Basic Information | |
---|---|
Family ID | F043065 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 157 |
Average Sequence Length | 44 residues |
Representative Sequence | DTHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSTLR |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 157 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.09 % |
% of genes from short scaffolds (< 2000 bps) | 89.81 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.726 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.478 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.478 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.408 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.49% β-sheet: 11.27% Coil/Unstructured: 73.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 157 Family Scaffolds |
---|---|---|
PF00664 | ABC_membrane | 66.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.73 % |
Unclassified | root | N/A | 1.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E01EP0ON | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300000789|JGI1027J11758_12101436 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300000789|JGI1027J11758_12472451 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300001661|JGI12053J15887_10284258 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300002886|JGI25612J43240_1050558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300002914|JGI25617J43924_10063070 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300004139|Ga0058897_10941234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300004479|Ga0062595_102325527 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005174|Ga0066680_10675940 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005175|Ga0066673_10536960 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005177|Ga0066690_10161466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1477 | Open in IMG/M |
3300005186|Ga0066676_10494604 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300005439|Ga0070711_101582163 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005445|Ga0070708_100269885 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300005445|Ga0070708_101931204 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005536|Ga0070697_100127818 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
3300005555|Ga0066692_10662501 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300005566|Ga0066693_10272889 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300005569|Ga0066705_10137039 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300005586|Ga0066691_10360972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300005591|Ga0070761_10281522 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300006028|Ga0070717_11584477 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006046|Ga0066652_101695187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300006047|Ga0075024_100593653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300006047|Ga0075024_100842111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300006050|Ga0075028_100077878 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300006057|Ga0075026_100894095 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006102|Ga0075015_100431547 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300006172|Ga0075018_10110275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
3300006173|Ga0070716_100045824 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
3300006173|Ga0070716_101293166 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300006175|Ga0070712_102034076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300006794|Ga0066658_10897011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300006796|Ga0066665_10612645 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300006804|Ga0079221_10564659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 757 | Open in IMG/M |
3300007255|Ga0099791_10298900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300007258|Ga0099793_10262421 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300007265|Ga0099794_10155772 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300009012|Ga0066710_103201455 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300009088|Ga0099830_10048190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2993 | Open in IMG/M |
3300009088|Ga0099830_10254708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1390 | Open in IMG/M |
3300009088|Ga0099830_10672825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
3300009089|Ga0099828_10430746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300009089|Ga0099828_11265622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300009143|Ga0099792_10193202 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300010046|Ga0126384_12375837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300010047|Ga0126382_11619398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 601 | Open in IMG/M |
3300010320|Ga0134109_10073838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
3300010321|Ga0134067_10014375 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
3300010322|Ga0134084_10458253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 509 | Open in IMG/M |
3300010326|Ga0134065_10094098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300010358|Ga0126370_10140979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1742 | Open in IMG/M |
3300010358|Ga0126370_10256046 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300010358|Ga0126370_11989503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 568 | Open in IMG/M |
3300010358|Ga0126370_12257046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 538 | Open in IMG/M |
3300010359|Ga0126376_10113187 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
3300010360|Ga0126372_10622984 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300010360|Ga0126372_10896125 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300010360|Ga0126372_12605669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 557 | Open in IMG/M |
3300010361|Ga0126378_10580601 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300011120|Ga0150983_16700437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
3300011270|Ga0137391_10960883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300012096|Ga0137389_10981666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
3300012096|Ga0137389_11471002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300012096|Ga0137389_11747429 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300012189|Ga0137388_10392605 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300012189|Ga0137388_11070727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300012205|Ga0137362_10124272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2190 | Open in IMG/M |
3300012209|Ga0137379_11676636 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012210|Ga0137378_10341835 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300012349|Ga0137387_10040130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3070 | Open in IMG/M |
3300012357|Ga0137384_11359912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 558 | Open in IMG/M |
3300012361|Ga0137360_10204762 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300012361|Ga0137360_11090816 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012519|Ga0157352_1070057 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012582|Ga0137358_10130038 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300012918|Ga0137396_11168867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300012924|Ga0137413_11577515 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012976|Ga0134076_10083258 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300014150|Ga0134081_10236214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 634 | Open in IMG/M |
3300014166|Ga0134079_10319383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 696 | Open in IMG/M |
3300015054|Ga0137420_1075949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300015054|Ga0137420_1092689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300015054|Ga0137420_1106150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300015242|Ga0137412_10239467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
3300015242|Ga0137412_10697076 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300015372|Ga0132256_101291032 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300015374|Ga0132255_100589044 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
3300016357|Ga0182032_11384649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 609 | Open in IMG/M |
3300016404|Ga0182037_10247744 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300018058|Ga0187766_11436110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 507 | Open in IMG/M |
3300018433|Ga0066667_11121288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300018433|Ga0066667_12031182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300020199|Ga0179592_10510341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300020581|Ga0210399_10515974 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300021088|Ga0210404_10481594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300021168|Ga0210406_10829095 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300021170|Ga0210400_10793538 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300021181|Ga0210388_10261163 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
3300021420|Ga0210394_10582837 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300021559|Ga0210409_10837428 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300024227|Ga0228598_1117177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300024249|Ga0247676_1063555 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300025915|Ga0207693_11423265 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300025928|Ga0207700_11469325 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025939|Ga0207665_10012732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5531 | Open in IMG/M |
3300026277|Ga0209350_1117908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300026277|Ga0209350_1124837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300026285|Ga0209438_1003771 | All Organisms → cellular organisms → Bacteria | 5140 | Open in IMG/M |
3300026296|Ga0209235_1285605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300026301|Ga0209238_1266429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300026316|Ga0209155_1234246 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300026319|Ga0209647_1297190 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300026323|Ga0209472_1030891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2450 | Open in IMG/M |
3300026330|Ga0209473_1068721 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300026548|Ga0209161_10320430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 721 | Open in IMG/M |
3300026551|Ga0209648_10504888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300026557|Ga0179587_10182429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
3300027030|Ga0208240_1035724 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300027069|Ga0208859_1046280 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300027376|Ga0209004_1068228 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300027565|Ga0209219_1176970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300027643|Ga0209076_1146995 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300027651|Ga0209217_1117081 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300027684|Ga0209626_1183664 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300027783|Ga0209448_10085994 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300027835|Ga0209515_10278115 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300027842|Ga0209580_10460261 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300027875|Ga0209283_10058902 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
3300027875|Ga0209283_10119299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
3300027882|Ga0209590_10501822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300027903|Ga0209488_10422918 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300028536|Ga0137415_11063797 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300031057|Ga0170834_113102227 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031231|Ga0170824_119965977 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300031474|Ga0170818_103403059 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300031564|Ga0318573_10795309 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300031715|Ga0307476_10668258 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300031718|Ga0307474_11124014 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300031754|Ga0307475_10053838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3030 | Open in IMG/M |
3300031754|Ga0307475_10843574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
3300031820|Ga0307473_10785145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
3300031823|Ga0307478_10920337 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300031912|Ga0306921_10052107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4649 | Open in IMG/M |
3300031912|Ga0306921_11865650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 644 | Open in IMG/M |
3300032180|Ga0307471_100171625 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
3300032180|Ga0307471_101145420 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300032180|Ga0307471_102210690 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300032180|Ga0307471_102750955 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300032180|Ga0307471_103319591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300032180|Ga0307471_104348811 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300033180|Ga0307510_10452265 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300033290|Ga0318519_10853091 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300033486|Ga0316624_11254883 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300034125|Ga0370484_0047658 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.64% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.01% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.37% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.46% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.27% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.64% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.64% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.64% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.64% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.64% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.64% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.64% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.64% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.64% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.64% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_06477530 | 2189573000 | Grass Soil | GVRWNPKTKRYQSLDRTYEQFLLESPTLSNARSQLK |
JGI1027J11758_121014361 | 3300000789 | Soil | VKGMDDKHVLPIAVRWNPKTQRYQSLDRTYEHFLSESPALSNTRSLLK* |
JGI1027J11758_124724512 | 3300000789 | Soil | VKGMDDRHVLPIGVRWNAKTKRYQSLDRTYEQFLTESPTLSNARSQLR* |
JGI12053J15887_102842581 | 3300001661 | Forest Soil | IGIRWNSDTKRYQSLDRSYEHFLTEAASLSTAHSNLR* |
JGI25612J43240_10505581 | 3300002886 | Grasslands Soil | TDSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDPRSTLR* |
JGI25617J43924_100630702 | 3300002914 | Grasslands Soil | SQIKGLELYFTPLKGTTDSHVSPIGVRWNSQTKRYQSLDRTYEHFLVESPSIQDARSTLR |
Ga0058897_109412342 | 3300004139 | Forest Soil | HVLPIGIRFNPATKRYQSLDRTYEHFLLESPSLQDLRSTLR* |
Ga0062595_1023255272 | 3300004479 | Soil | THVLPVGVRWNPQTKRYQSLDPSYEHFLKESAALDNVRSRLQ* |
Ga0066680_106759401 | 3300005174 | Soil | PLKGTTDSHTLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSVLR* |
Ga0066673_105369601 | 3300005175 | Soil | TLYLTPVKGMDDKHVLPIAVRWNPKTKRYQSLDRSYEQFLGESPSLSTQRSQLR* |
Ga0066690_101614662 | 3300005177 | Soil | HNLPIGVRWNPQTKRYQSLDRAYEHFLLESPSIQDARSVLR* |
Ga0066676_104946042 | 3300005186 | Soil | KGMDDRHVLPIGVRWNEKTKRYQSLDRTYEQFLMESPTLSNTRSQLR* |
Ga0070711_1015821631 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DTHTLPIGIRWNSKTKRYQSLDRSYENFLNESPALSTARSNLR* |
Ga0070708_1002698851 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AVDTHSLPIGIRWNPDTKRYQSLDRSYEHFLNEAASLSAAHSNLR* |
Ga0070708_1019312042 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LYFTPLKGATDSHVLPIGVRWNKQTQRYQSLDRTYEHFLLENPTIQDARSSLR* |
Ga0070697_1001278181 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HVLPIGVRWNEKTKRYQSLDRTYEQFLMESPTLSNTRSQLK* |
Ga0066692_106625012 | 3300005555 | Soil | LPIGIRFNPDTKRYQSLDRSYEHFLNEAASLSTAHSSLR* |
Ga0066693_102728891 | 3300005566 | Soil | VRWNPQTKRYQSLDRAYEHFLLESPSIQDARSVLR* |
Ga0066705_101370391 | 3300005569 | Soil | LTPVKGLDDKHILPIAVRWNPQTKRYQSLDRTYEHFLNESPSLSNATRSQLK* |
Ga0066691_103609721 | 3300005586 | Soil | DSHNLPIGVRWNPQTKRYQSLDRAYEHFLLESPSIQDARSVLR* |
Ga0070761_102815221 | 3300005591 | Soil | TPIRADGDKHVLPIGVAWNPATKRYQSLDLTYEHFLTETPSLETAKSRLR* |
Ga0070717_115844771 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DTHTLPIGIRWNTETKRYQSLDRSYEHFLNEAPSLGTARSSLR* |
Ga0066652_1016951872 | 3300006046 | Soil | PIGVRWNPATKRYQSLERTYEHFLLESPSMQDARSTLR* |
Ga0075024_1005936531 | 3300006047 | Watersheds | LKGTSDSHVLPIGVRWNPETQRYQSLDRTYEHFLLEAPSMQDARSSLR* |
Ga0075024_1008421111 | 3300006047 | Watersheds | AEHALPIGVRWNPATKRYQSLDRSYEKFLKEASSLENARSTLR* |
Ga0075028_1000778781 | 3300006050 | Watersheds | TDSHVLPIGVRWNPETKRYQSLDRNYEHFLLESPSIQDARSVLR* |
Ga0075026_1008940952 | 3300006057 | Watersheds | LYFTPLKGAIDSHVLPIGVWWNPATKRYQSLDRTYEHFLLESPSMQDARSILR* |
Ga0075015_1004315471 | 3300006102 | Watersheds | HTCDPATKRYQSLDRTYEHFLLEAPSLERARSMLR* |
Ga0075018_101102751 | 3300006172 | Watersheds | PLKGTTDSHVLPIGVRWNPETKRYQSLDRTYEHFLLESPTIQDARSVLR* |
Ga0070716_1000458241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TLYLTPVKGMDDRHVLPIGVRWNEKTKRYQSLDRTYEQFLLESPTLSKTRSQLK* |
Ga0070716_1012931662 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RFNPERKRYQSLDRSYEHFLNESASLSTAHSNLR* |
Ga0070712_1020340762 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RWNPQVKRYQTLDRTYEHFLNEAPTLGGTPKSTLR* |
Ga0066658_108970112 | 3300006794 | Soil | PIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSTLR* |
Ga0066665_106126451 | 3300006796 | Soil | FTPLKGTTDSHVLPIGVRWNSQTKRYQSLDRTYEHFLLESPSIQDARSVLR* |
Ga0079221_105646591 | 3300006804 | Agricultural Soil | VLPIGVRWNPQTKRYQSLDRTYEHFLLESATIETARSRLR* |
Ga0099791_102989001 | 3300007255 | Vadose Zone Soil | PLQGTTDSHVLPIGVRWNPATKRYQSLDRTYEHFLLEAPALNDVRSRLR* |
Ga0099793_102624212 | 3300007258 | Vadose Zone Soil | GIRWNPETKRYQSLDRSYEHFLNEAPSLSTARSNLR* |
Ga0099794_101557721 | 3300007265 | Vadose Zone Soil | HTLPIGIRWNADTKRYQSLDRSYEHFLIEAASLSTAHSNLR* |
Ga0066710_1032014551 | 3300009012 | Grasslands Soil | GVRWNPQTKRYQSLDRAYEHFLLESPSIQDARSVLR |
Ga0099830_100481901 | 3300009088 | Vadose Zone Soil | DSHVLPIGVRWNPETKRYQSLDRTYEHFLLESPSMHDARSTLR* |
Ga0099830_102547081 | 3300009088 | Vadose Zone Soil | PIGVRWNPATRRYQSLDRTYEHFLLESPSMQDARSTLR* |
Ga0099830_106728251 | 3300009088 | Vadose Zone Soil | PIGVRFNPATKRYQSLDRTYEHFLLESPSMQDARSTLR* |
Ga0099828_104307462 | 3300009089 | Vadose Zone Soil | VRWNPATKRYQSLDRTYEHFLLESPTMQDARSTLR* |
Ga0099828_112656222 | 3300009089 | Vadose Zone Soil | RWNPATKRYQSLDRTYEHFLLESPTMQDARSTLR* |
Ga0099792_101932022 | 3300009143 | Vadose Zone Soil | ALYFTPLKGAVDTHTLPIGIRWNPQTKRYQSLDRSSEHFLTESPTLNTARSSLR* |
Ga0126384_123758371 | 3300010046 | Tropical Forest Soil | THSLPIGIRWNPQVKRYQSLDRSYEHFLNEAPSLSTARSTLR* |
Ga0126382_116193982 | 3300010047 | Tropical Forest Soil | TDSHVLPIGVRWNPQTKRYQSLDRTYEHFLLESPSIETARSKLR* |
Ga0134109_100738381 | 3300010320 | Grasslands Soil | NLPIGVRWNPQTKRYQSLDRAYEHFLLESPSIQDARSVLR* |
Ga0134067_100143753 | 3300010321 | Grasslands Soil | LYFTPLKGITDSHPQTIGVRWNSATKRYQSLDRNYEHFLLESPSIGTARSTLR* |
Ga0134084_104582531 | 3300010322 | Grasslands Soil | PLKGVTDSHVLPIGVRWNPGTKRYQSLDRTYEHFLLESPSLDTARSSLR* |
Ga0134065_100940981 | 3300010326 | Grasslands Soil | GTTDSHNLPIGVRWNPQTKRYQSLDRAYEHFLLESPSIQDARSVLR* |
Ga0126370_101409791 | 3300010358 | Tropical Forest Soil | RWNPQTKRYQSLDRAYEHFLLESASIEPARSKLR* |
Ga0126370_102560461 | 3300010358 | Tropical Forest Soil | LKGVTDSHVLPIGVRWNPKTQRYQSLDRTYEHFLLESPSIENARSKLR* |
Ga0126370_119895031 | 3300010358 | Tropical Forest Soil | IDTHVQPIGVRWNPKTQRYQSLDPSYEQFLLEAPTLEAPRSNIR* |
Ga0126370_122570461 | 3300010358 | Tropical Forest Soil | LKGVTDSHVLPIGVRWNPKTQRYQSLDRSYENFLLESPTIDTPRSNVR* |
Ga0126376_101131871 | 3300010359 | Tropical Forest Soil | KGISDSHVLPIAVQWNPKTKRYQSLDRSYQQFLLESPALSHVRTRLQ* |
Ga0126372_106229841 | 3300010360 | Tropical Forest Soil | DQHVLPIGVRWNPKAKRYQSLDRTYEHFLSESPALSTMRSQLK* |
Ga0126372_108961252 | 3300010360 | Tropical Forest Soil | GVRWNPKTQRYQSLDRSYENFLLESPTIDTPRSNVR* |
Ga0126372_126056692 | 3300010360 | Tropical Forest Soil | KGVTDSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSIETARSKLR* |
Ga0126378_105806012 | 3300010361 | Tropical Forest Soil | LKGVTDSHVLPIGVRWNPGTKRYQSLDRTYEHFLLESPSLDTARSSLR* |
Ga0150983_167004371 | 3300011120 | Forest Soil | DSHVLPIGVRWNPDTKRYQSLDRTYEHFLLESPSIQDARSVLR* |
Ga0137391_109608832 | 3300011270 | Vadose Zone Soil | TPLKGVTDSYVLPIAVQWNLATKRYQSLDRNYEHFLLESPSLQDARSTLR* |
Ga0137389_109816662 | 3300012096 | Vadose Zone Soil | VRWNSATKRYQSLDRTYEHFLLESPALNDVRSRLR* |
Ga0137389_114710021 | 3300012096 | Vadose Zone Soil | IGVRFNPATKRYQSLDRTYEHFLLESPSMQDARSTLR* |
Ga0137389_117474292 | 3300012096 | Vadose Zone Soil | QPTRGSHVSPIGVRWNPATKRYQSLDRTFQDFLFEVPALEKIPSHLK* |
Ga0137388_103926051 | 3300012189 | Vadose Zone Soil | TDSHVLPIGVRWNPATKRYQSLDRTYEHFLLEATSLEDARSRLR* |
Ga0137388_110707271 | 3300012189 | Vadose Zone Soil | GTTDSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPTMQDARSTLR* |
Ga0137362_101242721 | 3300012205 | Vadose Zone Soil | IKGLELYFTPLKGTTDSHVLPIGVRWNSQTKRYQSLDRTYEHFLPESPSIQDARSVLR* |
Ga0137379_116766362 | 3300012209 | Vadose Zone Soil | QLYFTPLKGATDSHVLPIGVRWNKQTKRYQSLDRAYEHFLLENPTIQDARSSLR* |
Ga0137378_103418352 | 3300012210 | Vadose Zone Soil | KGITDSHVLPIGVRWNSATKRYQSLDRTYEHFLLESPTLEAARSSLR* |
Ga0137387_100401303 | 3300012349 | Vadose Zone Soil | VRWNPATKRYQSLDRTYEHFLLEATSLEDARSRLR* |
Ga0137384_113599122 | 3300012357 | Vadose Zone Soil | RWNPATKRYQSLDRTYEHFLLEAPSIEAARSTVR* |
Ga0137360_102047622 | 3300012361 | Vadose Zone Soil | DTHTLPIGVRWNPNTKRYQSLDRSYENFLNEAPSLSTARSSLQ* |
Ga0137360_110908162 | 3300012361 | Vadose Zone Soil | LTAVKGMDDRHVLPIGVRWNPKTKRYQSLDRTYEQFLGESPTLTTLRSQLK* |
Ga0157352_10700572 | 3300012519 | Unplanted Soil | MPDAHVLPIGVQWNPKTKRYQSLDRSYQQFLMESPALSNVRTRLQ* |
Ga0137358_101300382 | 3300012582 | Vadose Zone Soil | TPLKGTTDSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDPRSTLR* |
Ga0137396_111688672 | 3300012918 | Vadose Zone Soil | PIGVRWNLATKRYQSLDRTYEHFLLESPALNDVRSRLR* |
Ga0137413_115775152 | 3300012924 | Vadose Zone Soil | GVRWNPDTKRYQSLDRTYEHFLLESPSLQDARSVLR* |
Ga0134076_100832581 | 3300012976 | Grasslands Soil | GATDSHVLPIGVRWNPATKRYQSLDRTYEHFLLEAGSLEDARSRLR* |
Ga0134081_102362141 | 3300014150 | Grasslands Soil | ITDSHPQTIGVRWNSATKRYQSLDRNYEHFLLESPSIGTARSTLR* |
Ga0134079_103193831 | 3300014166 | Grasslands Soil | IGVRWNSATKRYQSLDRTYEHFLLEAPSIEAARSSLR* |
Ga0137420_10759492 | 3300015054 | Vadose Zone Soil | IDTHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSTLR* |
Ga0137420_10926891 | 3300015054 | Vadose Zone Soil | GVRWNPATKRYQSLDRTYEHFLLESPSMQQDPRSTLR* |
Ga0137420_11061501 | 3300015054 | Vadose Zone Soil | LPIGIRWNADTKRYQSLDRSYEHFLNEAASLSTAHSNLR* |
Ga0137412_102394671 | 3300015242 | Vadose Zone Soil | TTDSHVLPIGVRWNSQTKRYQSLDRTYEHFLPESPSIQDARSVLR* |
Ga0137412_106970762 | 3300015242 | Vadose Zone Soil | TPLKGTTDSHVLPVGVRWNPDTKRYQSLDRTYEHFLLESPSLQDARSVLR* |
Ga0132256_1012910321 | 3300015372 | Arabidopsis Rhizosphere | GMPDAHVLPIGVQWNPKTKRYQSLDRSYQQFLAESPALSNARSRLQ* |
Ga0132255_1005890442 | 3300015374 | Arabidopsis Rhizosphere | HVLPIGVQWNPKTKRYQSLDRSYQQFLAESPALSNARSRLQ* |
Ga0182032_113846491 | 3300016357 | Soil | VRWNPATKRYQSLDRTYEHFLPESPALDTARSTLR |
Ga0182037_102477442 | 3300016404 | Soil | HVLPIAVRWNPKTKRYQSLDRSYQQFLVESPSLSNARSRLR |
Ga0187766_114361101 | 3300018058 | Tropical Peatland | PLKGSTDSHVLPIGVRYNPATKRYQSLDRNYEQFLIESPSIQDARSALR |
Ga0066667_111212881 | 3300018433 | Grasslands Soil | KDENGLELYFTPLNGGIDTHVLPIRVRWTTATKRYPSLDRRYEHILLESPSVQDARSQLR |
Ga0066667_120311821 | 3300018433 | Grasslands Soil | KGTGTPDSHVLPIGVRWNPSTKRYQSLDRSYEHFLGESPTMDTPRSTLR |
Ga0179592_102880842 | 3300020199 | Vadose Zone Soil | EKGLQLYFTPLKGVTDSHVLPIAVQWNPATKRYQSLDRNYEHFLLESPSLQDARSTLR |
Ga0179592_105103411 | 3300020199 | Vadose Zone Soil | SHVLPIGVRWNSATKRYQSLDRTYEHFLLESPALNDVRSRLR |
Ga0210399_105159742 | 3300020581 | Soil | IKGTGDSHVLPIGIRWNPTAKRYQSLDPTYAHFLVESPSLGDTPRSRLR |
Ga0210404_104815941 | 3300021088 | Soil | KGTTDSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMADTRSTLR |
Ga0210406_108290951 | 3300021168 | Soil | DAHVLPIGVRWNPKTKRYQSLDHNYESFLLEAPTISGTPKSTLR |
Ga0210400_107935382 | 3300021170 | Soil | QGAVDTHTLPIGVRWNPDTKRYQSLDRSYEHFLNEASALSTARSSLR |
Ga0210388_102611632 | 3300021181 | Soil | LDTHVLPIGVRYNSATKRYQSLDRTYEHFVLESATLQDVRSTLR |
Ga0210394_105828372 | 3300021420 | Soil | IKGGADKHVLPIGIAWNPATKRYQSLDMTYEHFLMEKPSLDTARSVLR |
Ga0210409_108374281 | 3300021559 | Soil | TPVKGNSDPHVLPVGVRWNPETKRYQSMDRSYEHFLLESPSLGEPRSKLR |
Ga0228598_11171772 | 3300024227 | Rhizosphere | FTPLKGAIDTHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSTLR |
Ga0247676_10635551 | 3300024249 | Soil | IAVQWNPRTKRYQSLDRSYQQFLLESPALSNVRTRLQ |
Ga0207693_114232651 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IGVQWNPKTKRYQSLDRSYQQFLTESPALSNVRTRLQ |
Ga0207700_114693252 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LPIGIRWNTETKRYQSLDRSYEHFLNEAPSLGTARSSLR |
Ga0207665_100127325 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TLYLTPVKGMDDRHVLPIGVRWNEKTKRYQSLDRTYEQFLLESPTLSKTRSQLK |
Ga0209350_11179081 | 3300026277 | Grasslands Soil | HVLPIGVRWNPATKRYQSLDRTYEHFLLESPSVQDARSQLR |
Ga0209350_11248371 | 3300026277 | Grasslands Soil | VLPIAVRWNPATKRYQSLERSYERFLLESPSMQDARSTLR |
Ga0209438_10037715 | 3300026285 | Grasslands Soil | DSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDPRSTLR |
Ga0209235_12856051 | 3300026296 | Grasslands Soil | LYFTPLQGTTDSHVLPIGVRWNLATKRYQSLDRTYEHFLLESPALNDARSRLR |
Ga0209238_12664292 | 3300026301 | Grasslands Soil | LKGAIDSHVLPIGVRWNISTKRYQSLDRTYEHFLLESPSMQDARSTLR |
Ga0209155_12342461 | 3300026316 | Soil | HVLPIAVRWNPKTKRYQSLDRSYEQFLGESPSLSTQRSQLR |
Ga0209647_12971901 | 3300026319 | Grasslands Soil | TTDSHTLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSVLR |
Ga0209472_10308913 | 3300026323 | Soil | DTHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSVQDARSQLR |
Ga0209473_10687212 | 3300026330 | Soil | TDPHILPIGVRWNPETKRYQSLDRAYEHFLSESPSIDTARSKLR |
Ga0209161_103204301 | 3300026548 | Soil | TDSHVLPIGVRWNPGTKRYQSLDRTYEHFLLESPSLDTARSSLR |
Ga0209648_105048882 | 3300026551 | Grasslands Soil | VLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSTLR |
Ga0179587_101824291 | 3300026557 | Vadose Zone Soil | IGVRFNPTTKRYQSLDRTYEHFLLESPSMQDARSTLR |
Ga0208240_10357241 | 3300027030 | Forest Soil | DKHVLPIGIAWNPATKRYQSLDLTYEHFLMEKPSLDTARSVLR |
Ga0208859_10462802 | 3300027069 | Forest Soil | VLPIGVRWNPATKRYQSLDRTYEHFLLESPSLQDVRSTLR |
Ga0209004_10682282 | 3300027376 | Forest Soil | LPIGVRWNPDTKRYQSLDRSYEHFLNEASALSTARSSLR |
Ga0209219_11769701 | 3300027565 | Forest Soil | PIGIRWNPATKRYQSLDRTYEHFLVESPTMGDTARSKLQ |
Ga0209076_11469951 | 3300027643 | Vadose Zone Soil | GIRWNPETKRYQSLDRSYEHFLNEAPSLSTARSNLR |
Ga0209217_11170812 | 3300027651 | Forest Soil | PAPIGVRWNPAAKRYQSLDRNYERFLGEAVALQNVRSQLR |
Ga0209626_11836641 | 3300027684 | Forest Soil | VLPIGVRWNPKTKRYQSLDHNYESFLLESPTISGTPKSTLR |
Ga0209448_100859942 | 3300027783 | Bog Forest Soil | TPVKSGADNHVLPIGIAWNPATKRYQSLDMTYEHFLMEKPSLDTARSVLR |
Ga0209515_102781152 | 3300027835 | Groundwater | TQPIGVRWNPEAKRYQSMDRSFEHFLLELPSLENAASHLK |
Ga0209580_104602611 | 3300027842 | Surface Soil | PLKGAVDTHTLPIGIRWNPKTKRYQSLDRSYENFLNEAASLSTAHSNLR |
Ga0209283_100589023 | 3300027875 | Vadose Zone Soil | TPLKGAVDTHTLPIGVRWNPNTKRYQSLDRSYEHFLNEAPSLSTARSNLR |
Ga0209283_101192992 | 3300027875 | Vadose Zone Soil | KGITDSHVLPIGVRFNPATKRYQSLDRTYEHFLLESPSMQDARSTLR |
Ga0209590_105018221 | 3300027882 | Vadose Zone Soil | LPIGVRWNPATKRYQSLDRTYEHFLLEAASLEDARSTLR |
Ga0209488_104229181 | 3300027903 | Vadose Zone Soil | PIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSVLR |
Ga0209488_107522862 | 3300027903 | Vadose Zone Soil | TLPIGIRWNPETKRYQSLDRSYEHFLTEAPSLSTARSNLR |
Ga0137415_110637971 | 3300028536 | Vadose Zone Soil | LKGAVDTHSLPIGIRWNSAAKRYQSLDRSYEHFLNEAPSLNTARSTLR |
Ga0170834_1131022272 | 3300031057 | Forest Soil | LPIGIAWNPATKRYQSLDMTYEHFLLEKATLDTARSVLR |
Ga0170824_1199659772 | 3300031231 | Forest Soil | AKGLTLYLTPVKGMEDKHVLPIGVRWNAKTKRYQSLDRSYEQFLGESPSLTTQRSQLR |
Ga0170818_1034030592 | 3300031474 | Forest Soil | YLTPVKGMEDKHVLPIGVRWNPKTKRYQSLDRTYEQFLGESPSLTMQRSQLR |
Ga0318573_107953091 | 3300031564 | Soil | LPIAVQWNPKTKRYQSLDRSYQQFLLESPALSHVRTRLE |
Ga0307476_106682581 | 3300031715 | Hardwood Forest Soil | GMPDAHVLPIALRWNPKVKRYQSLDRSYQQFLTESPSLSNIRTQLK |
Ga0307474_111240141 | 3300031718 | Hardwood Forest Soil | PIGVRWNPATNRYQSLDASYEHFLKESNSLQNVRSTLR |
Ga0307475_100538383 | 3300031754 | Hardwood Forest Soil | HVLPIGVRFNTATKRYQSLDRTYEHFLLESPSMQDPRSTLR |
Ga0307475_108435741 | 3300031754 | Hardwood Forest Soil | DTHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSMQDARSTLR |
Ga0307473_107851452 | 3300031820 | Hardwood Forest Soil | QLYFTPLQGTTDSHVLPIGLRWNPATKRYQSLDRTYEHFLLESPALNDVRSRLR |
Ga0307478_109203372 | 3300031823 | Hardwood Forest Soil | TPLKGTNDSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPSLQDARSVLK |
Ga0306921_100521074 | 3300031912 | Soil | VLPIAVRWNPKTKRYQSLDRSYQQFLVESPSLSNARSRLR |
Ga0306921_118656501 | 3300031912 | Soil | LKGVTDSHVLPIGVRWNPATKRYQSLDRTYEHFLPESPALDTARSTLR |
Ga0307471_1001716251 | 3300032180 | Hardwood Forest Soil | GMDDRHVLPIGIRWNEKTKRYQSLDRTYEQFLLESPTLSKTRSQLK |
Ga0307471_1011454202 | 3300032180 | Hardwood Forest Soil | TDSHVLPIGVRWNPATKRYQSLDRTYEHFLLESPALSDVRSRLR |
Ga0307471_1022106902 | 3300032180 | Hardwood Forest Soil | DDKHVLPIGVRWNPKTKRYQSLDRTYEQFLGESATLSTMRSQLK |
Ga0307471_1027509551 | 3300032180 | Hardwood Forest Soil | GVRWNPKNKRYQSLDRTYEQFLLESPSLATQRSQLK |
Ga0307471_1033195912 | 3300032180 | Hardwood Forest Soil | DSHVLPIGVRWNPETKRYQSLDRTYEHFLLESPSIQDARSVLR |
Ga0307471_1043488111 | 3300032180 | Hardwood Forest Soil | GVRWNPATNRYQSLDASYEHFLKESSTLQNVRSSLR |
Ga0307510_104522651 | 3300033180 | Ectomycorrhiza | VKGTDDKHVLPIGVRWNPKTKRYQSLDRSFENFLSEAPALSTTRSQLR |
Ga0318519_108530912 | 3300033290 | Soil | VLPIAVRWNPKTKRYQSLDRSYQQFLAESPSLSNARSRLR |
Ga0316624_112548831 | 3300033486 | Soil | ALTGAGASDPHVLPIGIAWNPATKRYQSLDRTYEHFLLETPSLSTARSVLR |
Ga0370484_0047658_930_1055 | 3300034125 | Untreated Peat Soil | HVLPIGVRWNPATKRYQSLDATYEQFLKESATLQNARSTLR |
⦗Top⦘ |