Metagenome Family F043134

Basic Information
Family ID	F043134
Family Type	Metagenome
Number of Sequences	157
Average Sequence Length	43 residues
Representative Sequence	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEMCY
Number of Associated Samples	23
Number of Associated Scaffolds	157

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	20.78 %
% of genes near scaffold ends (potentially truncated)	61.78 %
% of genes from short scaffolds (< 2000 bps)	89.81 %
Associated GOLD sequencing projects	13
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Unclassified (70.064 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (82.166 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 157 Family Scaffolds
PF13358	DDE_3	3.82
PF00501	AMP-binding	0.64

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
All Organisms	root	All Organisms	29.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
cellular organisms	root	All Organisms → cellular organisms	29.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	29.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	29.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	16.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	16.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	16.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	15.92 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	15.29 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.64 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	14.65 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.64 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.64 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	14.65 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.64 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	14.65 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.64 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	14.65 %
Ancylostomatoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea	0.64 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	14.65 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.64 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	14.65 %
Ancylostomatinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae	0.64 %
Sarcopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	14.65 %
Coelacanthimorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha	0.64 %
Ancylostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	14.65 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Coelacanthiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	14.65 %
Coelacanthidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	14.65 %
Latimeria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.06 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	14.65 %
Latimeria chalumnae	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	0.64 %
Ancylostoma duodenale	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	0.64 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.64 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001734\|JGI24668J20090_10062359	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	922	Open in IMG/M
3300001734\|JGI24668J20090_10113364	Not Available	727	Open in IMG/M
3300001734\|JGI24668J20090_10116247	Not Available	719	Open in IMG/M
3300001734\|JGI24668J20090_10125065	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	698	Open in IMG/M
3300001734\|JGI24668J20090_10142274	Not Available	661	Open in IMG/M
3300001734\|JGI24668J20090_10174243	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	605	Open in IMG/M
3300001734\|JGI24668J20090_10189564	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	582	Open in IMG/M
3300001734\|JGI24668J20090_10193210	Not Available	577	Open in IMG/M
3300001734\|JGI24668J20090_10204295	Not Available	563	Open in IMG/M
3300001734\|JGI24668J20090_10248309	Not Available	514	Open in IMG/M
3300001734\|JGI24668J20090_10254307	Not Available	508	Open in IMG/M
3300001734\|JGI24668J20090_10255884	Not Available	507	Open in IMG/M
3300001741\|JGI24671J20093_10005387	Not Available	1877	Open in IMG/M
3300001741\|JGI24671J20093_10082168	All Organisms → cellular organisms → Eukaryota → Opisthokonta	744	Open in IMG/M
3300001741\|JGI24671J20093_10086980	Not Available	729	Open in IMG/M
3300001741\|JGI24671J20093_10137083	Not Available	613	Open in IMG/M
3300001741\|JGI24671J20093_10146867	All Organisms → cellular organisms → Eukaryota → Opisthokonta	597	Open in IMG/M
3300001741\|JGI24671J20093_10153764	Not Available	586	Open in IMG/M
3300001741\|JGI24671J20093_10171128	All Organisms → cellular organisms → Eukaryota → Opisthokonta	562	Open in IMG/M
3300001741\|JGI24671J20093_10200542	Not Available	526	Open in IMG/M
3300001741\|JGI24671J20093_10212435	Not Available	513	Open in IMG/M
3300001742\|JGI24673J20094_10012565	Not Available	1627	Open in IMG/M
3300001742\|JGI24673J20094_10013161	Not Available	1602	Open in IMG/M
3300001742\|JGI24673J20094_10016440	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1479	Open in IMG/M
3300001742\|JGI24673J20094_10032065	Not Available	1169	Open in IMG/M
3300001742\|JGI24673J20094_10034914	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1135	Open in IMG/M
3300001742\|JGI24673J20094_10040760	Not Available	1073	Open in IMG/M
3300001742\|JGI24673J20094_10104257	Not Available	756	Open in IMG/M
3300001742\|JGI24673J20094_10106241	Not Available	750	Open in IMG/M
3300001742\|JGI24673J20094_10110492	Not Available	738	Open in IMG/M
3300001742\|JGI24673J20094_10121812	Not Available	710	Open in IMG/M
3300001742\|JGI24673J20094_10130841	Not Available	689	Open in IMG/M
3300001742\|JGI24673J20094_10145355	Not Available	660	Open in IMG/M
3300001742\|JGI24673J20094_10159464	Not Available	634	Open in IMG/M
3300001742\|JGI24673J20094_10176099	Not Available	607	Open in IMG/M
3300001742\|JGI24673J20094_10205540	All Organisms → cellular organisms → Eukaryota → Opisthokonta	567	Open in IMG/M
3300001742\|JGI24673J20094_10217621	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	553	Open in IMG/M
3300001742\|JGI24673J20094_10234972	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	534	Open in IMG/M
3300001744\|JGI24669J20092_10008388	Not Available	1597	Open in IMG/M
3300001744\|JGI24669J20092_10041214	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	858	Open in IMG/M
3300001744\|JGI24669J20092_10048056	Not Available	812	Open in IMG/M
3300001744\|JGI24669J20092_10053326	Not Available	783	Open in IMG/M
3300001744\|JGI24669J20092_10067034	Not Available	722	Open in IMG/M
3300001744\|JGI24669J20092_10084346	Not Available	664	Open in IMG/M
3300001744\|JGI24669J20092_10137491	Not Available	555	Open in IMG/M
3300001744\|JGI24669J20092_10140064	Not Available	551	Open in IMG/M
3300001744\|JGI24669J20092_10159935	Not Available	524	Open in IMG/M
3300001744\|JGI24669J20092_10173127	Not Available	508	Open in IMG/M
3300001746\|JGI24672J20091_10018037	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1148	Open in IMG/M
3300001746\|JGI24672J20091_10050628	Not Available	790	Open in IMG/M
3300001746\|JGI24672J20091_10073370	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	694	Open in IMG/M
3300001746\|JGI24672J20091_10101027	Not Available	621	Open in IMG/M
3300001746\|JGI24672J20091_10103422	All Organisms → cellular organisms → Eukaryota → Opisthokonta	615	Open in IMG/M
3300001746\|JGI24672J20091_10110389	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	601	Open in IMG/M
3300001746\|JGI24672J20091_10136854	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	556	Open in IMG/M
3300001746\|JGI24672J20091_10138473	Not Available	553	Open in IMG/M
3300001746\|JGI24672J20091_10147385	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	541	Open in IMG/M
3300001746\|JGI24672J20091_10167816	Not Available	515	Open in IMG/M
3300002181\|JGI24670J26820_11179435	Not Available	504	Open in IMG/M
3300002181\|JGI24670J26820_11224739	Not Available	533	Open in IMG/M
3300002181\|JGI24670J26820_11320577	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	608	Open in IMG/M
3300002181\|JGI24670J26820_11325214	Not Available	612	Open in IMG/M
3300002181\|JGI24670J26820_11341952	Not Available	628	Open in IMG/M
3300002181\|JGI24670J26820_11356315	All Organisms → cellular organisms → Eukaryota → Opisthokonta	643	Open in IMG/M
3300002181\|JGI24670J26820_11475312	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	814	Open in IMG/M
3300002181\|JGI24670J26820_11483684	Not Available	831	Open in IMG/M
3300002181\|JGI24670J26820_11495000	Not Available	856	Open in IMG/M
3300002181\|JGI24670J26820_11595925	Not Available	1304	Open in IMG/M
3300002181\|JGI24670J26820_11600580	Not Available	1353	Open in IMG/M
3300002181\|JGI24670J26820_11612748	Not Available	1519	Open in IMG/M
3300002181\|JGI24670J26820_11623867	Not Available	1797	Open in IMG/M
3300002181\|JGI24670J26820_11628554	Not Available	2024	Open in IMG/M
3300002181\|JGI24670J26820_11635085	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	3176	Open in IMG/M
3300003801\|Ga0056138_1006015	Not Available	1675	Open in IMG/M
3300003853\|Ga0049113_10049739	Not Available	1085	Open in IMG/M
3300003906\|JGI26667J51740_10203027	Not Available	579	Open in IMG/M
3300004087\|Ga0066190_10111978	Not Available	1008	Open in IMG/M
3300004087\|Ga0066190_10135694	Not Available	914	Open in IMG/M
3300004087\|Ga0066190_10316518	Not Available	552	Open in IMG/M
3300004098\|Ga0065184_10208241	Not Available	724	Open in IMG/M
3300004098\|Ga0065184_10319703	Not Available	543	Open in IMG/M
3300004122\|Ga0065185_10122737	All Organisms → cellular organisms → Eukaryota → Opisthokonta	947	Open in IMG/M
3300004122\|Ga0065185_10167477	Not Available	813	Open in IMG/M
3300004122\|Ga0065185_10243111	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	660	Open in IMG/M
3300004630\|Ga0049105_1004728	Not Available	7632	Open in IMG/M
3300027540\|Ga0209791_1274732	Not Available	675	Open in IMG/M
3300027540\|Ga0209791_1346531	Not Available	561	Open in IMG/M
3300027540\|Ga0209791_1357432	Not Available	546	Open in IMG/M
3300027551\|Ga0209338_1004242	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5588	Open in IMG/M
3300027551\|Ga0209338_1020970	Not Available	3333	Open in IMG/M
3300027551\|Ga0209338_1052223	Not Available	2324	Open in IMG/M
3300027551\|Ga0209338_1151343	Not Available	1295	Open in IMG/M
3300027551\|Ga0209338_1226871	Not Available	957	Open in IMG/M
3300027551\|Ga0209338_1307494	Not Available	716	Open in IMG/M
3300027551\|Ga0209338_1314146	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	699	Open in IMG/M
3300027551\|Ga0209338_1379683	Not Available	555	Open in IMG/M
3300027551\|Ga0209338_1382628	Not Available	549	Open in IMG/M
3300027556\|Ga0209743_1020418	Not Available	2541	Open in IMG/M
3300027556\|Ga0209743_1215342	Not Available	894	Open in IMG/M
3300027556\|Ga0209743_1228122	All Organisms → cellular organisms → Eukaryota → Opisthokonta	860	Open in IMG/M
3300027556\|Ga0209743_1255943	Not Available	790	Open in IMG/M
3300027564\|Ga0209428_1052611	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2043	Open in IMG/M
3300027564\|Ga0209428_1061683	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1909	Open in IMG/M
3300027564\|Ga0209428_1165478	Not Available	1139	Open in IMG/M
3300027564\|Ga0209428_1201227	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1001	Open in IMG/M
3300027564\|Ga0209428_1249423	Not Available	857	Open in IMG/M
3300027564\|Ga0209428_1310322	All Organisms → cellular organisms → Eukaryota → Opisthokonta	707	Open in IMG/M
3300027564\|Ga0209428_1314236	Not Available	699	Open in IMG/M
3300027564\|Ga0209428_1380745	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	576	Open in IMG/M
3300027584\|Ga0209637_1015515	Not Available	3372	Open in IMG/M
3300027584\|Ga0209637_1093845	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1639	Open in IMG/M
3300027584\|Ga0209637_1118796	Not Available	1441	Open in IMG/M
3300027584\|Ga0209637_1142038	Not Available	1297	Open in IMG/M
3300027584\|Ga0209637_1151234	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1248	Open in IMG/M
3300027584\|Ga0209637_1169961	Not Available	1158	Open in IMG/M
3300027584\|Ga0209637_1197230	Not Available	1048	Open in IMG/M
3300027584\|Ga0209637_1203672	Not Available	1025	Open in IMG/M
3300027584\|Ga0209637_1285453	Not Available	785	Open in IMG/M
3300027584\|Ga0209637_1344388	Not Available	656	Open in IMG/M
3300027585\|Ga0209150_1057068	Not Available	1596	Open in IMG/M
3300027585\|Ga0209150_1135842	Not Available	1082	Open in IMG/M
3300027585\|Ga0209150_1247415	Not Available	759	Open in IMG/M
3300027585\|Ga0209150_1321031	Not Available	624	Open in IMG/M
3300027585\|Ga0209150_1352236	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae → Ancylostomatinae → Ancylostoma → Ancylostoma duodenale	576	Open in IMG/M
3300027613\|Ga0209122_1035407	Not Available	2146	Open in IMG/M
3300027613\|Ga0209122_1060859	Not Available	1738	Open in IMG/M
3300027613\|Ga0209122_1064807	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1693	Open in IMG/M
3300027613\|Ga0209122_1080423	Not Available	1538	Open in IMG/M
3300027613\|Ga0209122_1096730	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1407	Open in IMG/M
3300027613\|Ga0209122_1273901	Not Available	750	Open in IMG/M
3300027613\|Ga0209122_1278815	All Organisms → cellular organisms → Eukaryota → Opisthokonta	740	Open in IMG/M
3300027613\|Ga0209122_1371708	Not Available	575	Open in IMG/M
3300027613\|Ga0209122_1378064	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	565	Open in IMG/M
3300027620\|Ga0209260_10118551	Not Available	792	Open in IMG/M
3300027620\|Ga0209260_10218709	Not Available	622	Open in IMG/M
3300027620\|Ga0209260_10293120	Not Available	546	Open in IMG/M
3300027620\|Ga0209260_10294374	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	545	Open in IMG/M
3300027620\|Ga0209260_10348525	Not Available	503	Open in IMG/M
3300027626\|Ga0209149_1013422	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae	6092	Open in IMG/M
3300027626\|Ga0209149_1037626	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3970	Open in IMG/M
3300027626\|Ga0209149_1159879	Not Available	1565	Open in IMG/M
3300027626\|Ga0209149_1182672	Not Available	1376	Open in IMG/M
3300027626\|Ga0209149_1188960	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1330	Open in IMG/M
3300027626\|Ga0209149_1257889	All Organisms → cellular organisms → Eukaryota → Opisthokonta	935	Open in IMG/M
3300027626\|Ga0209149_1276366	Not Available	854	Open in IMG/M
3300027626\|Ga0209149_1307618	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	730	Open in IMG/M
3300027626\|Ga0209149_1317408	Not Available	696	Open in IMG/M
3300027632\|Ga0209339_1033499	Not Available	3628	Open in IMG/M
3300027632\|Ga0209339_1118360	Not Available	1846	Open in IMG/M
3300027632\|Ga0209339_1161652	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1473	Open in IMG/M
3300027632\|Ga0209339_1184130	Not Available	1323	Open in IMG/M
3300027632\|Ga0209339_1279604	Not Available	889	Open in IMG/M
3300027632\|Ga0209339_1332396	Not Available	720	Open in IMG/M
3300027632\|Ga0209339_1338829	Not Available	702	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	82.17%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	17.83%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	82.17%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	17.83%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24668J20090_100623592	3300001734	Marine Gutless Worms Symbiont	MVDILNINFEPLTFYCVLFVSLILVSVNVIDINMCKVLILYEM*
JGI24668J20090_101133641	3300001734	Marine Gutless Worms Symbiont	ILNINFEPLTFCCVSFVLSILVAINVIDINMCKMLILCEMCYFCVLDFHTVW*
JGI24668J20090_101162472	3300001734	Marine Gutless Worms Symbiont	MVDILXINFEPLTFSCVLFVLSILVALNAIDINMCKVLILCEMCYFCV*
JGI24668J20090_101250651	3300001734	Marine Gutless Worms Symbiont	MVDILNINFKPLTFCCVLFVSSILVSVNVIDINVCKVLILCEMCYFCA*
JGI24668J20090_101422741	3300001734	Marine Gutless Worms Symbiont	MVDILKINFEPLTFCCVLFISSILVALNVIDINMCKVLILCEMCYFCV*
JGI24668J20090_101742432	3300001734	Marine Gutless Worms Symbiont	MVDILNVNFEPLTFCCVLFVSSILVSVNVIDINMTLCKVLILCEMCYFCV*
JGI24668J20090_101895641	3300001734	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSLILVVLNVIDINMCKVPILCEMCYFCV*
JGI24668J20090_101932102	3300001734	Marine Gutless Worms Symbiont	VNILNINFEPLTFCCVLFVSSILVSVNVIYINMCKVLILM*
JGI24668J20090_102042952	3300001734	Marine Gutless Worms Symbiont	FEALTFCCVLFVSSILVSVNVIDINMCKVLILREMCYFCV*
JGI24668J20090_102483091	3300001734	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSLILVSVNVIDINMCKVLILV*
JGI24668J20090_102543071	3300001734	Marine Gutless Worms Symbiont	KINFEPLTFCCVLFVSSILVALNAIDINMCKVLILV*
JGI24668J20090_102558841	3300001734	Marine Gutless Worms Symbiont	NFEPLTFCCVLFVSSILVALNVIDINMCKVLIVCEMCYFCV*
JGI24671J20093_100053875	3300001741	Marine Gutless Worms Symbiont	MINILNINFEPLTFFCVLFISSILVALNVIDINMYKLLILCEMCYFCV*
JGI24671J20093_100479781	3300001741	Marine Gutless Worms Symbiont	EPLTFCCVLFVSSILVSVNVIDINMCKVLILREMCYFCD*
JGI24671J20093_100821681	3300001741	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSPILVALNVIDINMCKVLILCEMRRPGLRLA*
JGI24671J20093_100869801	3300001741	Marine Gutless Worms Symbiont	INVEPLTFCCVLFVSSILVALNAIDINMSKVLILCEMCYFCV*
JGI24671J20093_101370831	3300001741	Marine Gutless Worms Symbiont	LNINFEPLTFYCVLFVSSILVALNVIDINMCKVLILC
JGI24671J20093_101468672	3300001741	Marine Gutless Worms Symbiont	MVDIFNISFEPLTFCCVLFVSSIGLLVPLNVIDIGLGLNMCKVLILCEMCYFCV*
JGI24671J20093_101537641	3300001741	Marine Gutless Worms Symbiont	VEPLTYCGFLFVSSILVSVNVIDINMYKVLILCEMCYFCV*
JGI24671J20093_101711281	3300001741	Marine Gutless Worms Symbiont	MVDILKINFEPLTFCCVLFVSSILVALNAIDINMCKVLILCEMCYFC
JGI24671J20093_102005421	3300001741	Marine Gutless Worms Symbiont	MVDILNINFKPLTFCCVLFVSSILVALNVIVINMCNVLILCEMCYFCV*
JGI24671J20093_102124351	3300001741	Marine Gutless Worms Symbiont	DIFNINFDPLTFCCVLFVSSILASVNVIDINMCKVLILA*
JGI24673J20094_100125653	3300001742	Marine Gutless Worms Symbiont	MVDILNINCEPLTFCCVLFVSSILVSVNVIDINMCKV
JGI24673J20094_100131611	3300001742	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVDTGCNTMVALNVIDINMCKVLILCEMCFFCV*
JGI24673J20094_100164401	3300001742	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFASSILVSINVIDINMCKVLILC
JGI24673J20094_100320651	3300001742	Marine Gutless Worms Symbiont	MVDIFNINFEPVTFCCVLFVSSINVIDINMCKVQILCEMCYFCVRHFSHGMVATVASRRLS*
JGI24673J20094_100349143	3300001742	Marine Gutless Worms Symbiont	MVDILNINFEPPCCVLFVSSILISVNVIDINMCKVLILCEMCYFCV*
JGI24673J20094_100407601	3300001742	Marine Gutless Worms Symbiont	VNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEMCYFCV*
JGI24673J20094_101042572	3300001742	Marine Gutless Worms Symbiont	MVDIVNINFEPLTFCCVLFVSAILVSVNVIDINMCKVLILL*
JGI24673J20094_101062411	3300001742	Marine Gutless Worms Symbiont	LNINFEPLTFCYVLFVSSILVALNVIDINMCKVLILC
JGI24673J20094_101104923	3300001742	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVSSILVPLNVIDINMCKVLIHVLCEMF
JGI24673J20094_101218121	3300001742	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEMCY
JGI24673J20094_101308411	3300001742	Marine Gutless Worms Symbiont	MVDILNINFEPLXFCCVLFVSSIXVSVNVIDINMCKVXILV*
JGI24673J20094_101453551	3300001742	Marine Gutless Worms Symbiont	MVDILNINFDPLTFCCVLFVSSILVFVNVIHINMCKV*
JGI24673J20094_101594641	3300001742	Marine Gutless Worms Symbiont	MVDILNINYEPLTFCCVLFVSSILVSVNVVMDMNMCKVLILCEMCYFCV*
JGI24673J20094_101760991	3300001742	Marine Gutless Worms Symbiont	LNTNFEPLTFCCVLFVSSILVSVNVIDINMCKVLI
JGI24673J20094_102055402	3300001742	Marine Gutless Worms Symbiont	LNTNFEPLTFCCILSVSSILVALNVIDINMCKVLILCEMCYFVSETFTR
JGI24673J20094_102176211	3300001742	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVPLNVIDINMCKVLIL
JGI24673J20094_102349721	3300001742	Marine Gutless Worms Symbiont	MVDILNTNFEPLTFCCVLFVSSILVSVNVIDINMCKVLI
JGI24669J20092_100083882	3300001744	Marine Gutless Worms Symbiont	NFEPVTFCCVSFVSSILVPLNVIDINMCKVLILCVMCYLCV*
JGI24669J20092_100412143	3300001744	Marine Gutless Worms Symbiont	MVNILNINFEPLTFCCVLFVSSILVALNVIDINMCKGLILCEMCYFY
JGI24669J20092_100480561	3300001744	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVSSILVFVNVIDINIFKVLILV*
JGI24669J20092_100533262	3300001744	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEMCYFCV
JGI24669J20092_100670342	3300001744	Marine Gutless Worms Symbiont	MVDILNIKFEPLTFSCVLFVSSILVALNVIDINMCEVLILCEMCYFCV*
JGI24669J20092_100843461	3300001744	Marine Gutless Worms Symbiont	MVDILNINFEPLTFWCVLFVSTILVPLNVIDVNMCKVLILCEMCYFCA*
JGI24669J20092_101374911	3300001744	Marine Gutless Worms Symbiont	MVDILNINFDPLTFCCVSSILVSVNVFDINMCKVLILV*
JGI24669J20092_101400641	3300001744	Marine Gutless Worms Symbiont	MVDILNINSEPLTFCCVLFVSSILVFVNVIDINIFKVLILV*
JGI24669J20092_101599351	3300001744	Marine Gutless Worms Symbiont	MVDIFNINFEPLTFCCVLFVSSILIPLNVIDINMCKVL
JGI24669J20092_101731271	3300001744	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIHINMCKVL
JGI24672J20091_100180373	3300001746	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILISVNVIDINMCKVLILV*
JGI24672J20091_100506281	3300001746	Marine Gutless Worms Symbiont	LNINFEPPTFCCVLFVSSILVSVNVIDINMCKVLILCEMC
JGI24672J20091_100733701	3300001746	Marine Gutless Worms Symbiont	MVDILNINFEFLTFHCVLFVSSILVSVNVIDINLRKVLILSEMCYFCV*
JGI24672J20091_101010271	3300001746	Marine Gutless Worms Symbiont	NFEPLTFCCVLFVSSILISVNVIDINMSTVLILV*
JGI24672J20091_101034222	3300001746	Marine Gutless Worms Symbiont	MVDILNINFEPLAFCYVLFVSSILVALNVIDINMCKVLILG*
JGI24672J20091_101103891	3300001746	Marine Gutless Worms Symbiont	MHVFALMVDILNINFEPLTFLCVLFASLILVALNVIDINMCKVLILCEMCYFCFRDFHTVW*
JGI24672J20091_101368541	3300001746	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILVXNVLLL
JGI24672J20091_101384732	3300001746	Marine Gutless Worms Symbiont	DILNIHFEPLTFCCVLFVSSILVSVNVIDINMCKVLILV*
JGI24672J20091_101473851	3300001746	Marine Gutless Worms Symbiont	LIVDILNINFEPLTFCCVSSILVALNVIDINMCKVLIL
JGI24672J20091_101673031	3300001746	Marine Gutless Worms Symbiont	MNINFEPLTFCYVLFVSSILVPLNVIDINMCKVLIIV*
JGI24672J20091_101678161	3300001746	Marine Gutless Worms Symbiont	MVDILNINFDPLTFCCVLLVSSILVAIYVIDINMCKVLILCEIRYFCV*
JGI24670J26820_111794351	3300002181	Marine Gutless Worms Symbiont	MVDILNINFEPLTFYCVLFVSSILVSVNVIDINMCKVLILV*
JGI24670J26820_112247391	3300002181	Marine Gutless Worms Symbiont	MVDILNINFYPVTFCCVLFVSSILVSVNVIDINMCKVLILV
JGI24670J26820_113205771	3300002181	Marine Gutless Worms Symbiont	MVDIFNINFEPLTFCSVLLVSSILVPLNVIDINMCKVLILCEMFCFCV*
JGI24670J26820_113252142	3300002181	Marine Gutless Worms Symbiont	MVDILNINFEPLIFCCVLFVLSILVFVNVIDINMCKVLILCEMCYFCVRDFHTVW*
JGI24670J26820_113419521	3300002181	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEMCYF
JGI24670J26820_113563151	3300002181	Marine Gutless Worms Symbiont	MVDILNTNFEPQTFCCVLFVSSILVSINVIDINMCKVLILC
JGI24670J26820_114753121	3300002181	Marine Gutless Worms Symbiont	MVDILNIYFEPLTLCFLFVSSILVSVNVIDINMCKVLILCEMCYF
JGI24670J26820_114836841	3300002181	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVSSILVSVNVIYINMCKVLILM*
JGI24670J26820_114950001	3300002181	Marine Gutless Worms Symbiont	LNINFEPPTFCCVLFVSSILVSVNVIDINMCKVLILC
JGI24670J26820_115959251	3300002181	Marine Gutless Worms Symbiont	MVDILKINFEPLTFCCVLLVSSILVALNVIDINMCKVLILCEMCYFCV*
JGI24670J26820_116005803	3300002181	Marine Gutless Worms Symbiont	EPLTFCCVLFVSSILVALNVIDINMCKVLIVCEMCYFCV*
JGI24670J26820_116127484	3300002181	Marine Gutless Worms Symbiont	MVDILNINFKPLASCCVLFVSSILVPVNVIDINMCKVLILCEM
JGI24670J26820_116238674	3300002181	Marine Gutless Worms Symbiont	MVDILNINYEPLTFCCVLFVSSILVSVNVVMDMNMCKVLILCEMCYF
JGI24670J26820_116285544	3300002181	Marine Gutless Worms Symbiont	MVDIFNINFEPMTFCCVLFVSSILVSVNVIDINMCTVLILCEMCYFCI*
JGI24670J26820_116350855	3300002181	Marine Gutless Worms Symbiont	VDILNINFEPLTFCCVLFVSSILVSVNVIDINICKVLILV*
Ga0056138_10060154	3300003801	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILIPLNVIDINMCKVPILYEMCYFCVGHFHTVW*
Ga0049113_100497391	3300003853	Marine Gutless Worms Symbiont	MVDILNINFVPMTFWHVLFILSILVSVNVIIINTHKVLMLREIC*
JGI26667J51740_102030272	3300003906	Marine Gutless Worms Symbiont	MVDVLNINFDPVTFWCILCVLPTLEFVNLIDTNMCKVLILCEMFYFCEIFM*
Ga0066190_101119781	3300004087	Marine Gutless Worms Symbiont	LNINFEPVTIRCVFFVSLILIGTNLIDINICKVLIQREVK
Ga0066190_101356941	3300004087	Marine Gutless Worms Symbiont	VFACVVDNLYINFERVTFWCVLFVLSILVSVNVIDINVCKVLILREMCYFCVREFYTIRCM*
Ga0066190_103165181	3300004087	Marine Gutless Worms Symbiont	MVDILNINFEPMTFWRVLFVLSILVSVNLMDIIMCKVPMWHEMCYFCVYNVYT
Ga0065184_102082412	3300004098	Marine Gutless Worms Symbiont	MVGILNINFKPLAFCCVLFVSSILVFVNVIDINVCKVLILCEMC*
Ga0065184_103197031	3300004098	Marine Gutless Worms Symbiont	INFEPLTFCCVLFVSLILVPLDVININMCKVLILCELRYFCV*
Ga0065185_101227373	3300004122	Marine Gutless Worms Symbiont	MGDILNINFEPATFCCVLFVSLILVCVNLTDINMCKVLILCEMCYFCV
Ga0065185_101674771	3300004122	Marine Gutless Worms Symbiont	MVDIMNINFEPVTFCCLSFVSSILVSVNVIDINMCKVLILCEMCYFCVRHFHAV*
Ga0065185_102431111	3300004122	Marine Gutless Worms Symbiont	MQVFSLIVDILNINFEPLTFCCVLFVSSILVALNVIDINMCKVLIL
Ga0049105_10047284	3300004630	Marine Gutless Worms Symbiont	MQMVDILDIEFKPMTFCCILFILFILVSVNLISIHMCKVPILCEMCYF*
Ga0209791_12747321	3300027540	Marine Gutless Worms Symbiont	MVDILNINFKHLTFCCVLFVSSILVFVNVIDINMCKVLILV
Ga0209791_13465311	3300027540	Marine Gutless Worms Symbiont	LNINFDPLTFCYVLFVSSILVSVNVMDINMCKVLY
Ga0209791_13574321	3300027540	Marine Gutless Worms Symbiont	LNINFEPPTFCCVLFVSSILVSVNVIDINMCKVLI
Ga0209338_10042422	3300027551	Marine Gutless Worms Symbiont	MVDILNTNFEPQTFCCVLFVSSILVSINVIDINMCKVLILCEMCYFCV
Ga0209338_10209701	3300027551	Marine Gutless Worms Symbiont	FEIHFKSLTFCCVLFVSSILVSVNVIDINMCKVLILV
Ga0209338_10522231	3300027551	Marine Gutless Worms Symbiont	NFEPLTFCCVLFVLSILAAINVIDINMCKVLILCEMCYFCV
Ga0209338_11513431	3300027551	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVPHAIDINMCKVLILCEMCYFCVGDFNMVW
Ga0209338_12268711	3300027551	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINVCKVLILCEMCDFCV
Ga0209338_13074941	3300027551	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDTCINMCKVLILV
Ga0209338_13141461	3300027551	Marine Gutless Worms Symbiont	LNIRFEPLTFCCVLFVSSILVALNVIDINMCKVLIL
Ga0209338_13796831	3300027551	Marine Gutless Worms Symbiont	MVDILNINFETLTFCCVLFVSSILVSVNVIDINMCKVLILV
Ga0209338_13826281	3300027551	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLLLCEMCYFCV
Ga0209743_10204183	3300027556	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILV
Ga0209743_11975581	3300027556	Marine Gutless Worms Symbiont	MNINFEPLTFCYVLFVSSILVPLNVIDINMCKVLIIV
Ga0209743_12153421	3300027556	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVFVNVIDIKMCKVLILV
Ga0209743_12281222	3300027556	Marine Gutless Worms Symbiont	LNINFEPLTVCCVLFVSLILINANVFDINMCKVLI
Ga0209743_12559432	3300027556	Marine Gutless Worms Symbiont	ILNINFEPLTFCCVLFVSSILVAINVIDIDMCKVLILCEMYYFCV
Ga0209428_10526111	3300027564	Marine Gutless Worms Symbiont	INFEPLTFCCVLFVSSILVSVNVIDINMCKVLILV
Ga0209428_10616831	3300027564	Marine Gutless Worms Symbiont	VVDKILDILNINFEPLTFCCVLFVSSILVALTVIDINMCKV
Ga0209428_11654781	3300027564	Marine Gutless Worms Symbiont	NFEPLTFCCVSFVSSILVALNVIDINTCKVLILCEMCYFCV
Ga0209428_12012271	3300027564	Marine Gutless Worms Symbiont	MVDIFNINFEPLTFCSVLLVSSILVPLNVIDINMCKVLI
Ga0209428_12494231	3300027564	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLIFV
Ga0209428_13103222	3300027564	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVTSILVSVNVIDINMCKVLILCE
Ga0209428_13142361	3300027564	Marine Gutless Worms Symbiont	MVDILNINFDPLTFCCVLFVSSILVFVNVIDINMCKVLILV
Ga0209428_13807451	3300027564	Marine Gutless Worms Symbiont	LKINFEPLTFCCVLFVSSILVALNVIDINMCKVLILCEMCYFCV
Ga0209637_10155154	3300027584	Marine Gutless Worms Symbiont	MMDILKINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCDFCVLTLSHGIVAT
Ga0209637_10938451	3300027584	Marine Gutless Worms Symbiont	MVYILNINFEPLTFCCVLFVSSILVSVNVIGINMCKVLILV
Ga0209637_11187961	3300027584	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVALNVIDINMYKVLILV
Ga0209637_11420381	3300027584	Marine Gutless Worms Symbiont	MVDILKINFEPLTFCCVLFVSSILVALNAIDINMCKVLLLV
Ga0209637_11512341	3300027584	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCSVLFVSSILVALNVIDINMCKVLISV
Ga0209637_11699612	3300027584	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCIMFVSSILVSVNVIDINMCKVLILV
Ga0209637_11972301	3300027584	Marine Gutless Worms Symbiont	MMDILNINFKPLTFCYVLFVSSILVPLNVIDINMCKVLILCEVCYFCVWDFHTVW
Ga0209637_12036721	3300027584	Marine Gutless Worms Symbiont	CCVLFVSSIGLLVPLNVIDIGLGLNMCKVLILCEMCYFCV
Ga0209637_12854532	3300027584	Marine Gutless Worms Symbiont	FEPLTFCCVLFVSLILVRLNVIDRPINMCKVQILYEMCYFCV
Ga0209637_13443881	3300027584	Marine Gutless Worms Symbiont	FCCVLFVLSILVALNVIDINMCKVLILCEMCYFCVLDFHTVW
Ga0209150_10570681	3300027585	Marine Gutless Worms Symbiont	MVDIFNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILC
Ga0209150_11358422	3300027585	Marine Gutless Worms Symbiont	NYEPLTFCCVLFVSSILVSVNVVMDMNMCKVLILCEMCYFWV
Ga0209150_12474151	3300027585	Marine Gutless Worms Symbiont	LNTNFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEMC
Ga0209150_13210311	3300027585	Marine Gutless Worms Symbiont	LKINFEPLTSCCVLFVSSILVALNAIDINMWKVLILCEM
Ga0209150_13522362	3300027585	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLISV
Ga0209122_10354073	3300027613	Marine Gutless Worms Symbiont	NINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEICYFCI
Ga0209122_10608591	3300027613	Marine Gutless Worms Symbiont	IVNINFEPLTFCCVLFVSAILVSVNVIDINMCKVLILL
Ga0209122_10648071	3300027613	Marine Gutless Worms Symbiont	MVDILNINFEPLAFCYVLFVSSILVALNVIDINMCKVLILG
Ga0209122_10804231	3300027613	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIEITCAKC
Ga0209122_10967301	3300027613	Marine Gutless Worms Symbiont	MVDIFNINFEPLTFCCVLFVSSILVSVNVIDINVYKVLCA
Ga0209122_12739011	3300027613	Marine Gutless Worms Symbiont	LNINFKPLAFCCVLFVSSILVFVNVIDINVCKVLILCEMC
Ga0209122_12788152	3300027613	Marine Gutless Worms Symbiont	MVDILSVNFEPLTFCCVLFVSSILVSVNVIDINMCKVLMLV
Ga0209122_13717082	3300027613	Marine Gutless Worms Symbiont	MHVFVRIVDILNINFEPLAFCCVLFVLSILVVINVIDVNMCKVLILCEMC
Ga0209122_13780641	3300027613	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSINVIDINMCKVLILV
Ga0209260_101185511	3300027620	Marine Gutless Worms Symbiont	MVDILNINFETLTFCCVLFVSPIPVLVPVNVIDINMCKVLM
Ga0209260_102187091	3300027620	Marine Gutless Worms Symbiont	NINFEPLTLCCVSFVSSILVSVNVIDINMCKVLILCEMCYFCV
Ga0209260_102931201	3300027620	Marine Gutless Worms Symbiont	MVDIVNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILV
Ga0209260_102943741	3300027620	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCSVLFVSSILVALNVIDINMCKVLILV
Ga0209260_103485251	3300027620	Marine Gutless Worms Symbiont	LNINFEPLTICCVLFVSLILVPLNVIAINMCKVLI
Ga0209149_10134225	3300027626	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCILFVSSILVSVNVIDINMCKVLILV
Ga0209149_10376261	3300027626	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSPILVALNVIDINMCKVLILCEMCRP
Ga0209149_11598791	3300027626	Marine Gutless Worms Symbiont	LKINFEPLTFCCVLFVSSILVDLNAIDINMCKVLILCEMCY
Ga0209149_11826721	3300027626	Marine Gutless Worms Symbiont	INFEPLTFCCVLFVSSILVSVNVIDINMCKVLILCEMCYFCVGHFHTV
Ga0209149_11889601	3300027626	Marine Gutless Worms Symbiont	MMDILNINIEPLTFCCVLFVSSILVALNVIDITIFKVLIL
Ga0209149_12578892	3300027626	Marine Gutless Worms Symbiont	LNINFEPLTFCCVLFVSSILVALNVIDINMYKVLIL
Ga0209149_12763661	3300027626	Marine Gutless Worms Symbiont	DILNISFEPLTFCCVLFVSSILVALNVIDINTCKVLILCEMCYFCV
Ga0209149_13076181	3300027626	Marine Gutless Worms Symbiont	LKINFEPRTFCSVLFVSSILVALNVIDINMCKVLILC
Ga0209149_13174081	3300027626	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVFVNVIDINMCKVLILV
Ga0209339_10334994	3300027632	Marine Gutless Worms Symbiont	RSDVVVRMHVFALMVDILNINFEPLTFLCVLFASLILVALNVIDINMCKVLILCEMCYFCFRDFHTVW
Ga0209339_11183602	3300027632	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLFVSSILVSVNVIDINMCKVLILV
Ga0209339_11616521	3300027632	Marine Gutless Worms Symbiont	LKINFEPLTFCCVLFVSSILVALNAIDINMCKVLIL
Ga0209339_11841302	3300027632	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCDLFVSSILASVNVIDINMCKVLILV
Ga0209339_12796041	3300027632	Marine Gutless Worms Symbiont	VDILKINFEPLTFCCVLFVSSILVALNEIDINMCKVLILV
Ga0209339_13323961	3300027632	Marine Gutless Worms Symbiont	NIKFEPLAFCCVLFVSSILVALNVIDINMCKVLILCEMCYICV
Ga0209339_13388291	3300027632	Marine Gutless Worms Symbiont	MVDILNINFEPLTFCCVLIVSSILVSVNVIDINMCKVLLV

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F043134

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001734	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1	Host-Associated	Open in IMG/M
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated	Open in IMG/M
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated	Open in IMG/M
3300001744	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2	Host-Associated	Open in IMG/M
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated	Open in IMG/M
3300002181	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3	Host-Associated	Open in IMG/M
3300003801	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1	Host-Associated	Open in IMG/M
3300003853	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.1	Host-Associated	Open in IMG/M
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated	Open in IMG/M
3300004087	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.1 (version 2)	Host-Associated	Open in IMG/M
3300004098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2)	Host-Associated	Open in IMG/M
3300004122	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2)	Host-Associated	Open in IMG/M
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated	Open in IMG/M
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated	Open in IMG/M
3300027556	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes)	Host-Associated	Open in IMG/M
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated	Open in IMG/M
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated	Open in IMG/M
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated	Open in IMG/M
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated	Open in IMG/M
3300027620	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes)	Host-Associated	Open in IMG/M
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign