Metagenome Family F043164

Basic Information
Family ID	F043164
Family Type	Metagenome
Number of Sequences	156
Average Sequence Length	47 residues
Representative Sequence	AATDRTGKQPQQGLPDHFNKLMDSPCTNHAYPVKHLYKDCELLKCFL
Number of Associated Samples	66
Number of Associated Scaffolds	156

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	9.52 %
% of genes near scaffold ends (potentially truncated)	51.28 %
% of genes from short scaffolds (< 2000 bps)	94.23 %
Associated GOLD sequencing projects	65
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.29

Most Common Taxonomy
Group	Unclassified (55.128 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.513 % of family members)
Environment Ontology (ENVO)	Unclassified (95.513 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (95.513 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 32.00% β-sheet: 0.00% Coil/Unstructured: 68.00%
Feature Viewer

Powered by Feature Viewer

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
All Organisms	root	All Organisms	44.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
cellular organisms	root	All Organisms → cellular organisms	44.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	44.23 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	43.59 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	43.59 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	43.59 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	43.59 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	43.59 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	43.59 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	43.59 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	43.59 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	43.59 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	43.59 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	43.59 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	43.59 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	43.59 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	43.59 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	42.31 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	42.31 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	39.74 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.64 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	39.74 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.64 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	36.54 %
Anthephorinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae	0.64 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.64 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.64 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	36.54 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.64 %
Digitaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria	0.64 %
Aegilops	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops	0.64 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	26.28 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	5.77 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	3.85 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	0.64 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.64 %
Aegilops tauschii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii	0.64 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.13 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	26.28 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	5.77 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3.85 %
Aegilops tauschii subsp. strangulata	subspecies	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata	0.64 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	0.64 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.64 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.64 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.64 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_102017777	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300005334\|Ga0068869_102019493	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	518	Open in IMG/M
3300013296\|Ga0157374_12917574	Not Available	505	Open in IMG/M
3300013297\|Ga0157378_11427511	Not Available	735	Open in IMG/M
3300015268\|Ga0182154_1023103	Not Available	692	Open in IMG/M
3300015268\|Ga0182154_1028008	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	658	Open in IMG/M
3300015274\|Ga0182188_1015082	Not Available	726	Open in IMG/M
3300015274\|Ga0182188_1015671	Not Available	719	Open in IMG/M
3300015275\|Ga0182172_1060534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	540	Open in IMG/M
3300015276\|Ga0182170_1061358	Not Available	540	Open in IMG/M
3300015279\|Ga0182174_1043637	Not Available	615	Open in IMG/M
3300015279\|Ga0182174_1063633	Not Available	551	Open in IMG/M
3300015281\|Ga0182160_1043348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	610	Open in IMG/M
3300015281\|Ga0182160_1069822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	531	Open in IMG/M
3300015282\|Ga0182124_1025595	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	699	Open in IMG/M
3300015282\|Ga0182124_1033506	Not Available	650	Open in IMG/M
3300015282\|Ga0182124_1070985	Not Available	526	Open in IMG/M
3300015283\|Ga0182156_1041817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	626	Open in IMG/M
3300015283\|Ga0182156_1049707	Not Available	596	Open in IMG/M
3300015283\|Ga0182156_1051555	Not Available	590	Open in IMG/M
3300015285\|Ga0182186_1026745	Not Available	698	Open in IMG/M
3300015286\|Ga0182176_1029697	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	701	Open in IMG/M
3300015286\|Ga0182176_1040710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	636	Open in IMG/M
3300015287\|Ga0182171_1050669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	594	Open in IMG/M
3300015287\|Ga0182171_1082923	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	513	Open in IMG/M
3300015288\|Ga0182173_1024400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	720	Open in IMG/M
3300015289\|Ga0182138_1052381	Not Available	589	Open in IMG/M
3300015291\|Ga0182125_1086709	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	516	Open in IMG/M
3300015292\|Ga0182141_1051802	Not Available	601	Open in IMG/M
3300015292\|Ga0182141_1060402	Not Available	575	Open in IMG/M
3300015294\|Ga0182126_1009879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	959	Open in IMG/M
3300015294\|Ga0182126_1085231	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	521	Open in IMG/M
3300015295\|Ga0182175_1017662	Not Available	826	Open in IMG/M
3300015296\|Ga0182157_1093469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	519	Open in IMG/M
3300015298\|Ga0182106_1025913	Not Available	756	Open in IMG/M
3300015298\|Ga0182106_1064668	Not Available	581	Open in IMG/M
3300015298\|Ga0182106_1081447	Not Available	541	Open in IMG/M
3300015299\|Ga0182107_1038761	Not Available	678	Open in IMG/M
3300015300\|Ga0182108_1022501	Not Available	797	Open in IMG/M
3300015300\|Ga0182108_1091400	Not Available	528	Open in IMG/M
3300015303\|Ga0182123_1030758	Not Available	702	Open in IMG/M
3300015303\|Ga0182123_1032222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	693	Open in IMG/M
3300015304\|Ga0182112_1026589	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	755	Open in IMG/M
3300015304\|Ga0182112_1030647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	725	Open in IMG/M
3300015304\|Ga0182112_1104741	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	504	Open in IMG/M
3300015305\|Ga0182158_1022157	Not Available	789	Open in IMG/M
3300015305\|Ga0182158_1033570	Not Available	703	Open in IMG/M
3300015305\|Ga0182158_1046672	Not Available	641	Open in IMG/M
3300015305\|Ga0182158_1058248	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	601	Open in IMG/M
3300015307\|Ga0182144_1051092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	632	Open in IMG/M
3300015307\|Ga0182144_1062612	Not Available	596	Open in IMG/M
3300015307\|Ga0182144_1104816	Not Available	508	Open in IMG/M
3300015314\|Ga0182140_1027698	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	770	Open in IMG/M
3300015314\|Ga0182140_1028248	Not Available	766	Open in IMG/M
3300015314\|Ga0182140_1046645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	664	Open in IMG/M
3300015322\|Ga0182110_1079147	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	581	Open in IMG/M
3300015322\|Ga0182110_1079615	Not Available	580	Open in IMG/M
3300015322\|Ga0182110_1118771	Not Available	510	Open in IMG/M
3300015323\|Ga0182129_1114676	Not Available	504	Open in IMG/M
3300015341\|Ga0182187_1051842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	807	Open in IMG/M
3300015341\|Ga0182187_1096152	Not Available	654	Open in IMG/M
3300015341\|Ga0182187_1122624	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	601	Open in IMG/M
3300015342\|Ga0182109_1173508	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	554	Open in IMG/M
3300015343\|Ga0182155_1047297	Not Available	873	Open in IMG/M
3300015343\|Ga0182155_1153574	Not Available	580	Open in IMG/M
3300015344\|Ga0182189_1125703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	631	Open in IMG/M
3300015345\|Ga0182111_1107966	Not Available	688	Open in IMG/M
3300015345\|Ga0182111_1177122	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	570	Open in IMG/M
3300015345\|Ga0182111_1195544	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	549	Open in IMG/M
3300015345\|Ga0182111_1206218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	538	Open in IMG/M
3300015345\|Ga0182111_1232797	Not Available	512	Open in IMG/M
3300015346\|Ga0182139_1097544	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	715	Open in IMG/M
3300015346\|Ga0182139_1141573	Not Available	623	Open in IMG/M
3300015346\|Ga0182139_1172546	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	577	Open in IMG/M
3300015346\|Ga0182139_1178934	Not Available	569	Open in IMG/M
3300015346\|Ga0182139_1190723	Not Available	555	Open in IMG/M
3300015346\|Ga0182139_1209521	Not Available	535	Open in IMG/M
3300015347\|Ga0182177_1117526	Not Available	670	Open in IMG/M
3300015351\|Ga0182161_1119566	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	692	Open in IMG/M
3300015351\|Ga0182161_1131966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	666	Open in IMG/M
3300015351\|Ga0182161_1212776	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	551	Open in IMG/M
3300015355\|Ga0182159_1156046	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	714	Open in IMG/M
3300015355\|Ga0182159_1247594	Not Available	586	Open in IMG/M
3300015355\|Ga0182159_1338616	Not Available	510	Open in IMG/M
3300015361\|Ga0182145_1043824	Not Available	823	Open in IMG/M
3300015361\|Ga0182145_1089224	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	653	Open in IMG/M
3300015361\|Ga0182145_1188726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	507	Open in IMG/M
3300017404\|Ga0182203_1145589	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	523	Open in IMG/M
3300017404\|Ga0182203_1151835	Not Available	515	Open in IMG/M
3300017407\|Ga0182220_1058902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	598	Open in IMG/M
3300017407\|Ga0182220_1090218	Not Available	530	Open in IMG/M
3300017409\|Ga0182204_1064396	Not Available	608	Open in IMG/M
3300017409\|Ga0182204_1118093	Not Available	504	Open in IMG/M
3300017410\|Ga0182207_1039856	Not Available	819	Open in IMG/M
3300017410\|Ga0182207_1102808	Not Available	605	Open in IMG/M
3300017410\|Ga0182207_1168020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	511	Open in IMG/M
3300017410\|Ga0182207_1169563	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	509	Open in IMG/M
3300017411\|Ga0182208_1037305	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	735	Open in IMG/M
3300017411\|Ga0182208_1090158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	564	Open in IMG/M
3300017411\|Ga0182208_1125047	Not Available	508	Open in IMG/M
3300017413\|Ga0182222_1072637	Not Available	558	Open in IMG/M
3300017413\|Ga0182222_1099389	Not Available	514	Open in IMG/M
3300017415\|Ga0182202_1060790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	656	Open in IMG/M
3300017424\|Ga0182219_1057786	Not Available	662	Open in IMG/M
3300017424\|Ga0182219_1068163	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	629	Open in IMG/M
3300017424\|Ga0182219_1113113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	538	Open in IMG/M
3300017424\|Ga0182219_1130677	Not Available	514	Open in IMG/M
3300017425\|Ga0182224_1050450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	732	Open in IMG/M
3300017425\|Ga0182224_1057286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	704	Open in IMG/M
3300017425\|Ga0182224_1076791	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata	643	Open in IMG/M
3300017425\|Ga0182224_1090306	Not Available	612	Open in IMG/M
3300017425\|Ga0182224_1124991	Not Available	552	Open in IMG/M
3300017425\|Ga0182224_1158376	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	509	Open in IMG/M
3300017425\|Ga0182224_1161900	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	506	Open in IMG/M
3300017427\|Ga0182190_1036176	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	839	Open in IMG/M
3300017427\|Ga0182190_1083415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	636	Open in IMG/M
3300017427\|Ga0182190_1096061	Not Available	606	Open in IMG/M
3300017427\|Ga0182190_1144154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	527	Open in IMG/M
3300017433\|Ga0182206_1083431	Not Available	619	Open in IMG/M
3300017433\|Ga0182206_1115698	Not Available	558	Open in IMG/M
3300017436\|Ga0182209_1083370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	638	Open in IMG/M
3300017436\|Ga0182209_1132038	Not Available	550	Open in IMG/M
3300017436\|Ga0182209_1161629	Not Available	514	Open in IMG/M
3300017438\|Ga0182191_1041764	Not Available	819	Open in IMG/M
3300017438\|Ga0182191_1052372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	762	Open in IMG/M
3300017438\|Ga0182191_1068721	Not Available	697	Open in IMG/M
3300017438\|Ga0182191_1138297	Not Available	553	Open in IMG/M
3300017438\|Ga0182191_1156242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	531	Open in IMG/M
3300017438\|Ga0182191_1160434	Not Available	526	Open in IMG/M
3300017442\|Ga0182221_1130174	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	548	Open in IMG/M
3300017442\|Ga0182221_1167577	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	505	Open in IMG/M
3300017443\|Ga0182193_1082435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	678	Open in IMG/M
3300017443\|Ga0182193_1149636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	554	Open in IMG/M
3300017683\|Ga0182218_1062467	Not Available	663	Open in IMG/M
3300017683\|Ga0182218_1105528	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	566	Open in IMG/M
3300017684\|Ga0182225_1101848	Not Available	561	Open in IMG/M
3300017685\|Ga0182227_1050728	Not Available	738	Open in IMG/M
3300017685\|Ga0182227_1056888	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	703	Open in IMG/M
3300017685\|Ga0182227_1114682	Not Available	536	Open in IMG/M
3300017685\|Ga0182227_1130258	Not Available	511	Open in IMG/M
3300017686\|Ga0182205_1131091	Not Available	551	Open in IMG/M
3300017689\|Ga0182231_1089217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	591	Open in IMG/M
3300017690\|Ga0182223_1017264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	859	Open in IMG/M
3300017690\|Ga0182223_1041146	Not Available	682	Open in IMG/M
3300025899\|Ga0207642_11106839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	512	Open in IMG/M
3300025942\|Ga0207689_11669708	Not Available	529	Open in IMG/M
3300026089\|Ga0207648_12239454	Not Available	507	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.51%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.21%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.28%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.51%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.28%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.28%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.28%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1020177772	3300005334	Miscanthus Rhizosphere	GKQPQQGLPDHFNKLMDSPCPNHAYPIKHLYKDCELLKRFL*
Ga0068869_1020194931	3300005334	Miscanthus Rhizosphere	GKQPQQGLPDHFNKLMDSPCTNHAYPVKHLYKDYELLKHFLQ*
Ga0157374_129175741	3300013296	Miscanthus Rhizosphere	LVATADHTGKHPQQDLPGHFNELMESLCTNHAYSVKHLYKVYELLKRLLR*
Ga0157378_114275112	3300013297	Miscanthus Rhizosphere	MAKQPQQDLSCHFNELMESLCTNHVYPVKHLYKDCELLKHLLR*
Ga0182154_10231032	3300015268	Miscanthus Phyllosphere	MANSALVAAADHASKQLQQGLPDHFDKLMESPYTNHAYPVKHLYKDCELLKR
Ga0182154_10280081	3300015268	Miscanthus Phyllosphere	HRPTNSALIPTADHTGKQPQQDPPGHFHELMESPCTNHGYPIKHLYKDCELLKRLLR*
Ga0182188_10150822	3300015274	Miscanthus Phyllosphere	MMVAVADRMGKQPQQGLPDHFNKLMGSPCTNHAYPVKHLYKDCELLKRFLR*
Ga0182188_10156712	3300015274	Miscanthus Phyllosphere	VVVADRIGKQPQQGLPDHFNKLMDSLCTNHAYPVKHLYKDYELLKRFLR*
Ga0182172_10605341	3300015275	Miscanthus Phyllosphere	LASSALVATADHTGKQPQQDPPGHFHELMESPCTNHDYPAKHLYKNCELLKRLLR*
Ga0182170_10613581	3300015276	Miscanthus Phyllosphere	ALPDHFDELMETPCTNHAYPVKHLYKDCELLKRFLR*
Ga0182174_10436372	3300015279	Miscanthus Phyllosphere	MGKQPQQGLPNHFNKLMDSLCTNHTYPVKHLYKDYELLKRFL*
Ga0182174_10636331	3300015279	Miscanthus Phyllosphere	QGLPDHFNKLMDGPCPNHAYPIKHLYKECKLLKRFL*
Ga0182160_10433481	3300015281	Miscanthus Phyllosphere	NDRCRPTNPALVAAADRMGKQPQQGLPDHFNELMESPCTNHAYPVKHLYKDYELLKRLLR
Ga0182160_10698222	3300015281	Miscanthus Phyllosphere	MVAVADRTGKQPQQGLPDHFNKLMDSPCTNHAYPIKHLYKDYKLLKRFL*
Ga0182124_10255953	3300015282	Miscanthus Phyllosphere	MGKQPQQGLPNHYNKLMDSPCTNHAYPIKHLYKDYELLKCFL*
Ga0182124_10335061	3300015282	Miscanthus Phyllosphere	VTTADHMGKQPQQDLPGHFHELMESLCTNHAYPVKHLYKDCQLLKRLLR*
Ga0182124_10709851	3300015282	Miscanthus Phyllosphere	GLPDHFNKLMDSPCTNHAYSVKHLYKDYELLKRFL*
Ga0182156_10418171	3300015283	Miscanthus Phyllosphere	MVATADRMGKQPQQGLPDHFNKLMDSLCTNHAYPVRQLYKDC
Ga0182156_10497072	3300015283	Miscanthus Phyllosphere	VLVAAADRVGKQPQQGLPNHFNKLMDSSCTNHAYPIKHLYKDCELLKRFLR*
Ga0182156_10515551	3300015283	Miscanthus Phyllosphere	MADHTGKQPQQDPQGHFHELMESSCTNHVYPIKHLYKDCELLKRLL
Ga0182156_10754971	3300015283	Miscanthus Phyllosphere	QPQQDPSGHFHELIESPCTNHDYPVKHLYKDCQLLKRLLR*
Ga0182186_10267451	3300015285	Miscanthus Phyllosphere	TMLVGSADRVGKQPQQGLPDHFNKLMDSPCTNHAYPVKHLYKDCELLKCFLR*
Ga0182176_10296972	3300015286	Miscanthus Phyllosphere	VADHTGKKPQQGPLDHFNKLMESPCTNHAYPIKHLYKDCELLKRLL*
Ga0182176_10407101	3300015286	Miscanthus Phyllosphere	MAGHMHKQPQQDPTGHYHELMDSPCTNHGYPIKHLYKDCELLKRLLR*
Ga0182171_10506692	3300015287	Miscanthus Phyllosphere	LVAVADRVGKQPLQGLPNHFEKLMDSPCSNHAYPIKHLYKDCELLKRFL*
Ga0182171_10829231	3300015287	Miscanthus Phyllosphere	QPQQGLPNHFNKLMDNPCTNHAYPTKHLYKDCKLLKCFQR*
Ga0182173_10244001	3300015288	Miscanthus Phyllosphere	LVAVANHVGKQPQHGQPNHFNKLMESPCTNHAYPIKYLYKDCELLKRFLQ*
Ga0182138_10409331	3300015289	Miscanthus Phyllosphere	ATADHTGMQPQQDPPGHFHELMESPCTNHDYPIKHLYKDCQLIKRLLRQAGRPKEKKAKK
Ga0182138_10523811	3300015289	Miscanthus Phyllosphere	ADRTPRQPQQGLPDHFNKLMDGPCPNHTYPVKHLYKECELLKCFLR*
Ga0182125_10867092	3300015291	Miscanthus Phyllosphere	LVVVTDRASKQPQQGQPDHFDKLMESPCTNHAYPIKHLYKDYELLKCFL*
Ga0182141_10518021	3300015292	Miscanthus Phyllosphere	LVAVADHAGKQPQQGQPDHFDKLMESPCTNHTYPIKYLYKNCELLKRLL*
Ga0182141_10604021	3300015292	Miscanthus Phyllosphere	VAAIDRTGKQPQQGLPNHFNKLMDSPCTNHAYLVKHLYRDYELLKCFL*
Ga0182126_10098791	3300015294	Miscanthus Phyllosphere	LVATVDHTSKQPKQDLPGHFHELMESPCTNHTYPVKHLYKDCELLKRLLR*
Ga0182126_10852311	3300015294	Miscanthus Phyllosphere	VKQPQQGLPNHFNKLMDIPCTDHAYPVKHLYKDCELLKRFL*
Ga0182175_10176621	3300015295	Miscanthus Phyllosphere	MGKQPQQGLPDHFNELMESLYTNHAYLVKHLYKDCELLKRLLR*
Ga0182157_10934692	3300015296	Miscanthus Phyllosphere	DNTTMVAVADHTGKQPQQGLPDHFNKLMGSPCTNHAYPVKHLYKDCELLKRFLR*
Ga0182106_10259131	3300015298	Miscanthus Phyllosphere	PQQGLPDHFDKLMDSKCTNHAYPIKHLYKDSELLKRFL*
Ga0182106_10646681	3300015298	Miscanthus Phyllosphere	KQPQQDLLGHFNELMESPCTNHAYPIKHLYKDYELLKRLLR*
Ga0182106_10814471	3300015298	Miscanthus Phyllosphere	QPQQGLPDHFNELMDSPCTNHTYPVKHLYKDCELLKRLL*
Ga0182107_10387612	3300015299	Miscanthus Phyllosphere	LDSSALVAMADRTTKQPQQGLPDHFNKLMDGPCTDHDYPVKHLYKDCQLLKRLLR*
Ga0182108_10225011	3300015300	Miscanthus Phyllosphere	AATDRMGKQPQQGLPDHFNKLMDSTSTNHAYPIKYLYKDYELLKHFLP*
Ga0182108_10914001	3300015300	Miscanthus Phyllosphere	KDRRRPANSALVTVADRAGKQAQQGQPDHFNKLMESPCTNHAYPIKHLYKDCELLKRFLR
Ga0182123_10307581	3300015303	Miscanthus Phyllosphere	RRPTNFALVATANHTSKQPQQDLPGHFHELMESPCTNHDYPVKHLYKDC*
Ga0182123_10322222	3300015303	Miscanthus Phyllosphere	MADHTGKQPQQDLLGHFNELMESPCTNHTYPVKHLYKDCELLKRFLR*
Ga0182112_10265892	3300015304	Miscanthus Phyllosphere	MNKQPQQGLPEHFNELMESPCTNHAYPIKHLYKDRELLKRLLR*
Ga0182112_10306471	3300015304	Miscanthus Phyllosphere	MGKQPQQDLLGHFHKLMESPCTNHAYPIKHLYKDCELLKHLLR*
Ga0182112_11047411	3300015304	Miscanthus Phyllosphere	LVATADHTGKQPQQGLLDHFNELMESPCTNHAYPVKHLYKDCELLKCFL*
Ga0182158_10221572	3300015305	Miscanthus Phyllosphere	LVATADHTGKQPQQGLPDHFNELMESPCINHAHPVKYLYKDYELLKRLL*
Ga0182158_10335701	3300015305	Miscanthus Phyllosphere	PQQGQSDHFDKLMDSPCTNNAYPIKHLYMECELLKRFL*
Ga0182158_10466721	3300015305	Miscanthus Phyllosphere	MLVAVADRMGKQPQQGLPNHFNKLMDSPCTNHAYLIKHLYKDCELLKCFLR*
Ga0182158_10582481	3300015305	Miscanthus Phyllosphere	RMSKQPQQGLPDHFNKLMDSPCTNHAYLVTHLYKDSELLKCFLR*
Ga0182144_10510922	3300015307	Miscanthus Phyllosphere	AATDRTGKQPQQGLPNHFNKLMDSPCTNHAYPVKHLYKDCELLKRFLQ*
Ga0182144_10626123	3300015307	Miscanthus Phyllosphere	GLPSHINKLMDSPCTNHAYPIKHLFKDCELLKRFLR*
Ga0182144_11048162	3300015307	Miscanthus Phyllosphere	MVVAANRTGKQPQQGLPDHFNKLMDSPCTNHAYRVKHLYKDSEVLKRFLR*
Ga0182142_10949541	3300015308	Miscanthus Phyllosphere	KDWRRPNNTTLVAATDLMGKQPQQGLPDHFNKLMDSPCTNHAYPIKYLYKDCELLKHFLR
Ga0182140_10276981	3300015314	Miscanthus Phyllosphere	MADRTSKQPQQGLPNHFDKLMESPCTNHAYHVKHLYKDCKLLKRFLR*
Ga0182140_10282482	3300015314	Miscanthus Phyllosphere	LVAAANSAGKQPQQGQPDHFDKLMESPFTNHAYPIKHLYKDCELLKRFLR*
Ga0182140_10466451	3300015314	Miscanthus Phyllosphere	NSALVATADHTGKQPQQDLPGHFNELMESPCTNHAHPVKHLYRDCELLKRLLR*
Ga0182110_10791472	3300015322	Miscanthus Phyllosphere	LIAVADHASKQPQQSQPDHFDKLMESPCTNHVYPIKHLYKDYKLLKLFS*
Ga0182110_10796151	3300015322	Miscanthus Phyllosphere	ALVAMADHMGKQPQQDPLGHFHELMDSPCTNHAYPVKHLYKDCKLLKRFLR*
Ga0182110_11187711	3300015322	Miscanthus Phyllosphere	LVVTADHTSKQPQQDLLGHFNELMESLCTNDIYPIKHLYMDYELLKRFLRQ
Ga0182129_11146762	3300015323	Miscanthus Phyllosphere	KQPQQGLPDHFNELMQSPCTNNAYPIKHLYKDYELLKRLLR*
Ga0182187_10518422	3300015341	Miscanthus Phyllosphere	LVTAVDRVVKQPQQGQPDHFDRLMESPCTNHAYPIKHLYKDCELLKRFL*
Ga0182187_10961521	3300015341	Miscanthus Phyllosphere	MGKQPQQDLPSHFHELLESPCTNHAYLVKHLYKDCELLKRLLR*
Ga0182187_11226242	3300015341	Miscanthus Phyllosphere	LIAVADRVGKQPQQGQPDHIDKLMDSPYTNHAYPIKHLYKDCELLKRFLRHVGK*
Ga0182109_11735081	3300015342	Miscanthus Phyllosphere	MVAAADRIGKQPQSGLPDHFNKLMDSSCTNHAYPIKHLYKDCELLKHFL*
Ga0182155_10472972	3300015343	Miscanthus Phyllosphere	FTLVAVAEHMGKQPQQDLLGHFNELMESPCTNHSYPVKHLYENYELLKRLLR*
Ga0182155_11535741	3300015343	Miscanthus Phyllosphere	VLVATTNLTGKQPQQGLPDHFNKLMESPCTNHAYPIKLLYKDCELLKRLLR*
Ga0182189_11257031	3300015344	Miscanthus Phyllosphere	MADHTGKQPQQDPLGHFHELMESPCTNHAYPVKHLYKDYELLKRLLR*
Ga0182111_11079661	3300015345	Miscanthus Phyllosphere	LVTVTDRVGKQLQQGMPDHFNKLMDSSCTNHVYPIKHLYKDCELLKHFLR*
Ga0182111_11771222	3300015345	Miscanthus Phyllosphere	VLVAATDRTGKQPQQGLPDHFNKLMDSPCTNHAYPIKHLYKDCELLKCFLR*
Ga0182111_11955441	3300015345	Miscanthus Phyllosphere	MDNHMGKQPQQDLLGHFNELMESPCTNHAYPVKHLYKDCELLKRL
Ga0182111_12062182	3300015345	Miscanthus Phyllosphere	LVAAADHTGKQPQQGFLDHFNELMESPCTNHAYPIKYLYKDYELLKRFLR*
Ga0182111_12327971	3300015345	Miscanthus Phyllosphere	GKQPQPSLLDHFNKLMDSLCTNHAYPVKYLYKDYELLKCFL*
Ga0182139_10975441	3300015346	Miscanthus Phyllosphere	DLPDHFNKLMESPCTNHAYPVKHLYKDCELLKRLLR*
Ga0182139_11415732	3300015346	Miscanthus Phyllosphere	SQGLPDHFNKLMDSSCTNHAYPIKHLYKDCELLKRFLR*
Ga0182139_11477161	3300015346	Miscanthus Phyllosphere	LVATADHTGKQPQQDLLGHFHELMESPCTNHAYPFKYLYKDC
Ga0182139_11725461	3300015346	Miscanthus Phyllosphere	DRKGKQPQQGMPDHFNKLMDSPCTNHAYPVKHLYKDRELLKCFL*
Ga0182139_11789342	3300015346	Miscanthus Phyllosphere	ADQVGKQPSQDLLDHFNKLMDSPCNTHVYPVKHLYKDCELLKRFLR*
Ga0182139_11907231	3300015346	Miscanthus Phyllosphere	RISANCMGKQPQQGLPDHFNKLMDSPCTNHAYPIKHLYKDYELLKRFLQ*
Ga0182139_12095212	3300015346	Miscanthus Phyllosphere	LVAVADHMGKQPQQGLPDNFDELMESQSTNHAYPVKHLYKDCELLKRFLR*
Ga0182177_11175262	3300015347	Miscanthus Phyllosphere	TDRMGKQPQQGLPDHFHKLMDSLCTNHANLVKHLYKDYELLKRFL*
Ga0182161_11195661	3300015351	Miscanthus Phyllosphere	MANSVLVAATDRMSKQPQQGLPDHYNELMESPCTNHAYPVKHLYKDYELLKRFLR*
Ga0182161_11319661	3300015351	Miscanthus Phyllosphere	MADHTGKQPQQDPLGHFHKHMESLCTNHAYPIKHLYKDCELLKRLL*
Ga0182161_12127761	3300015351	Miscanthus Phyllosphere	MADHTGKQPQQDLLGHFNELMESLCTNHAYPVKHLYKDCELLKRLLR*
Ga0182159_11560461	3300015355	Miscanthus Phyllosphere	TKHPQQDLLGHFHRLMEIPCTNHAYPVKHLYKDCELLKRLLR*
Ga0182159_12475941	3300015355	Miscanthus Phyllosphere	MPDHFDKLMESPSTNHAYPIKHIYKDYELLKHFL*
Ga0182159_13386161	3300015355	Miscanthus Phyllosphere	LVATADHTGKRPQQGLLDHFNDLMENLCTNHAYPVKHLYKECELLKRLL*
Ga0182145_10438242	3300015361	Miscanthus Phyllosphere	MADRVGKQPQQGQPDHFDKLMESPCTNHAYPIKHLYKDYEHLKRFLR*
Ga0182145_10892242	3300015361	Miscanthus Phyllosphere	LVAAADRAGKQPQQGQPDHFNKLMESPCTNHTYLVKHLYKDYELLKRFL*
Ga0182145_11887262	3300015361	Miscanthus Phyllosphere	LLPAGNFALVATADHTGKQPQQGLPKHFNELMESPCTNHAYPVKHLYKDCELLK
Ga0182203_11455891	3300017404	Miscanthus Phyllosphere	MVAMADCMGKLPQQGLPNHFNKLMDGPCTNHAYPVKHLYKECELLKCFLR
Ga0182203_11518351	3300017404	Miscanthus Phyllosphere	DNTALVAVPDRTGKQPQQGLPDHFNKLVDSSCINHAYPVKHLYKDYELLEHFL
Ga0182220_10589021	3300017407	Miscanthus Phyllosphere	GLPNHFNKLMDGLSPNHAYTVKHLYKECELLKCFLR
Ga0182220_10902181	3300017407	Miscanthus Phyllosphere	PRQPQQGLPDHFNKLMDGPCPNHAYPVKHLYKECELLKCFLR
Ga0182204_10643962	3300017409	Miscanthus Phyllosphere	LVTVADRTGKWPQQGLPNHFNKLMDSPCTNHTYPMKHLYKDCELLKRFL
Ga0182204_11180931	3300017409	Miscanthus Phyllosphere	TGKQPQQGLPDHFNKLMDSPCTNHTYPIKNLYKGCELLKHFLR
Ga0182207_10398561	3300017410	Miscanthus Phyllosphere	MANHAGTQPQQDPPGHFHELMDSPCTNHAYPVKHLYKDYKLLKCFL
Ga0182207_11028081	3300017410	Miscanthus Phyllosphere	RLANSTLVTAADHAGKQPQQGLPNHFDKLMESPCTNHAYPIKNLYKDCGLLKRFL
Ga0182207_11680201	3300017410	Miscanthus Phyllosphere	MANLAGTQPQQDPLGHFYELMQSPCTNHDYPVKHLYKDCELLKRLL
Ga0182207_11695631	3300017410	Miscanthus Phyllosphere	RRRPANSALVTVDDRAGKQPQQGQPNHFDKLMESPCTNHTYPVKHLYKDYELLKCFL
Ga0182208_10373052	3300017411	Miscanthus Phyllosphere	MADHTGKQPQQDLLSHFHELMESLCTNHAYPIKHLDKDCELLKHLLR
Ga0182208_10901582	3300017411	Miscanthus Phyllosphere	MVAMAGRTGKQPQQGLPDHFNKLMDNPCTNHAYPVKHLYKDYELLKHFL
Ga0182208_11250471	3300017411	Miscanthus Phyllosphere	NHMGKQPQQGLPNHFNKPLDSPCTNHAYPIKHLYKDCELLMRLL
Ga0182222_10726371	3300017413	Miscanthus Phyllosphere	TLVTATDRTGKQPQQGLPNHFNKLMDSPCTNHAYPIKHLYKDSKLLKCFL
Ga0182222_10993891	3300017413	Miscanthus Phyllosphere	PRQPQQGLPDHFNKLMDGLCPNHAYPIKHLYKECELLKRFLR
Ga0182202_10607902	3300017415	Miscanthus Phyllosphere	QQGLPDHFNKLMDDPCTNHAYPVKHKECELLKHFLR
Ga0182219_10577861	3300017424	Miscanthus Phyllosphere	SDNTTMVAAPDRTAKQPQQGMPDHFNKLMDSPCTNHAYSVKHLYKDYELLKHFLR
Ga0182219_10681631	3300017424	Miscanthus Phyllosphere	SANSALVATADHTGKQPLQGLPDHFNKLMESPCTNHAYPVKHLNKDCKLLKRFL
Ga0182219_11131131	3300017424	Miscanthus Phyllosphere	MADHTGKQPQQDLPGHFHELMESLCTNHAYPIKHLYKDCELLKCLLRQADGPK
Ga0182219_11306771	3300017424	Miscanthus Phyllosphere	MVAVADRTGKQPQQGLPDHFNKLMDSPCTNHDYSVKHLYKDCELLKRFL
Ga0182224_10504502	3300017425	Miscanthus Phyllosphere	MANFALVAAADHMGKEPQQGLPDHFNELMDSPCTNHAYPIKHLYKDCELLKHFLQ
Ga0182224_10572861	3300017425	Miscanthus Phyllosphere	AATDRTGKQPQQGLPDHFNKLMDSPCTNHAYPVKHLYKDCELLKCFL
Ga0182224_10767913	3300017425	Miscanthus Phyllosphere	MGKQPQQDLPDHFNKLMDSLCTNHAYPIKHLYKDYELLKRFLR
Ga0182224_10890471	3300017425	Miscanthus Phyllosphere	LPDHFNKLKDSPCTNHAYPIKHLYKDYELLKSFLR
Ga0182224_10903061	3300017425	Miscanthus Phyllosphere	MADHTGKQPQQDLLGHLNELMESPCTNHAYPVKYLYKECELLKRYL
Ga0182224_11249911	3300017425	Miscanthus Phyllosphere	ALVATADHTGKQPQQDLPGHFNELMEIPCTNHADPIKHLYNDYELRKRLLR
Ga0182224_11583761	3300017425	Miscanthus Phyllosphere	MGKQPQQDPPGHFHELMESPCTNHTYPIKHLYKDCKLLKRLLR
Ga0182224_11619002	3300017425	Miscanthus Phyllosphere	MANSVLVAAADRVGMQPQQGRPNHFNKLMDSPCTNHAFPVKHLYKDYELLKRFL
Ga0182190_10361762	3300017427	Miscanthus Phyllosphere	MPKQPQQGLPDHFNKLMDGPCPNHAYPVKHLYKECELLKRFLRQPREEAW
Ga0182190_10834151	3300017427	Miscanthus Phyllosphere	LVATADHMGKQPQQDLLGHFNELMESPCTNHAYPIKHLYKDYELLKRLLR
Ga0182190_10960611	3300017427	Miscanthus Phyllosphere	MGKQPQQGLPNHFNKLMDSSCTNHAYPIKHLYKDYELLKRLLR
Ga0182190_11441542	3300017427	Miscanthus Phyllosphere	VLVAVADHTGKQPQQGLPDHFNELTESPCTNHAYPVKHLYKDCELLKRLLR
Ga0182206_10834312	3300017433	Miscanthus Phyllosphere	HSLPDHFNKLMDSPCTNHAYPVKHLYKDCELLKRFLR
Ga0182206_11156981	3300017433	Miscanthus Phyllosphere	MADHTSKQPQQDLLGHFNELMESPCTNHAYPIKDLYKDCELLKKLLR
Ga0182206_11169461	3300017433	Miscanthus Phyllosphere	QGQPDHFDKLMESPCTNHTYPIKHLYKDCELFKRFL
Ga0182209_10833701	3300017436	Miscanthus Phyllosphere	MMVAVADRTDKQPQQGLPDHFNKLMDSPCTNHTYPVKHLYKECEVLKRFL
Ga0182209_11320381	3300017436	Miscanthus Phyllosphere	ALVAVANRTGKQPQQGLPDHFNKLMDSPCTDHAYPVKHLYKDCELLKSFL
Ga0182209_11616291	3300017436	Miscanthus Phyllosphere	VTAADRVGKQPQQGLPDHFNKLMDSPCTNHAYPIKHLYKDC
Ga0182191_10417641	3300017438	Miscanthus Phyllosphere	LVTTANHAGTQPQQDPPGHFHELMESPCTNHTYPIKHLYKDYELLKRLLL
Ga0182191_10523723	3300017438	Miscanthus Phyllosphere	GLPDHFNKLMDGPCPNHAYPVKHLYKECELLKRFLR
Ga0182191_10687211	3300017438	Miscanthus Phyllosphere	TGKQPQQGLPDHFDKLKESPCTNHAYPIKHLYKDCELLKRFL
Ga0182191_11382971	3300017438	Miscanthus Phyllosphere	ADHMGKQPQQDPPGHFHELMESPCTNHNYPVKHLYKDYELLKRLLR
Ga0182191_11562421	3300017438	Miscanthus Phyllosphere	MGKQTQQDPLAYFHELMESPCTNHAYPIKHLYKDYELLK
Ga0182191_11604342	3300017438	Miscanthus Phyllosphere	LDNTALVAIADCRGKQPQQGLPDHFNKLMDSSCTNHVYPVKHLYKDYELLKHFL
Ga0182221_11301741	3300017442	Miscanthus Phyllosphere	MADHVGKQPQQSLSDHFNELMESPCTNHAYPVKHLDKDCELLKHL
Ga0182221_11675772	3300017442	Miscanthus Phyllosphere	MMVAAADRTGKQPQQGLPNHFNKLMDSPCTNHTYTVKHLYKDCELLKRFLR
Ga0182193_10824353	3300017443	Miscanthus Phyllosphere	ADRTGKQPQQGLPDHFNKLMDTPCTNHAYPVKHLYKDCELLKHFLR
Ga0182193_11496361	3300017443	Miscanthus Phyllosphere	VTTADHMGKQPQQDPPGHFHELMESPCTNHNYPVKHLYKDCELLKCLL
Ga0182218_10624672	3300017683	Miscanthus Phyllosphere	VSVATADHADKHPQQDLSGHFHKLMESPCTNHTYPVKHLYKDYELLKRLLRQAAGP
Ga0182218_11055281	3300017683	Miscanthus Phyllosphere	VAADHTAKQPQQGLPDHFNKLMDGPCTNHAYPVKHLYKECELLKRFLR
Ga0182225_11008371	3300017684	Miscanthus Phyllosphere	IDNSTLVTAADRAGKQPQKSLPDHFDKLMYCPCTNNAYPIKHLYKDYELLKRFMR
Ga0182225_11017081	3300017684	Miscanthus Phyllosphere	KKDRRRTANSTLVTAADRAGKQAQQGLPDHFDKLMDSPCTNHAYPIKHLYKDYELLKHFL
Ga0182225_11018482	3300017684	Miscanthus Phyllosphere	ADCVGKQPQQGLPNHFDKVMDSPYTNNAYPIKHLYKDCELL
Ga0182227_10507281	3300017685	Miscanthus Phyllosphere	MGKQPQQGLPDHFNKLMDSPCTNHAYPIKHLYKDCELLKCFL
Ga0182227_10568882	3300017685	Miscanthus Phyllosphere	QPQQGLPDHFNKLMDGLCPNHAYPVKHLYWECELLKCFL
Ga0182227_11146822	3300017685	Miscanthus Phyllosphere	LVAAADRAGKKPQQGLPDHIDKLMESLCINHAYPIKHLYKDYKLFKHFL
Ga0182227_11302582	3300017685	Miscanthus Phyllosphere	VATNSASVATADHTDKHPQQDLPGHFHELMESSCTNHAYSVKHLYKDCELLERFLR
Ga0182205_11310912	3300017686	Miscanthus Phyllosphere	MADHTGKQPQQSLLDHFNKLMESPCTNHAYLVKHLYKDCELLKCFL
Ga0182231_10892171	3300017689	Miscanthus Phyllosphere	MVATADHTGKQPQQDLPGHFNELMESPCTNHAYPVKHLYKDCELLKRLL
Ga0182223_10172641	3300017690	Miscanthus Phyllosphere	MLVAAADRVAKQPQQGLPDHFNKLMDSPCTNHAYPVKHLYKDYELLKRFLR
Ga0182223_10411462	3300017690	Miscanthus Phyllosphere	AGKQPQQGQPDHFDKLMESPFTNHAYPIKHLYKDCELLKSFLR
Ga0182223_10632051	3300017690	Miscanthus Phyllosphere	NKKDRHRPDNTALVATTDRKGKQPQQGMPDHFNKLMDSPCTNHAYPVKHLYKDYELLKCFLR
Ga0207642_111068391	3300025899	Miscanthus Rhizosphere	ADRMGKQPQQGQPDHFNKLIESPCTNHAYPIKHLYKDCELLKRFLR
Ga0207689_116697082	3300025942	Miscanthus Rhizosphere	SALVTATDHTGKQPQQGLPNHFNELMESPCTNHAYPIKHLYKDCELLKRFLR
Ga0207648_122394542	3300026089	Miscanthus Rhizosphere	MMVAAADRMGKQPQQGLPDHFNKLMDSLCTNHAYLIKHLYKNCELLKRLLR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.29
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.29
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F043164

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign