorrhizaKLEVEKDFQGMKILFVQTFSYKEGAIVIVDFESSN
Ga0307509_1080600913300031507EctomycorrhizaMMLILHENKLEVEKDFQGMKFLVVQNFSYKEGAIVIVDFEP
Ga0307508_1001721713300031616EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIMIVDFEP
Ga0307508_1012265613300031616EctomycorrhizaMLLVHENKLEVEKDFQWMKILVGQNFSYKGGAIVIVDFEP
Ga0307508_1042909313300031616EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQNSSYKEGAIVIVDFEPFIEINHAQN
Ga0307508_1045888913300031616EctomycorrhizaMTLDELFLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307508_1047822923300031616EctomycorrhizaMHENKLEVEKDFQGMKILVVQNFSYEGEPIIIVDFEP
Ga0307508_1067092713300031616EctomycorrhizaMLFLHENKLEVEKDFQGMKILVVQNFTYKGEAIVIVDFKP
Ga0307514_1017844513300031649EctomycorrhizaMMLFLHENKLEVEKDFQGTEILVVQNFSCKGGAIVIVDF
Ga0307514_1020606713300031649EctomycorrhizaMMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVGFEP
Ga0307514_1022338513300031649EctomycorrhizaMMLFLHENKLEVEKDFQGMKILVVQNFSYKRGAIVIVDFEP
Ga0307514_1023175313300031649EctomycorrhizaMLFMHENKLEVEKDFQGMKIFVVQAFSYKGGAIVIVDFEP
Ga0307514_1023583913300031649EctomycorrhizaFLHENKLEVEKDFQGMEILVVQNFSYKGGAIVIVDF
Ga0307514_1031032313300031649EctomycorrhizaDAKXPWLMLLMHENKLEVEKDFQWMKILVGQNFSYKGGAIVIIDFEP
Ga0307514_1039142413300031649EctomycorrhizaMMLFFHENKLEVEKDFQGMKILVVQNFSYKGGAVVIVDFEP
Ga0307516_1013465233300031730EctomycorrhizaMMLFLHENKLEVEKDIQGMKILVVQNFSYKGGAIMIVDFEP
Ga0307516_1023253113300031730EctomycorrhizaMLHMHENKLEVEKDFQGMKILVVQNFSYEGEAIIIVDFEP
Ga0307516_1034110513300031730EctomycorrhizaMLFLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFES
Ga0307516_1035230613300031730EctomycorrhizaMLLLDENKLEVEKDFQGMKILVVQNFSYKEGAVVIVDFEP
Ga0307516_1052519313300031730EctomycorrhizaMLFRHENQLEVEKDFQGMKFLVVQNFSYKGGAIMIDDFKP
Ga0307516_1054643913300031730EctomycorrhizaMMLFMHENKLEVEKNFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307516_1064170913300031730EctomycorrhizaMLFLHENKLEVEKDIQGMKILVVQNFSYKGGAIMIVNFEP
Ga0307516_1080836913300031730EctomycorrhizaMLHMHENKLEVEKDFQGMKILVVQNFSYEGEPIIIVDFEP
Ga0307516_1082741913300031730EctomycorrhizaMLFRHENKLEVEKGFQGMKILVVQNFSYKGGAIMIDDFEP
Ga0307518_10001221113300031838EctomycorrhizaMLFIHENNLEVGKDFQGKKILVVQNFSCKRGAIVIVDFKS
Ga0307518_1007319413300031838EctomycorrhizaMMLFFHENKLEVEKDFQGMKILVVQNFSYKGGAVVIVD
Ga0307518_1009914613300031838EctomycorrhizaMHKNKLEVEKDFQGMKILVVQNFSYEGEAIIIVDFES
Ga0307518_1012531013300031838EctomycorrhizaMLFLHEIKLEVEKEFQGMKILVVQNFSYKGEAIVIVDFEP
Ga0307518_1031172213300031838EctomycorrhizaMLILHENKLEVEKDFQGMKILVVQNFSYKEGAIVLVDFEP
Ga0307518_1035687713300031838EctomycorrhizaMLFLRENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0307518_1039604023300031838EctomycorrhizaMMLILHENKLEVEKDFQGMKILVVQTFSYKEGAIVIVDFESSN
Ga0307518_1042891713300031838EctomycorrhizaLHENKLEVEKDFQGMEILVVQNFSYKEGAIVIVDF
Ga0325403_1000142293300032354XylemMHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFKP
Ga0325403_100120273300032354XylemMHENKLEVEKDFQGMKILIVQNFSCKGGVIVIVDFEL
Ga0325403_1001888113300032354XylemMLFLHENKLEVEKNFQGMKILVTQNFSYKRGDIVIVDFEP
Ga0325403_100292083300032354XylemMMLILHENKLEVEKDFQGMKILVVQNFRYKEGVIVIVDFEP
Ga0325403_100341793300032354XylemMMLFLHENKLEVEKDFQGMKILVVQNCSYKRGAIVIVDFEP
Ga0325403_100413513300032354XylemMHENKLKVGKDFQGMKILFVQNFSYKGGVVVIIDFES
Ga0325403_100415453300032354XylemMLFLHENKLEVEKDFHWMKILVAQNFSYKGGAIVIVDFEP
Ga0325403_100478863300032354XylemMHENKLEVEKNFQGIKILVVQNFSYKGGAIVIVDFEP
Ga0325403_100715173300032354XylemMTLDMLLLHENKLKVEEDFQGIKIFVVQNFSYKEGAVVIVDFES
Ga0325403_100996163300032354XylemMMLFLHENKLEVEKDFQGMEILVVQNFSYKGGAIVIVDFEP
Ga0325403_101584813300032354XylemMHENKLKVEKDFQGMKILVVQNFSYKGGVIVIVDFES
Ga0325403_101590023300032354XylemMHENKLEVEKNFQWMKILVGQNFSYKGGAIVIVDFEPQNKIIWS
Ga0325403_102116253300032354XylemMLFSHENKLEVEKDFQGMKILVVQNFTYKGKDIVIIDFEP
Ga0325403_102236543300032354XylemMLILHENKLEVEKDFRGMKILVVQNFSYKEGAIVIVDFKP
Ga0325403_106040023300032354XylemMMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFEP
Ga0325403_107294123300032354XylemMMLLLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0325403_107669023300032354XylemMLILQENKLEVEKDFQGMKILVVQNFSYKEGAIVIIDFEP
Ga0325403_108036923300032354XylemMILFLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0325403_110242613300032354XylemMLFRHENKLEVEKDFQGMKILVVQNFSYKGEAIMIDDFEP
Ga0325401_102347013300032355XylemMLFLHENKLEVEKDFQGMKILVVQNCSYKRGAIVIVDFEP
Ga0325401_106641223300032355XylemMFLLHENKLEVEKDFQGMKILVVQNFSYKQGAVVIVDFEP
Ga0325401_117957413300032355XylemMMLILHENKLEVEKDFQGMKILVVQNFRYKEGIIVIVDFEP
Ga0325400_1002085123300032374XylemMLLMHENKLEVEKNFQGIKILVVQNFSYKGGAIVIVDFEP
Ga0325400_106599243300032374XylemMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVI
Ga0325400_106858333300032374XylemMMLILQENKLEVEKDFQGMKILVVQNFSYKEGAIVIIDFEP
Ga0325400_113256223300032374XylemDAKXPWMMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFEP
Ga0325400_114384113300032374XylemDAKXPWMMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVIIDFEP
Ga0325400_114706113300032374XylemMMLLLHENKLEVEKDFQGMKILVVQNFSYKGGATVIVDFEP
Ga0325400_127172313300032374XylemMLFLHENKLEVEKDFHWMKILVAQNFSYKGGAIVIVNFEP
Ga0325405_100024593300032389XylemMMLFLHENKLEVEKDFQGMEILVQNFSYKEEAIVIVDFEP
Ga0325405_100239673300032389XylemMMLFLHENKLEVEKDFQGMKILVVQKFSYKRGAIVIVDFEP
Ga0325405_100290683300032389XylemMTLDNVDLHENNLEVEKDFQGMKILILQNFSYKEEAIVIVDFEP
Ga0325405_1004051113300032389XylemMHENKLEVEKNFQGMKILIVQNFSCKGGAIVIVDFEP
Ga0325405_100437363300032389XylemMLFRHENKLEVEKDFQEMKILVVQNFSYKGGAIMIDDFEP
Ga0325405_101762013300032389XylemMHENKLEVEKNFQWMKILVGQNFSYKGGAIVIVDFEPQNKII
Ga0325405_103906713300032389XylemMLLLHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFEP
Ga0325404_1002607163300032390XylemMLFLHENKLEVEKDFQGMKILVVQKFSYKRGAIVIVDFEP
Ga0325404_100917643300032390XylemMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAIVIVDFEP
Ga0325404_101075653300032390XylemMMLFLHENKLEVENDFQGMKIVVVQNFSYKGGAIVIVDFEP
Ga0325404_103295533300032390XylemMLFMHENKLKVEKDFQGMKILVVQNFSYKGGVIVIVDFES
Ga0325410_103736713300032735XylemMMLFSHENKLEVEKDFQGMKILVVQNFTYKGKDIVIIDFEP
Ga0325411_100046593300032740XylemMLFLHENKLEVEKDFQGMEILVQNFSYKEEAIVIVDFEP
Ga0325411_100482523300032740XylemMLFMHENKLEVEKNFQGMKILIVQNFSCKGGAIVIVDFEP
Ga0325414_104453023300032741LeafMMLILHENKLEVEKDFRGMKILVVQNFSYKEGAIVIVDFKP
Ga0307507_1017295233300033179EctomycorrhizaWMMLFLHENKLEVEKDFQGMKILVVQNFSYKGGTIVIVDFNL
Ga0307510_1000490643300033180EctomycorrhizaMHENKLEVEKDFQGMKILVVQNFSYEGEAIIIVDFEP
Ga0307510_1016398713300033180EctomycorrhizaMLLLHENKLEVEKDFQGMKILVVQNFSYKEGAVVIVDFEP
Ga0307510_1052555513300033180EctomycorrhizaMHENKLKVEKDFQGMKIVVVQNFSYKEGVLVIVNFES
Ga0325419_000565_9670_97833300034389LeafMHEHKLKVEKDFQGKKILVVQIFSYKGGVIVIVDFEF
Ga0325419_003055_16900_170223300034389LeafMFFMHENKLEVEKDFQGMKILVVQNFSYKGGAIVIVDFKP
Ga0325419_006393_10748_108703300034389LeafMLFMHENKLEVEKDFQGMKILIVQNFSCKGGVIVIVDFEL
Ga0325419_015862_4286_44083300034389LeafMLFIHENKLEVEKDFQWIKILVVQNFSYKGEAIVIVDFEL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.