| Basic Information | |
|---|---|
| Family ID | F043158 |
| Family Type | Metagenome |
| Number of Sequences | 157 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MEASDGESTALPAFAAVGILTLFVLLSISGYLILSAR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.96 % |
| % of genes near scaffold ends (potentially truncated) | 5.73 % |
| % of genes from short scaffolds (< 2000 bps) | 66.24 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.994 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.025 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.688 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF01028 | Topoisom_I | 26.75 |
| PF01553 | Acyltransferase | 17.20 |
| PF00127 | Copper-bind | 8.28 |
| PF02861 | Clp_N | 7.64 |
| PF03320 | FBPase_glpX | 6.37 |
| PF04471 | Mrr_cat | 1.27 |
| PF12802 | MarR_2 | 1.27 |
| PF00561 | Abhydrolase_1 | 0.64 |
| PF07690 | MFS_1 | 0.64 |
| PF13240 | zinc_ribbon_2 | 0.64 |
| PF14026 | DUF4242 | 0.64 |
| PF02595 | Gly_kinase | 0.64 |
| PF02517 | Rce1-like | 0.64 |
| PF00296 | Bac_luciferase | 0.64 |
| PF00005 | ABC_tran | 0.64 |
| PF03404 | Mo-co_dimer | 0.64 |
| PF13302 | Acetyltransf_3 | 0.64 |
| PF01593 | Amino_oxidase | 0.64 |
| PF01243 | Putative_PNPOx | 0.64 |
| PF08281 | Sigma70_r4_2 | 0.64 |
| PF00583 | Acetyltransf_1 | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 26.75 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 7.64 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 6.37 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| COG1929 | Glycerate kinase | Carbohydrate transport and metabolism [G] | 0.64 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.64 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.99 % |
| Unclassified | root | N/A | 7.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001086|JGI12709J13192_1001573 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
| 3300001086|JGI12709J13192_1011157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 725 | Open in IMG/M |
| 3300001089|JGI12683J13190_1000531 | All Organisms → cellular organisms → Bacteria | 5421 | Open in IMG/M |
| 3300001145|JGI12682J13319_1001423 | All Organisms → cellular organisms → Bacteria | 2618 | Open in IMG/M |
| 3300001174|JGI12679J13547_1003772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 854 | Open in IMG/M |
| 3300001369|JGI12701J14581_1002071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1222 | Open in IMG/M |
| 3300001545|JGI12630J15595_10001371 | All Organisms → cellular organisms → Bacteria | 5252 | Open in IMG/M |
| 3300001593|JGI12635J15846_10191183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1362 | Open in IMG/M |
| 3300001593|JGI12635J15846_10891047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300001661|JGI12053J15887_10012276 | All Organisms → cellular organisms → Bacteria | 4716 | Open in IMG/M |
| 3300001661|JGI12053J15887_10128751 | Not Available | 1347 | Open in IMG/M |
| 3300002908|JGI25382J43887_10459747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300002909|JGI25388J43891_1032822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
| 3300005166|Ga0066674_10113979 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300005180|Ga0066685_10730797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
| 3300005181|Ga0066678_10213771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1236 | Open in IMG/M |
| 3300005187|Ga0066675_10287160 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300005445|Ga0070708_100534089 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300005447|Ga0066689_10125495 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300005450|Ga0066682_10371901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 919 | Open in IMG/M |
| 3300005468|Ga0070707_102010533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300005471|Ga0070698_100002214 | All Organisms → cellular organisms → Bacteria | 21520 | Open in IMG/M |
| 3300005552|Ga0066701_10017705 | All Organisms → cellular organisms → Bacteria | 3464 | Open in IMG/M |
| 3300005552|Ga0066701_10093507 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300005552|Ga0066701_10111564 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300005554|Ga0066661_10144781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1451 | Open in IMG/M |
| 3300005557|Ga0066704_10144866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1590 | Open in IMG/M |
| 3300005574|Ga0066694_10378225 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005576|Ga0066708_10687985 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005587|Ga0066654_10599608 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005598|Ga0066706_10105672 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300006028|Ga0070717_10022952 | All Organisms → cellular organisms → Bacteria | 4937 | Open in IMG/M |
| 3300006028|Ga0070717_10024571 | All Organisms → cellular organisms → Bacteria | 4787 | Open in IMG/M |
| 3300006028|Ga0070717_10139457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2090 | Open in IMG/M |
| 3300006041|Ga0075023_100552186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300006173|Ga0070716_100394804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 993 | Open in IMG/M |
| 3300006791|Ga0066653_10498069 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006800|Ga0066660_10041947 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
| 3300006800|Ga0066660_10322191 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300007076|Ga0075435_100548181 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300007258|Ga0099793_10117036 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300007265|Ga0099794_10131789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1262 | Open in IMG/M |
| 3300007265|Ga0099794_10497121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 642 | Open in IMG/M |
| 3300007982|Ga0102924_1008217 | All Organisms → cellular organisms → Bacteria | 9371 | Open in IMG/M |
| 3300007982|Ga0102924_1020442 | All Organisms → cellular organisms → Bacteria | 4855 | Open in IMG/M |
| 3300009012|Ga0066710_100532382 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300009038|Ga0099829_10001670 | All Organisms → cellular organisms → Bacteria | 12456 | Open in IMG/M |
| 3300009038|Ga0099829_10015925 | All Organisms → cellular organisms → Bacteria | 5026 | Open in IMG/M |
| 3300009038|Ga0099829_10191323 | Not Available | 1652 | Open in IMG/M |
| 3300009038|Ga0099829_10249109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1448 | Open in IMG/M |
| 3300009038|Ga0099829_10328675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1257 | Open in IMG/M |
| 3300009088|Ga0099830_10096469 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300009088|Ga0099830_10154682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1766 | Open in IMG/M |
| 3300009088|Ga0099830_11882036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300009090|Ga0099827_10002506 | All Organisms → cellular organisms → Bacteria | 10181 | Open in IMG/M |
| 3300009090|Ga0099827_10061621 | All Organisms → cellular organisms → Bacteria | 2864 | Open in IMG/M |
| 3300010321|Ga0134067_10053324 | Not Available | 1307 | Open in IMG/M |
| 3300010322|Ga0134084_10016370 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300010329|Ga0134111_10182237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 843 | Open in IMG/M |
| 3300011269|Ga0137392_11443560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300011270|Ga0137391_10476165 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300011271|Ga0137393_10343334 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300011401|Ga0153984_1103405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 590 | Open in IMG/M |
| 3300012198|Ga0137364_10095791 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300012200|Ga0137382_10002201 | All Organisms → cellular organisms → Bacteria | 8871 | Open in IMG/M |
| 3300012202|Ga0137363_10736137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 835 | Open in IMG/M |
| 3300012202|Ga0137363_11739825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
| 3300012203|Ga0137399_10013212 | All Organisms → cellular organisms → Bacteria | 5089 | Open in IMG/M |
| 3300012203|Ga0137399_11579369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
| 3300012205|Ga0137362_11545782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300012208|Ga0137376_10100657 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300012349|Ga0137387_10059317 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300012361|Ga0137360_10559836 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300012917|Ga0137395_10000127 | All Organisms → cellular organisms → Bacteria | 25622 | Open in IMG/M |
| 3300012918|Ga0137396_10884082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 655 | Open in IMG/M |
| 3300012918|Ga0137396_11101947 | Not Available | 567 | Open in IMG/M |
| 3300012925|Ga0137419_11120564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Raineyella → Raineyella fluvialis | 656 | Open in IMG/M |
| 3300012927|Ga0137416_10995727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 749 | Open in IMG/M |
| 3300012927|Ga0137416_11819556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
| 3300015241|Ga0137418_11154719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300018433|Ga0066667_10646354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
| 3300018468|Ga0066662_10124361 | Not Available | 1890 | Open in IMG/M |
| 3300018468|Ga0066662_10226834 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300018482|Ga0066669_10247103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1407 | Open in IMG/M |
| 3300019888|Ga0193751_1058929 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300020579|Ga0210407_10193968 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300021046|Ga0215015_10199062 | All Organisms → cellular organisms → Bacteria | 3064 | Open in IMG/M |
| 3300021046|Ga0215015_10309286 | All Organisms → cellular organisms → Bacteria | 4333 | Open in IMG/M |
| 3300021046|Ga0215015_10428542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 574 | Open in IMG/M |
| 3300021046|Ga0215015_10746866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 646 | Open in IMG/M |
| 3300021432|Ga0210384_10494900 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300021559|Ga0210409_10098810 | Not Available | 2694 | Open in IMG/M |
| 3300022557|Ga0212123_10060432 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
| 3300025910|Ga0207684_10007183 | All Organisms → cellular organisms → Bacteria | 10069 | Open in IMG/M |
| 3300025910|Ga0207684_10892734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 747 | Open in IMG/M |
| 3300025910|Ga0207684_10909866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 739 | Open in IMG/M |
| 3300025910|Ga0207684_11736490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300025922|Ga0207646_10046687 | All Organisms → cellular organisms → Bacteria | 3885 | Open in IMG/M |
| 3300025929|Ga0207664_11330660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 638 | Open in IMG/M |
| 3300025939|Ga0207665_10435983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1003 | Open in IMG/M |
| 3300026277|Ga0209350_1033493 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300026296|Ga0209235_1118200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1117 | Open in IMG/M |
| 3300026297|Ga0209237_1057872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1900 | Open in IMG/M |
| 3300026309|Ga0209055_1060639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1600 | Open in IMG/M |
| 3300026310|Ga0209239_1291783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
| 3300026316|Ga0209155_1047080 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300026317|Ga0209154_1035618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2268 | Open in IMG/M |
| 3300026318|Ga0209471_1001951 | All Organisms → cellular organisms → Bacteria | 12104 | Open in IMG/M |
| 3300026318|Ga0209471_1066588 | Not Available | 1622 | Open in IMG/M |
| 3300026318|Ga0209471_1254064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
| 3300026326|Ga0209801_1289010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 590 | Open in IMG/M |
| 3300026328|Ga0209802_1014154 | All Organisms → cellular organisms → Bacteria | 4569 | Open in IMG/M |
| 3300026330|Ga0209473_1029936 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300026342|Ga0209057_1181061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
| 3300026548|Ga0209161_10032592 | All Organisms → cellular organisms → Bacteria | 3576 | Open in IMG/M |
| 3300026548|Ga0209161_10554872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300026551|Ga0209648_10065021 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300027388|Ga0208995_1026529 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300027521|Ga0209524_1011556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1771 | Open in IMG/M |
| 3300027521|Ga0209524_1019577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1397 | Open in IMG/M |
| 3300027535|Ga0209734_1004773 | All Organisms → cellular organisms → Bacteria | 2387 | Open in IMG/M |
| 3300027537|Ga0209419_1001277 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
| 3300027546|Ga0208984_1008553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1912 | Open in IMG/M |
| 3300027546|Ga0208984_1081654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 698 | Open in IMG/M |
| 3300027562|Ga0209735_1019989 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300027587|Ga0209220_1000833 | All Organisms → cellular organisms → Bacteria | 9140 | Open in IMG/M |
| 3300027587|Ga0209220_1002781 | All Organisms → cellular organisms → Bacteria | 4745 | Open in IMG/M |
| 3300027587|Ga0209220_1005824 | All Organisms → cellular organisms → Bacteria | 3297 | Open in IMG/M |
| 3300027587|Ga0209220_1008932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2680 | Open in IMG/M |
| 3300027587|Ga0209220_1011141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2397 | Open in IMG/M |
| 3300027587|Ga0209220_1076143 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300027603|Ga0209331_1020041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1732 | Open in IMG/M |
| 3300027610|Ga0209528_1146844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
| 3300027645|Ga0209117_1008502 | All Organisms → cellular organisms → Bacteria | 3496 | Open in IMG/M |
| 3300027651|Ga0209217_1053839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1208 | Open in IMG/M |
| 3300027651|Ga0209217_1068570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300027667|Ga0209009_1000004 | All Organisms → cellular organisms → Bacteria | 164700 | Open in IMG/M |
| 3300027678|Ga0209011_1015899 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300027678|Ga0209011_1110115 | Not Available | 795 | Open in IMG/M |
| 3300027681|Ga0208991_1044966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1334 | Open in IMG/M |
| 3300027846|Ga0209180_10074911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1904 | Open in IMG/M |
| 3300027846|Ga0209180_10081032 | Not Available | 1832 | Open in IMG/M |
| 3300027846|Ga0209180_10276576 | Not Available | 964 | Open in IMG/M |
| 3300027862|Ga0209701_10070853 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300027862|Ga0209701_10171564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1311 | Open in IMG/M |
| 3300027882|Ga0209590_10028789 | All Organisms → cellular organisms → Bacteria | 2909 | Open in IMG/M |
| 3300027903|Ga0209488_10412719 | Not Available | 998 | Open in IMG/M |
| 3300027910|Ga0209583_10288851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 740 | Open in IMG/M |
| 3300028047|Ga0209526_10413112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 894 | Open in IMG/M |
| 3300028673|Ga0257175_1128463 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300028792|Ga0307504_10463348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300031753|Ga0307477_10000169 | All Organisms → cellular organisms → Bacteria | 92072 | Open in IMG/M |
| 3300031820|Ga0307473_10713127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 706 | Open in IMG/M |
| 3300031823|Ga0307478_10000234 | All Organisms → cellular organisms → Bacteria | 63803 | Open in IMG/M |
| 3300031962|Ga0307479_10000148 | All Organisms → cellular organisms → Bacteria | 65223 | Open in IMG/M |
| 3300032180|Ga0307471_100070344 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
| 3300032180|Ga0307471_101386730 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 22.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.64% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001145 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001369 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011401 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12709J13192_10015735 | 3300001086 | Forest Soil | MLMEAPATESTVPAFVAIGIITLFVLLSISGYLILSAS* |
| JGI12709J13192_10111572 | 3300001086 | Forest Soil | LMFMEAPATESTVPAFVAVGIITLFVLLSISGYLILSAS* |
| JGI12683J13190_10005315 | 3300001089 | Forest Soil | METPDRQSTTLPAFAAVGILTLFVLLSISGYLILSAR* |
| JGI12682J13319_10014232 | 3300001145 | Forest Soil | MDARDAWRTTLPAFAAVVIITVFVLLSISGYLILSAS* |
| JGI12679J13547_10037721 | 3300001174 | Forest Soil | MEASDDKSTALPAFAAVGILTLFVLLSISGYLILSAR* |
| JGI12701J14581_10020712 | 3300001369 | Forest Soil | MEASDDKSTALPAFAAVGILTLFVLLSISGYLVLSAR* |
| JGI12630J15595_100013713 | 3300001545 | Forest Soil | MLMEAPATESTVPAVAAIVIITLFVLLSISGYLILSAS* |
| JGI12635J15846_101911832 | 3300001593 | Forest Soil | MFMEAPATESTVPAFVAVGIITLFVLLSISGYLILSAS* |
| JGI12635J15846_108910472 | 3300001593 | Forest Soil | MDAREAWRTTLPALAAVGIITVFVLLSISGYLILSAS* |
| JGI12053J15887_100122762 | 3300001661 | Forest Soil | MEAPQGESTGLPAFAAVGILTLFVLLSISGYLILSAR* |
| JGI12053J15887_101287512 | 3300001661 | Forest Soil | MEVPDREPALPAYVAVAILTLFVLLAISGYLILSAR* |
| JGI25382J43887_104597473 | 3300002908 | Grasslands Soil | LILMEAPDNESTALPAFAAVGILTLFVLLSISGYLILSAR* |
| JGI25388J43891_10328222 | 3300002909 | Grasslands Soil | MIVMETPDGEHTALPAFAAVGILAIFVLLSISGYLILSAR* |
| Ga0066674_101139792 | 3300005166 | Soil | MLMETPDGEHTALPAFAAVGILALFVLLSIYGYLLLSAR* |
| Ga0066685_107307972 | 3300005180 | Soil | MIVMETPDGEHTALPAFAAVGILAIFVVLSISGYLILSAR* |
| Ga0066678_102137712 | 3300005181 | Soil | MEPMETPDNRSSALPAFAAVGILALFVLLSISGYLILSAR* |
| Ga0066675_102871602 | 3300005187 | Soil | MMFMGTPDGEHTALPAFAAVGILTLFVLLSIYGYLILSAR* |
| Ga0070708_1005340892 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LNVVDAQDPETTTLPAFAAIGIITLFVLLSISGYLILSAS* |
| Ga0066689_101254953 | 3300005447 | Soil | MIVMETPDGEHTALPAFAAVGILTIFVLLSISGYLILSAR* |
| Ga0066682_103719012 | 3300005450 | Soil | MFMETPDGEHTALPAFAAVGILALFVLLSIYGYLLLSAR* |
| Ga0070707_1020105331 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVKASDGDSTALPAFAAIGILTLFVLLSISGYLILSAR* |
| Ga0070698_10000221425 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVKASDGDSTALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0066701_100177053 | 3300005552 | Soil | METPDGERTALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0066701_100935072 | 3300005552 | Soil | MDAQDPETTTLPAYAAIGIITLFVLLSISGYLILSAS* |
| Ga0066701_101115642 | 3300005552 | Soil | MDAQDPESTTLPAFAAVGIIALFVLLSISGYLILSAT* |
| Ga0066661_101447812 | 3300005554 | Soil | METSDGESTAIPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0066704_101448662 | 3300005557 | Soil | METSDGESTALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0066694_103782252 | 3300005574 | Soil | MLMETPDGEHTALPAFAAVGILALFVLLSIYGYLILSAR* |
| Ga0066708_106879852 | 3300005576 | Soil | METPDNRSSALPAFAAVGILALFVLLSISGYLILSAR* |
| Ga0066654_105996082 | 3300005587 | Soil | MIVMETPDGEHTALPAFAAVGILTLFVLLSIYGYLILSAR* |
| Ga0066706_101056721 | 3300005598 | Soil | MTLMETPDGEHTALPAFAAVGILAIFVLLSISGYLI |
| Ga0070717_100229521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAQDPETTTLPAFAAIGIITLFVLLSISGYLILSAS* |
| Ga0070717_100245717 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAQDTRRTLPALAAIGIITLFVLLSISGYLILSAS* |
| Ga0070717_101394573 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAEDGRRTLPAFAAIGIITLFVLLSISGYFILSAS* |
| Ga0075023_1005521861 | 3300006041 | Watersheds | MEAHNRQRTLPALAAIGIITLFVLLSISGYLILSAS* |
| Ga0070716_1003948041 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | METPDEESTALPAFAAVGFLTLFVLLSISGYLILSAR* |
| Ga0066653_104980692 | 3300006791 | Soil | METPDGEHTALPAFAAVGILALFVLLSISGYLILSAR* |
| Ga0066660_100419474 | 3300006800 | Soil | METSDGEGTALPAFAAVGVLALFVRLSISGYLILSAR* |
| Ga0066660_103221912 | 3300006800 | Soil | METPDNRSSALPAIAAVGILALFVLLSISGYLILSAR* |
| Ga0075435_1005481812 | 3300007076 | Populus Rhizosphere | MDAKNAAPTTLPAFAAIGIITLFVLLSISGYLILSAS* |
| Ga0099793_101170362 | 3300007258 | Vadose Zone Soil | MEAPDNESTALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0099794_101317892 | 3300007265 | Vadose Zone Soil | MQAPDNESTALPAFAAVGILTLFVLLAISGYLILSAR* |
| Ga0099794_104971211 | 3300007265 | Vadose Zone Soil | PAGLFIMDAQDDERSPLPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0102924_10082173 | 3300007982 | Iron-Sulfur Acid Spring | METQGGVTTTLPAFAAVGIITLFVLLSISGYLVLSAT* |
| Ga0102924_10204423 | 3300007982 | Iron-Sulfur Acid Spring | LIIMDAHNDRSSALPAYAAVAFLTLFVLLSISGYLILSVR* |
| Ga0066710_1005323821 | 3300009012 | Grasslands Soil | MEGPDGEHTALPAFTAVGILALFVLLSISGYLILSAR |
| Ga0099829_1000167013 | 3300009038 | Vadose Zone Soil | MEAQNGQRTLPAFAAIGIITLFVLLSISGYLILSAS* |
| Ga0099829_100159256 | 3300009038 | Vadose Zone Soil | MDAQNPESTTLPAFAAVGIIALFVLLSISGYLILSAT* |
| Ga0099829_101913231 | 3300009038 | Vadose Zone Soil | MEAQDHEGTSLPAFAAVGILTLFVLLAISGYLILAAR* |
| Ga0099829_102491092 | 3300009038 | Vadose Zone Soil | MEASDGESTGLPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0099829_103286753 | 3300009038 | Vadose Zone Soil | MEAQDHERTTLPAFAAVGILTLFVLLSISGYLILAAR* |
| Ga0099830_100964692 | 3300009088 | Vadose Zone Soil | MDAQDAESTTLPAFAAVGIIALFVLLSISGYLILSAT* |
| Ga0099830_101546822 | 3300009088 | Vadose Zone Soil | MEAQDQEGTTLPAFAAVGILILFVLLAISGYLILAAR* |
| Ga0099830_118820362 | 3300009088 | Vadose Zone Soil | MEAKDDESTALPAFAAMGILTLFVLLSISGYLILSAR |
| Ga0099827_1000250611 | 3300009090 | Vadose Zone Soil | MKASDGESTALPAFAAVGILTLFVLLSISGYLVLSAR* |
| Ga0099827_100616213 | 3300009090 | Vadose Zone Soil | METPDGERAALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0134067_100533241 | 3300010321 | Grasslands Soil | MMFMGTPAGEHTALPAFAAVGILTLFVLLSIYGYLILSAR* |
| Ga0134084_100163702 | 3300010322 | Grasslands Soil | METPDGEHTALPAFAAVGILALFVLLSIYGYLLLSAR* |
| Ga0134111_101822371 | 3300010329 | Grasslands Soil | TPDGERTALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0137392_114435602 | 3300011269 | Vadose Zone Soil | MEAQNGQRTLPAFAAIGIITLFVLLSISGYLVLSAS* |
| Ga0137391_104761652 | 3300011270 | Vadose Zone Soil | MEAQDQEGTTLPAFAAVGILTLFVLLAISGYLILAAR* |
| Ga0137393_103433342 | 3300011271 | Vadose Zone Soil | LIFMEAQDHERTTLPAFAAVGILTLFVLLSISGYLILAAR* |
| Ga0153984_11034052 | 3300011401 | Attine Ant Fungus Gardens | MDAKNAAPTTLPALAAIGIIALFVLLSISGYLILSTT* |
| Ga0137364_100957914 | 3300012198 | Vadose Zone Soil | MEGPDGEHTALPAFTAVGILALFVLLSISGYLILSAR* |
| Ga0137382_100022016 | 3300012200 | Vadose Zone Soil | VQNKFMEGPDGEHTALPAFTAVGILALFVLLSISGYLILSAR* |
| Ga0137363_107361371 | 3300012202 | Vadose Zone Soil | MDAKNGEPTTFPAFAAIGIIALFVLLSISGYLILSAS* |
| Ga0137363_117398252 | 3300012202 | Vadose Zone Soil | METPDGERTALPALAAVGILTLFVLLSISGYLILSAR* |
| Ga0137399_100132123 | 3300012203 | Vadose Zone Soil | METPDNESTALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0137399_115793691 | 3300012203 | Vadose Zone Soil | METPENGRTALPAFAAVGILALFVLLSISGYLILSAR* |
| Ga0137362_115457822 | 3300012205 | Vadose Zone Soil | MDAQDPESTTLPAFAAVGIIALFVLLSISGYLILSAR* |
| Ga0137376_101006574 | 3300012208 | Vadose Zone Soil | MEAPDGEQTALPAFAAVGILTLFVLLSIYGYLILSGR* |
| Ga0137387_100593172 | 3300012349 | Vadose Zone Soil | METPDGERTALPAFAAVGILSLFVLLSISGYLILSAR* |
| Ga0137360_105598362 | 3300012361 | Vadose Zone Soil | MDAQAPESTTLPAFAAVGIIALFVLLSISGYLILSAT* |
| Ga0137395_1000012719 | 3300012917 | Vadose Zone Soil | MEAQNSQRTLPAFAAIGIITLFVLLSISGYLILSAS* |
| Ga0137396_108840822 | 3300012918 | Vadose Zone Soil | METPGDETKAFPAFAAVAILTLFVLLSISGYLILSAR* |
| Ga0137396_111019472 | 3300012918 | Vadose Zone Soil | MDAPGGESTALPAFAAVAILTLFVLLSISGYLILSAR* |
| Ga0137419_111205642 | 3300012925 | Vadose Zone Soil | MEAPDGKSTTLPAFAAVAILTLFVLLSISGYLILSAR* |
| Ga0137416_109957272 | 3300012927 | Vadose Zone Soil | MEAPDGKSTTLPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0137416_118195561 | 3300012927 | Vadose Zone Soil | MKAPDKESTALPAFAAVGILTLFVLLSISGYLILSAR* |
| Ga0137418_111547192 | 3300015241 | Vadose Zone Soil | METPDNESTALPAFAAVGILTLFVLLSISGYLMLSGS* |
| Ga0066667_106463542 | 3300018433 | Grasslands Soil | MIVMETPDGEHTALPAFAAVGILAIFVVLSISGYLILSAR |
| Ga0066662_101243613 | 3300018468 | Grasslands Soil | MIVMETPDGEHTALPAFAAVGILAIFVLLSISGYLILSAR |
| Ga0066662_102268342 | 3300018468 | Grasslands Soil | METPDGERTALPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0066669_102471033 | 3300018482 | Grasslands Soil | METPDGEHTALPAFAAVGILALFVLLSIYGYLLLSAR |
| Ga0193751_10589292 | 3300019888 | Soil | MEAQGGESTVLPAFAAVGIIAIFVLLSISGYLILSTS |
| Ga0210407_101939682 | 3300020579 | Soil | MEAHNRQRTLPAFAAIGIITLFVLLSISGYLILSAS |
| Ga0215015_101990623 | 3300021046 | Soil | MEAQDDRRTLPALAAIGIITLFVLLSISGYLILSAS |
| Ga0215015_103092863 | 3300021046 | Soil | VEAQDHESTTLPAFAAVGILTLFVLLSISGYLILAAR |
| Ga0215015_104285422 | 3300021046 | Soil | MEVRDQERTSLPAFAAVGILTLFVLLAISGYLILAAH |
| Ga0215015_107468662 | 3300021046 | Soil | MDAQDDDPSALPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0210384_104949002 | 3300021432 | Soil | MGAQSGQRTLPALAAIGIITLFVLLSISGYLILSAS |
| Ga0210409_100988105 | 3300021559 | Soil | MEAENRQRTLPAIAAIGLITLFVLLSISGYLILSAS |
| Ga0212123_100604322 | 3300022557 | Iron-Sulfur Acid Spring | MDAHNDRSSALPAYAAVAFLTLFVLLSISGYLILSVR |
| Ga0207684_100071832 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAEDGRRTLPAFAAIGIITLFVLLSISGYFILSAS |
| Ga0207684_108927341 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAQDHEGTTLPAFAAVGILTLFVLLAISGYLILAAR |
| Ga0207684_109098662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQDPESTTLPAFAAVGIIALFVLLSISGYLILSAT |
| Ga0207684_117364901 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQDPETTTLPAFAAVGIITLFVLLSISGYLILSAS |
| Ga0207646_100466874 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQDPETTTLPAFAAIGIITLFVLLSISGYLILSAS |
| Ga0207664_113306601 | 3300025929 | Agricultural Soil | LNVIDAKNAEPTTLPAFAAIGIIALFVLLSISGYLILSAS |
| Ga0207665_104359831 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | METPDEESTALPAFAAVGFLTLFVLLSISGYLVLSAR |
| Ga0209350_10334932 | 3300026277 | Grasslands Soil | METPDNRSSALPAFAAVGILALFVLLSISGYLILSAR |
| Ga0209235_11182002 | 3300026296 | Grasslands Soil | MEAPDNESTALPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209237_10578723 | 3300026297 | Grasslands Soil | LILMEAPDNESTALPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209055_10606393 | 3300026309 | Soil | METSDGESTAIPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209239_12917832 | 3300026310 | Grasslands Soil | MMFMGTPDGEHTALPAFAAVGILTLFVLLSIYGYLILSAR |
| Ga0209155_10470803 | 3300026316 | Soil | MLMETPDGEHTALPAFAAVGILALFVLLSIYGYLLLSAR |
| Ga0209154_10356183 | 3300026317 | Soil | METSDGESTALPAFAAVGILTLFVLLSISGYLILSA |
| Ga0209471_10019515 | 3300026318 | Soil | METSDGESTALPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209471_10665882 | 3300026318 | Soil | MEAPQGESTGLPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209471_12540642 | 3300026318 | Soil | METPDNRSSALPAIAAVGILALFVLLSISGYLILSAR |
| Ga0209801_12890101 | 3300026326 | Soil | MEPMETPDNRSSALPAFAAVGILALFVLLSISGYLILSAR |
| Ga0209802_10141544 | 3300026328 | Soil | MDAQDPETTTLPAYAAIGIITLFVLLSISGYLILSAS |
| Ga0209473_10299363 | 3300026330 | Soil | MVVMETPDGEHTALPAFAAVGILTIFVLLSISGYLILSAR |
| Ga0209057_11810612 | 3300026342 | Soil | CKMIVMETPDGEHTALPAFAAVGILAIFVLLSISGYLILSAR |
| Ga0209161_100325925 | 3300026548 | Soil | MTLMETPDGEHTALPAFAAVGILAIFVLLSISGYLILSAR |
| Ga0209161_105548722 | 3300026548 | Soil | KMIVMETPDGEHTALPAFAAVGILAIFVLLSISGYLILSAR |
| Ga0209648_100650213 | 3300026551 | Grasslands Soil | MATQDDRNTALPAFAAVGILTLFVLLAISGYLILSAR |
| Ga0208995_10265292 | 3300027388 | Forest Soil | MEAPDGKSTTLPAFAAVAILTLFVLLAISGYLILSAR |
| Ga0209524_10115564 | 3300027521 | Forest Soil | MLMEAPATESTVPAVAAIVIITLFVLLSISGYLILSAS |
| Ga0209524_10195772 | 3300027521 | Forest Soil | MEASDDKSTALPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209734_10047731 | 3300027535 | Forest Soil | MEAPHRESTALPAFAAMGILTLFVLLSISGYLMLSAR |
| Ga0209419_10012772 | 3300027537 | Forest Soil | MDAREAWRTTLPALAAVGIIAVFVLLSISGYLILSAS |
| Ga0208984_10085533 | 3300027546 | Forest Soil | MDAQDRGATTLPAFAAIGIISLFVLLSISGYLILSGS |
| Ga0208984_10816542 | 3300027546 | Forest Soil | MEVPDREPALPAYVAVAILTLFVLLAISGYLILSAR |
| Ga0209735_10199892 | 3300027562 | Forest Soil | MDAREAWRTTLPALAAVGIITVFVLLSISGYLILSAS |
| Ga0209220_100083311 | 3300027587 | Forest Soil | MEAPHRESTALPAFAAVGILTLFVLLSISGYLVLSAR |
| Ga0209220_10027815 | 3300027587 | Forest Soil | MLMEAPATESTVPAFVAIGIITLFVLLSISGYLILSAS |
| Ga0209220_10058242 | 3300027587 | Forest Soil | MFMEAPATESTVPAFVAVGIITLFVLLSISGYLILSAS |
| Ga0209220_10089324 | 3300027587 | Forest Soil | MEAPHGESTALPAFAAVGILTLFVLLSISGYLMLSAR |
| Ga0209220_10111413 | 3300027587 | Forest Soil | MEPSDGESRALPAFAAVGIITLFVLLSISSYLILSAR |
| Ga0209220_10761432 | 3300027587 | Forest Soil | METPDRQSTTLPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209331_10200411 | 3300027603 | Forest Soil | MEASDDKSTALPAFAAVGILTLFVLLSISGYLVLSAR |
| Ga0209528_11468441 | 3300027610 | Forest Soil | METSDRESTALPAFAAVGILTLFVLLSISGYLILS |
| Ga0209117_10085022 | 3300027645 | Forest Soil | MEAHDGESTTLPAFAAVGIITLFVLLTISGYLILSAS |
| Ga0209217_10538392 | 3300027651 | Forest Soil | MEASDGESTALPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0209217_10685702 | 3300027651 | Forest Soil | MEAQDSEGTPLPAFAAVGIITLFVLLAISGYLILSLR |
| Ga0209009_1000004119 | 3300027667 | Forest Soil | MDARDAWRTTLPAFAAVVIITVFVLLSISGYLILSAS |
| Ga0209011_10158992 | 3300027678 | Forest Soil | MEAPQPETTTLPALAAIGIITFFVLLSISGYLILSGS |
| Ga0209011_11101152 | 3300027678 | Forest Soil | MGARDGESTALPAFAAVGIITLFVLLTISGYLILSAS |
| Ga0208991_10449662 | 3300027681 | Forest Soil | MEALDGKSTTLPALAAVAILTLFVLLSISGYLILSAR |
| Ga0209180_100749113 | 3300027846 | Vadose Zone Soil | MEAQNGQRTLPAFAAIGIITLFVLLSISGYLILSAS |
| Ga0209180_100810323 | 3300027846 | Vadose Zone Soil | MDAQNPESTTLPAFAAVGIIALFVLLSISGYLILSAT |
| Ga0209180_102765762 | 3300027846 | Vadose Zone Soil | MEANDDESTALPAFAAMGILTLFVLLSISGYLILSAR |
| Ga0209701_100708532 | 3300027862 | Vadose Zone Soil | MDAQDAESTTLPAFAAVGIIALFVLLSISGYLILSAT |
| Ga0209701_101715642 | 3300027862 | Vadose Zone Soil | MEAQDQEGTTLPAFAAVGILILFVLLAISGYLILAAR |
| Ga0209590_100287893 | 3300027882 | Vadose Zone Soil | MKASDGESTALPAFAAVGILTLFVLLSISGYLVLSAR |
| Ga0209488_104127191 | 3300027903 | Vadose Zone Soil | MEAQNSQRTLPAFAAIGIITLFVLLSISGYLILSAS |
| Ga0209583_102888512 | 3300027910 | Watersheds | MEAHNRQRTLPALAAIGIITLFVLLSISGYLILSAS |
| Ga0209526_104131122 | 3300028047 | Forest Soil | METSDRESTALPAFAAVGILALFVLLSISGYLILSAR |
| Ga0257175_11284631 | 3300028673 | Soil | MEASDGASTGLPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0307504_104633482 | 3300028792 | Soil | MEAKNAEPTTLPALAAIGIIALFVLLSISGYLILSTS |
| Ga0307477_100001697 | 3300031753 | Hardwood Forest Soil | MEVENRQRTLPAIAAIVLITLFVLLSISGYLILSAS |
| Ga0307473_107131272 | 3300031820 | Hardwood Forest Soil | MEASDDKSRTLPAFAAVGILTLFVLLSISGYLILSAR |
| Ga0307478_100002346 | 3300031823 | Hardwood Forest Soil | MEAENSQRTLPAIAAIGLITLFVLLSISGYLILSAS |
| Ga0307479_1000014833 | 3300031962 | Hardwood Forest Soil | MDAKNAARTTLPAFAAIGIITLFVLLSISGYLMLSAS |
| Ga0307471_1000703442 | 3300032180 | Hardwood Forest Soil | MEAQNRQRTLPAFAAIGIITLFVLLSISGYLILSAS |
| Ga0307471_1013867302 | 3300032180 | Hardwood Forest Soil | MDARNAEPTTLPAFAAIGIITLFVLLSISGYLILSAS |
| ⦗Top⦘ |