| Basic Information | |
|---|---|
| Family ID | F042975 |
| Family Type | Metagenome |
| Number of Sequences | 157 |
| Average Sequence Length | 48 residues |
| Representative Sequence | GALDEARALAERYAAAARADLMAFERSPYREALEALPDFILARDH |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.72 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.975 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (9.554 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.847 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.847 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF01653 | DNA_ligase_aden | 59.24 |
| PF12826 | HHH_2 | 5.73 |
| PF03120 | DNA_ligase_OB | 4.46 |
| PF00144 | Beta-lactamase | 3.82 |
| PF14520 | HHH_5 | 1.91 |
| PF13361 | UvrD_C | 0.64 |
| PF05433 | Rick_17kDa_Anti | 0.64 |
| PF13516 | LRR_6 | 0.64 |
| PF13365 | Trypsin_2 | 0.64 |
| PF14534 | DUF4440 | 0.64 |
| PF04264 | YceI | 0.64 |
| PF14684 | Tricorn_C1 | 0.64 |
| PF04014 | MazE_antitoxin | 0.64 |
| PF01548 | DEDD_Tnp_IS110 | 0.64 |
| PF09363 | XFP_C | 0.64 |
| PF00596 | Aldolase_II | 0.64 |
| PF12796 | Ank_2 | 0.64 |
| PF00072 | Response_reg | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 63.69 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 3.82 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.82 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 3.82 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.64 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.25 % |
| Unclassified | root | N/A | 26.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_115056451 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106545522 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300003989|Ga0055473_10287431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300003994|Ga0055435_10094808 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300004007|Ga0055476_10190585 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300004011|Ga0055460_10141934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 716 | Open in IMG/M |
| 3300004065|Ga0055481_10462694 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004114|Ga0062593_100492848 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300004146|Ga0055495_10160688 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005330|Ga0070690_100321619 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005332|Ga0066388_100064278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3923 | Open in IMG/M |
| 3300005334|Ga0068869_100049230 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300005343|Ga0070687_101155227 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005355|Ga0070671_100949266 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005445|Ga0070708_100897962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300005446|Ga0066686_10661039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 709 | Open in IMG/M |
| 3300005471|Ga0070698_100865306 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005544|Ga0070686_101042744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300005545|Ga0070695_100782937 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005546|Ga0070696_100980913 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005552|Ga0066701_10681171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300005569|Ga0066705_10932944 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005615|Ga0070702_100198600 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300005764|Ga0066903_107364920 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005830|Ga0074473_11109876 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005833|Ga0074472_11331425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1445 | Open in IMG/M |
| 3300005836|Ga0074470_10422762 | Not Available | 565 | Open in IMG/M |
| 3300005842|Ga0068858_101146057 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005842|Ga0068858_101576009 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006186|Ga0075369_10403279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300006237|Ga0097621_100693597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300006796|Ga0066665_10271206 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300006844|Ga0075428_100259426 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300006844|Ga0075428_102644396 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006845|Ga0075421_100854515 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300006845|Ga0075421_100935117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300006846|Ga0075430_101095621 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006854|Ga0075425_102254469 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006871|Ga0075434_100169022 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300006880|Ga0075429_100129499 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300007076|Ga0075435_100039829 | All Organisms → cellular organisms → Bacteria | 3751 | Open in IMG/M |
| 3300007255|Ga0099791_10671334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300009012|Ga0066710_100141212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3329 | Open in IMG/M |
| 3300009012|Ga0066710_101330232 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300009012|Ga0066710_102329606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300009038|Ga0099829_10961716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300009090|Ga0099827_10802972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300009090|Ga0099827_11039939 | All Organisms → cellular organisms → Bacteria → PVC group | 711 | Open in IMG/M |
| 3300009091|Ga0102851_12471145 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009094|Ga0111539_13293021 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009111|Ga0115026_11955692 | Not Available | 501 | Open in IMG/M |
| 3300009131|Ga0115027_11687829 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009146|Ga0105091_10203067 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300009162|Ga0075423_10307781 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300009455|Ga0114939_10130361 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300009506|Ga0118657_10188411 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
| 3300009609|Ga0105347_1098078 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300009792|Ga0126374_10745681 | Not Available | 742 | Open in IMG/M |
| 3300009799|Ga0105075_1028176 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon | 629 | Open in IMG/M |
| 3300009822|Ga0105066_1083044 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300010337|Ga0134062_10690126 | Not Available | 535 | Open in IMG/M |
| 3300010360|Ga0126372_11686483 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010397|Ga0134124_12667890 | Not Available | 543 | Open in IMG/M |
| 3300010399|Ga0134127_12277410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter capsici | 621 | Open in IMG/M |
| 3300010399|Ga0134127_13653485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 505 | Open in IMG/M |
| 3300010400|Ga0134122_11687256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300010401|Ga0134121_11024197 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300010401|Ga0134121_12442100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300010412|Ga0136852_11082661 | Not Available | 762 | Open in IMG/M |
| 3300011443|Ga0137457_1347634 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012096|Ga0137389_10130948 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300012202|Ga0137363_11271402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300012362|Ga0137361_10902063 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012532|Ga0137373_10117555 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica | 2294 | Open in IMG/M |
| 3300012685|Ga0137397_11115142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300012918|Ga0137396_10411139 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300012922|Ga0137394_10595581 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300012931|Ga0153915_12017784 | Not Available | 675 | Open in IMG/M |
| 3300014311|Ga0075322_1120106 | Not Available | 627 | Open in IMG/M |
| 3300014325|Ga0163163_12690574 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014881|Ga0180094_1158543 | Not Available | 530 | Open in IMG/M |
| 3300014881|Ga0180094_1166144 | Not Available | 517 | Open in IMG/M |
| 3300015077|Ga0173483_10773412 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300015253|Ga0180081_1060662 | Not Available | 664 | Open in IMG/M |
| 3300015259|Ga0180085_1233346 | Not Available | 543 | Open in IMG/M |
| 3300015371|Ga0132258_11117475 | Not Available | 1992 | Open in IMG/M |
| 3300015371|Ga0132258_11923889 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1489 | Open in IMG/M |
| 3300015371|Ga0132258_13500293 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300017959|Ga0187779_10356656 | Not Available | 946 | Open in IMG/M |
| 3300017997|Ga0184610_1264077 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon | 571 | Open in IMG/M |
| 3300018058|Ga0187766_11484896 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300018063|Ga0184637_10418755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300018064|Ga0187773_10021287 | All Organisms → cellular organisms → Bacteria | 2782 | Open in IMG/M |
| 3300018083|Ga0184628_10405666 | Not Available | 712 | Open in IMG/M |
| 3300018084|Ga0184629_10316340 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300018089|Ga0187774_11091238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 564 | Open in IMG/M |
| 3300018468|Ga0066662_12909005 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300019487|Ga0187893_10789508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300021090|Ga0210377_10542795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300022221|Ga0224506_10106903 | Not Available | 1344 | Open in IMG/M |
| 3300025318|Ga0209519_10215914 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300025324|Ga0209640_10273569 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300025327|Ga0209751_10908357 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300025551|Ga0210131_1086270 | Not Available | 539 | Open in IMG/M |
| 3300025923|Ga0207681_10900367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 741 | Open in IMG/M |
| 3300025935|Ga0207709_10996023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300025938|Ga0207704_10934470 | Not Available | 731 | Open in IMG/M |
| 3300025940|Ga0207691_11274064 | Not Available | 608 | Open in IMG/M |
| 3300025960|Ga0207651_10987653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300025981|Ga0207640_10220982 | Not Available | 1450 | Open in IMG/M |
| 3300026041|Ga0207639_11622108 | Not Available | 607 | Open in IMG/M |
| 3300026075|Ga0207708_11162935 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026530|Ga0209807_1335267 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026538|Ga0209056_10055797 | All Organisms → cellular organisms → Bacteria | 3497 | Open in IMG/M |
| 3300026540|Ga0209376_1034472 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300026548|Ga0209161_10353371 | Not Available | 658 | Open in IMG/M |
| 3300027675|Ga0209077_1145855 | Not Available | 660 | Open in IMG/M |
| 3300027843|Ga0209798_10524168 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027869|Ga0209579_10100063 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300027907|Ga0207428_11145324 | Not Available | 542 | Open in IMG/M |
| 3300027909|Ga0209382_11201574 | Not Available | 775 | Open in IMG/M |
| 3300029987|Ga0311334_11093465 | All Organisms → cellular organisms → Bacteria → PVC group | 666 | Open in IMG/M |
| 3300029989|Ga0311365_11296667 | Not Available | 627 | Open in IMG/M |
| 3300030620|Ga0302046_10792286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 763 | Open in IMG/M |
| 3300030838|Ga0311335_10406300 | Not Available | 937 | Open in IMG/M |
| 3300030838|Ga0311335_11138277 | Not Available | 559 | Open in IMG/M |
| 3300031847|Ga0310907_10444527 | Not Available | 684 | Open in IMG/M |
| 3300031873|Ga0315297_11730508 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031949|Ga0214473_11311929 | Not Available | 742 | Open in IMG/M |
| 3300031997|Ga0315278_11557942 | Not Available | 634 | Open in IMG/M |
| 3300032005|Ga0307411_12154685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300032017|Ga0310899_10326876 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300032174|Ga0307470_10370725 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300032258|Ga0316191_11346472 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032276|Ga0316188_10121958 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300032397|Ga0315287_11801219 | Not Available | 681 | Open in IMG/M |
| 3300032770|Ga0335085_10862237 | Not Available | 991 | Open in IMG/M |
| 3300033158|Ga0335077_11086017 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300033408|Ga0316605_10451752 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300033414|Ga0316619_11073613 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300033416|Ga0316622_101174253 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300033416|Ga0316622_101679536 | Not Available | 740 | Open in IMG/M |
| 3300033416|Ga0316622_102134305 | Not Available | 650 | Open in IMG/M |
| 3300033416|Ga0316622_102841985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales | 554 | Open in IMG/M |
| 3300033418|Ga0316625_102444451 | Not Available | 527 | Open in IMG/M |
| 3300033419|Ga0316601_102345094 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300033429|Ga0316193_10430918 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300033429|Ga0316193_11623922 | Not Available | 513 | Open in IMG/M |
| 3300033481|Ga0316600_10999896 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300033483|Ga0316629_10762200 | Not Available | 739 | Open in IMG/M |
| 3300033501|Ga0326732_1086044 | Not Available | 515 | Open in IMG/M |
| 3300033521|Ga0316616_100094322 | Not Available | 2608 | Open in IMG/M |
| 3300033521|Ga0316616_101048431 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300033521|Ga0316616_102841130 | Not Available | 652 | Open in IMG/M |
| 3300033550|Ga0247829_11608167 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300034177|Ga0364932_0415031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300034178|Ga0364934_0341372 | Not Available | 567 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.73% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.46% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.55% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.91% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.27% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.27% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 1.27% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.27% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.27% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.64% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.64% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.64% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.64% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.64% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.64% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.64% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.64% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.64% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004065 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015253 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1150564511 | 3300000956 | Soil | DRVSRDELVHAARENGALEEARAQAERYAAAARADLAGFERSPYREALQALPDFILARDH |
| JGIcombinedJ13530_1065455221 | 3300001213 | Wetland | EARRLAEDYAEHARRDLAGFERSAYSEALRALPDFILGRDH* |
| Ga0055473_102874312 | 3300003989 | Natural And Restored Wetlands | VSRDEIVRLARERGALDEARVLAEQYAAAARGDLMVFEPSSYRDALEALPGFILARDH* |
| Ga0055435_100948083 | 3300003994 | Natural And Restored Wetlands | DRGFQRVSPDDVARLARECGALDEARSLAEEYAAAARADLLAFDRSPYREALAALPDFILARDH* |
| Ga0055476_101905851 | 3300004007 | Natural And Restored Wetlands | DRADQLLELARTSGALSEAQRLAEDYAEAARRDLLAFEGSPFRDALEALPGFVLARDH* |
| Ga0055460_101419342 | 3300004011 | Natural And Restored Wetlands | GFSRVSREELVRMARECGALDEASRMAEEYADLALRELLAFEPSPYREALEALPGFILARDH* |
| Ga0055481_104626941 | 3300004065 | Natural And Restored Wetlands | GDAEKVRIVLEDRGFGRVSRDEIVRLARERGALDEARVLAEQYAAAARGDLMVFEPSSYRDALEALPGFILARDH* |
| Ga0062593_1004928482 | 3300004114 | Soil | RALAERYAAAARADLAGFERSPYREALEALPDFILARDH* |
| Ga0055495_101606882 | 3300004146 | Natural And Restored Wetlands | RVTREELVKMARECGALDEARDLAEGYAAAARRDLVAFEPSEYREALEALPGFILARDY* |
| Ga0070690_1003216191 | 3300005330 | Switchgrass Rhizosphere | LDEARALAERYAEAARKDLAVFDRSPFREALSVLPDFILSRDH* |
| Ga0066388_1000642781 | 3300005332 | Tropical Forest Soil | EARAQAERYAAAAGADLVGFERSPYREALEALPNLLLARDH* |
| Ga0068869_1000492303 | 3300005334 | Miscanthus Rhizosphere | EARAQAERYADTARRALRAFDPSPYRDALEALPDFILARDH* |
| Ga0070687_1011552271 | 3300005343 | Switchgrass Rhizosphere | EDRGFSRVAEDELVSLAVEHGAILEARAQAERYADTARRALRAFDPSPYRDALEALPDFILARDH* |
| Ga0070671_1009492662 | 3300005355 | Switchgrass Rhizosphere | ELLRLAREHGALDEARALAERYAEAARKDLAVFDRSPFREALSVLPDFILSRDH* |
| Ga0070708_1008979621 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ATAAAERYAESARQDLGAFGPSSYREALERLPHYILSRHH* |
| Ga0066686_106610392 | 3300005446 | Soil | ALEEARAQAERYAVAARADLAGFERSPYREALEVLPDFILARDH* |
| Ga0070698_1008653061 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ENGALEEARAQAERYATAARADLASFERSPYREALQVLPDFILARDH* |
| Ga0070686_1010427442 | 3300005544 | Switchgrass Rhizosphere | LRLAREHGALDEARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH* |
| Ga0070695_1007829372 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRLAREHGALDEARALAERYATAARADLTGFERSPYREALEALPDFILARDH* |
| Ga0070696_1009809132 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DEARALAERYAAAARADLTGFERSPYREALEALPDFIVARDH* |
| Ga0066701_106811712 | 3300005552 | Soil | FGRVSREEIVRLAREHGALDEARALAETYAEAARRDLSAFERSPYREALEVLPDFILARDH* |
| Ga0066705_109329442 | 3300005569 | Soil | RKLAERYAEAARRELAVFERSPYREALAVLPDFILGRDH* |
| Ga0070702_1001986001 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DEARALAERYAEAARKDLAVFDRSPFREALAVLPDFILSRDH* |
| Ga0066903_1073649201 | 3300005764 | Tropical Forest Soil | VSREDLVRLARDCGALEEARALAERCADEARASLLAFEPSPYREALEALPGFILARDH* |
| Ga0074473_111098762 | 3300005830 | Sediment (Intertidal) | LARECGALDEARAMAERYADLARRELLAFDPSPYRDALEALPGFILARDH* |
| Ga0074472_113314251 | 3300005833 | Sediment (Intertidal) | ELVRMARECGALDQALEMAERYADLARRDLLAFDPSPYREALEALPGFILARDH* |
| Ga0074470_104227622 | 3300005836 | Sediment (Intertidal) | VVKDRGFERVSPDDVARLARECGALDEARSLAEEYAAAARADLLALDRSPYREALAALPDFILARDH* |
| Ga0068858_1011460572 | 3300005842 | Switchgrass Rhizosphere | DEARALAERYAEAARKDLAVFDRSPFREALSVLPDFILSRDH* |
| Ga0068858_1015760091 | 3300005842 | Switchgrass Rhizosphere | AERYAAAARADLAGFERSPYREALEALPEFILARDH* |
| Ga0075369_104032792 | 3300006186 | Populus Endosphere | EARALAARYAEAARKDLAVFDRSPFREALAVLPDFILSRDH* |
| Ga0097621_1006935971 | 3300006237 | Miscanthus Rhizosphere | AERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH* |
| Ga0066665_102712062 | 3300006796 | Soil | GMPRDNGVLEEARAQAERYAVADQSDLAGFERSPYREALEVLPDFILARDH* |
| Ga0075428_1002594261 | 3300006844 | Populus Rhizosphere | RLARECGALDEAHGMAERYAEEARASLLAFEASPYREALEALPGFILARDH* |
| Ga0075428_1026443961 | 3300006844 | Populus Rhizosphere | ARKHGAIDEARSQAERYAAAARRDLAAFDGSAYRDALEMLPDFILARDH* |
| Ga0075421_1008545152 | 3300006845 | Populus Rhizosphere | CGALEEARAMAERYADEARASLLAFEPSPYREALDALPGFILARDH* |
| Ga0075421_1009351173 | 3300006845 | Populus Rhizosphere | ALAARYAEAARKDLSVFERSPFREALAVLPDFILGRDH* |
| Ga0075430_1010956211 | 3300006846 | Populus Rhizosphere | GALDEARALAERYAAAARADLMAFERSPYREALEALPDFILARDH* |
| Ga0075425_1022544691 | 3300006854 | Populus Rhizosphere | SLAVEHGAILEARAQAERYADTARRALRAFDPSPYRDALEALPDFILARDH* |
| Ga0075434_1001690223 | 3300006871 | Populus Rhizosphere | RYAEAARKDLAVFDRSPFREALAVLPDFILSRDH* |
| Ga0075429_1001294991 | 3300006880 | Populus Rhizosphere | RAFARVSRDELVRLARECGALDEAHGMAERYAEEARASLLAFEASPYREALEALPGFILARDH* |
| Ga0075435_1000398291 | 3300007076 | Populus Rhizosphere | FERVSREDLLRLAREHGALEEARALAARYADAARKDLAAFERSPFREALAVLPDFILSRDH* |
| Ga0099791_106713342 | 3300007255 | Vadose Zone Soil | ELVRAARENGALEEARAQAERYAAAARADLAGFERSPYREALQALPDFILARDH* |
| Ga0066710_1001412124 | 3300009012 | Grasslands Soil | GRVSREEIVRLAREHGALDEARALAETYAEAARRDLSAFERSPYREALEVLPDFILARDH |
| Ga0066710_1013302323 | 3300009012 | Grasslands Soil | LADRGFGRVSREELLLLAREHGALDEARALAERYAAAARADLAGFERSPYREALEALPDFILARDH |
| Ga0066710_1023296061 | 3300009012 | Grasslands Soil | RVLAERYAASARQDLLAFERSPYRDALRVLPDFILARDH |
| Ga0099829_109617162 | 3300009038 | Vadose Zone Soil | ALDEARALAETYAEAAKRDLSAFERSPYREALEVLPDFILARDH* |
| Ga0099827_108029721 | 3300009090 | Vadose Zone Soil | LAETYAEAARRDLSAFERSPYREALEVLPDFILARDH* |
| Ga0099827_110399391 | 3300009090 | Vadose Zone Soil | EATAAAERYAESARQDLGAFEPSSYREALERLPHCILSRHY* |
| Ga0102851_124711452 | 3300009091 | Freshwater Wetlands | RDCGALDEAREMAERYADLARRDLLAFEPSPYREALDALPGFILSRDH* |
| Ga0111539_132930212 | 3300009094 | Populus Rhizosphere | ERYAAAARADLAGFERSPYREALEALPDFILARDH* |
| Ga0115026_119556922 | 3300009111 | Wetland | ALAEARALAETYANAARQDLVGFPPSVYRDALIVLPDFILARDH* |
| Ga0115027_116878292 | 3300009131 | Wetland | EMAERYAALARRDLLAFDPSPYRDALLALPGFILARDH* |
| Ga0105091_102030671 | 3300009146 | Freshwater Sediment | ELVKMARECGALDQARDLAEGYAAAARRDLLVFEPSEYREALEALPGFILARDH* |
| Ga0075423_103077812 | 3300009162 | Populus Rhizosphere | AERYAAAARADLAGFERSPYREALQVLPDFILARDH* |
| Ga0114939_101303611 | 3300009455 | Groundwater | ARECGALDEARAMAERYADAARDELRSFEPSEYKDALEALPGFILARDH* |
| Ga0118657_101884113 | 3300009506 | Mangrove Sediment | GALEEAGSLAERYAEAARRDLRIFEPSPYREALEALPGFILARDH* |
| Ga0105347_10980781 | 3300009609 | Soil | MAERYADEARASLLAFEPSPYREALDALPGFILARDH* |
| Ga0126374_107456811 | 3300009792 | Tropical Forest Soil | RMARENGAIEEARAQAERYAAAAGADLVGFERSPYREALEALPNLLLARDH* |
| Ga0105075_10281762 | 3300009799 | Groundwater Sand | ERASRDELVRAARDNGALEEARVQAERYAAAARADLAGFERSPYREALEALPDFILARDH |
| Ga0105066_10830441 | 3300009822 | Groundwater Sand | QYAEMARRDLLVFDRSPYREALEILPNFILARDH* |
| Ga0134062_106901261 | 3300010337 | Grasslands Soil | QAERYAAAARADLAGFDRSPYREALQALPDFILARDH* |
| Ga0126372_116864832 | 3300010360 | Tropical Forest Soil | VTREELLRLAREHGALEEARALAERYAEMARKDLAIFERSPFREALVVLPDFILSRDH* |
| Ga0134124_126678901 | 3300010397 | Terrestrial Soil | EARALAERYADSARQQLRVFEPSAYRDALEALPDFILARDH* |
| Ga0134127_122774101 | 3300010399 | Terrestrial Soil | PPAAEMVGAVLEDRGFDRVSRDELLRLAREHGALEEARLLAERYAAAARHDLAGFERTPYREALEALPEFILARNY* |
| Ga0134127_136534852 | 3300010399 | Terrestrial Soil | ARALAERYAEQARRDLQPFERSSYREALEALPDFILARDH* |
| Ga0134122_116872562 | 3300010400 | Terrestrial Soil | REHGALDEARALAETYAEAARRDLSGFERSPYREALEALPDFILARDH* |
| Ga0134121_110241971 | 3300010401 | Terrestrial Soil | ELLKLAREHGALDEARALAERYAAAARADLAGFERSPYREALEALPDFILARDH* |
| Ga0134121_124421001 | 3300010401 | Terrestrial Soil | LEDARALAARYAEAARKDLAVFERSPFREALAVLPDFILSRDH* |
| Ga0136852_110826611 | 3300010412 | Mangrove Sediment | RGFTRVPAAEIARLARETGALAEARSLAEDYAQAARQDLVGFEPSIYRDALAVLPDFILARDH* |
| Ga0137457_13476342 | 3300011443 | Soil | AVEYAARARRDLQVFERSKYREALEALPDFILSRDH* |
| Ga0137389_101309481 | 3300012096 | Vadose Zone Soil | RVSRDELVRAARENGALEEARAQAERYAAAARDDLAGFDRSPYREALQALPDFILARDH* |
| Ga0137363_112714021 | 3300012202 | Vadose Zone Soil | HGALDEARALAETYAEAARRDLSAFERSPYREALEVLPDFILARDH* |
| Ga0137361_109020631 | 3300012362 | Vadose Zone Soil | ARALAERYAEAARRDLAAFERSPYRDALEVLPGFILSRDH* |
| Ga0137373_101175551 | 3300012532 | Vadose Zone Soil | REHGALDEARALAQRYAEAARRDLAVFDRSPYREALEVLPDFILSRDH* |
| Ga0137397_111151422 | 3300012685 | Vadose Zone Soil | GALDEAQALAETYAEKARRDLAVFERSPYREALEVLPDFILARDH* |
| Ga0137396_104111392 | 3300012918 | Vadose Zone Soil | EEARAQAERYAAAARADLAGFERSPYREALQALPDFILARDH* |
| Ga0137394_105955812 | 3300012922 | Vadose Zone Soil | FERVSRDELVRAARENGALEEARAQAERYAAAARADLAGFDRSPFREALQALPDFILARDH* |
| Ga0153915_120177842 | 3300012931 | Freshwater Wetlands | EMAERYADLARRDLLAFDPSPYREALDALPGFILSRDH* |
| Ga0075322_11201062 | 3300014311 | Natural And Restored Wetlands | ELAERYAEEARRDLLAFEPSEYRDALEALPGFILARDH* |
| Ga0163163_126905742 | 3300014325 | Switchgrass Rhizosphere | GFDRVSPDAIVRLARDCGALEEARALAERYAEAARQDLLAFDRSPCREALEALPGFILARDH* |
| Ga0180094_11585432 | 3300014881 | Soil | DMAERYAELARRDLLAFEPSPYRDALEALPGFILARDH* |
| Ga0180094_11661441 | 3300014881 | Soil | CGALDQAHDMAERYADEARASLLAFEPSPYREALEALPSFILARDH* |
| Ga0173483_107734122 | 3300015077 | Soil | VRLARDCGALEEARAMAERYADEARASLLAFEPSPYREALDALPGFILARDH* |
| Ga0180081_10606622 | 3300015253 | Soil | VRLARECGALDEAHGMAERHADEARASLLAFEPSPYREALDALPGFILARDY* |
| Ga0180085_12333461 | 3300015259 | Soil | ELVRMARDCGALEEAREMAERYADLARRDLLAFDPSPYRDALDALPGFILGRDH* |
| Ga0132258_111174751 | 3300015371 | Arabidopsis Rhizosphere | LRRGGPAAAELVASVLAERGFGRVTREELVRMARDNGALDEARAQAERYAAAARADLAGFDRSPYREALDVLPTLLLARDH* |
| Ga0132258_119238893 | 3300015371 | Arabidopsis Rhizosphere | GALDEPRALAEEYADNARRELLVFDRSPYREALEILPDFILARDH* |
| Ga0132258_135002931 | 3300015371 | Arabidopsis Rhizosphere | ALEEARAMAERYADEARESLLAFEPSPYREALDALPGFILARDH* |
| Ga0187779_103566561 | 3300017959 | Tropical Peatland | LAEVYADRARRDLALFDRSAYREALEILPDFILARDH |
| Ga0184610_12640771 | 3300017997 | Groundwater Sediment | QAERYAAAARADLAGFERSPYREALQALPDFILARDH |
| Ga0187766_114848961 | 3300018058 | Tropical Peatland | RVTREELVRMARDCGALEEARALAERYADEACRELLAFDPSEYREALSALPGFILARDH |
| Ga0184637_104187551 | 3300018063 | Groundwater Sediment | DRVSQVLADRGFGRVTREEIVKLAREHGALDEARALAETYAEAARRDLAVFDRSAYREALEALPDFILARDH |
| Ga0187773_100212871 | 3300018064 | Tropical Peatland | TMAERFAQAARRELLAFEPSSYRDALEALPGFILARDH |
| Ga0184628_104056662 | 3300018083 | Groundwater Sediment | RDELVRLARECGALDEANEMAERYAALARRDLLAFEPSPYRDALEALPGFILARDH |
| Ga0184629_103163402 | 3300018084 | Groundwater Sediment | EHGALDEARALAERYAEAARKDLAVFDRSPYREALEVLPDFILARDH |
| Ga0187774_110912382 | 3300018089 | Tropical Peatland | ARDCGALDDARAMAERFAQAARRELLAFEPSSYRDALEALPGFILARDH |
| Ga0066662_129090052 | 3300018468 | Grasslands Soil | DNGALEEARAQAERYAAAARADLAGFDRSPYREALEALPDFILARDH |
| Ga0187893_107895082 | 3300019487 | Microbial Mat On Rocks | EEYADAARRDLLVFERSPYREALAALPDFILARDH |
| Ga0210377_105427952 | 3300021090 | Groundwater Sediment | EDYAEKARRDLMAFDRSPYREALSVLPDFILSRDH |
| Ga0224506_101069032 | 3300022221 | Sediment | EAYAERALEALRPFEHSPYREALSSLPGFILARDY |
| Ga0209519_102159141 | 3300025318 | Soil | DCGALDEARGMAERYADEARANLIVFEPSPYREALDALPGFILARDH |
| Ga0209640_102735691 | 3300025324 | Soil | AEHYASAARRDLLAFEPSVYREALEALPDFILSRDH |
| Ga0209751_109083571 | 3300025327 | Soil | RLAREQGAIEEARALAERYAEAARADLQSFERTPYREALAALPDFILARDH |
| Ga0210131_10862701 | 3300025551 | Natural And Restored Wetlands | RSLAEEYAAAARADLLAFDRSPYREALAALPDFILARDH |
| Ga0207681_109003671 | 3300025923 | Switchgrass Rhizosphere | AREHGALEEARALAARYAESARKDLAVFDRSPFREALAVLPDFILSRDH |
| Ga0207709_109960232 | 3300025935 | Miscanthus Rhizosphere | LRLAREHGALDEARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH |
| Ga0207704_109344701 | 3300025938 | Miscanthus Rhizosphere | AERYAAAARADLAGFERSPYREALEALPDFILARDH |
| Ga0207691_112740642 | 3300025940 | Miscanthus Rhizosphere | AVLADRGFGRVSREELLKLAREHGALDEARALAERYAAAARADLAGFERSPYREALEALPEFILARDH |
| Ga0207651_109876531 | 3300025960 | Switchgrass Rhizosphere | HGALDEARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH |
| Ga0207640_102209822 | 3300025981 | Corn Rhizosphere | LDEARALAERYAEAARKDLAVFDRSPFREALAVLPDFILSRDH |
| Ga0207639_116221082 | 3300026041 | Corn Rhizosphere | EARALAERYAEAARKDLAAFDRSPFREALAVLPDFILSRDH |
| Ga0207708_111629352 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | CGALDEARALAERYAEQARRDLQPFERSAYREALEALPDFILARDH |
| Ga0209807_13352672 | 3300026530 | Soil | RKLAERYAEAARRELAVFERSPYREALAVLPDFILGRDH |
| Ga0209056_100557973 | 3300026538 | Soil | SRRRAQAERYAVAARADLAGFERSPYREALEVLPDFILARDH |
| Ga0209376_10344723 | 3300026540 | Soil | ERYAAAARADLAGFERSPYREALQALPDFILARDH |
| Ga0209161_103533711 | 3300026548 | Soil | ARGQAERYAAAARADLAGFDRSPYREALQALPDFILARDH |
| Ga0209077_11458552 | 3300027675 | Freshwater Sediment | RDELVKMARECGALDQARDLAEGYAAAARRDLLVFEPSEYREALEALPGFILARDH |
| Ga0209798_105241681 | 3300027843 | Wetland Sediment | REHGALDEARTMAERYAESARQQLRAFEPSPYRDALEALPDFILARDH |
| Ga0209579_101000631 | 3300027869 | Surface Soil | RSLAEEYADRARRDLASFERSAYREALEALPDFILARDH |
| Ga0207428_111453242 | 3300027907 | Populus Rhizosphere | ERYAAAARADLAGFERSPYREALEALPDFILARDH |
| Ga0209382_112015741 | 3300027909 | Populus Rhizosphere | AERFAALARRDVLAFERSPYREALELLPDFILARDH |
| Ga0311334_110934652 | 3300029987 | Fen | RECGALEEAGELAERYADEARRDLLAFPPSEYRDALEALPGFILARDH |
| Ga0311365_112966672 | 3300029989 | Fen | GALEDARKLAEHYADEARRELLAFEPSEYRDALETLPGFILARDH |
| Ga0302046_107922861 | 3300030620 | Soil | DLLRQAREHGALEEARALAERYAEAARRDLAVFERSPYREALAALPDFILARDH |
| Ga0311335_104063001 | 3300030838 | Fen | EELVRMARDCGALEEAQTMAERYAEAARGELLAFEPSEYRDALFALPGFVLARDH |
| Ga0311335_111382771 | 3300030838 | Fen | ARKLAEHYADEARRELLAFEPSEYRDALETLPGFILARDH |
| Ga0310907_104445272 | 3300031847 | Soil | GQAERYADSARRALRGFDPSPYRDALEALPDFILARDH |
| Ga0315297_117305082 | 3300031873 | Sediment | MAERYAELARRDLLAFDPSPYRDALEALPSFILARDH |
| Ga0214473_113119291 | 3300031949 | Soil | LVRLARECGALDEARGMAERYADEARASLLAFEPSPYREALDALPGFILARDH |
| Ga0315278_115579421 | 3300031997 | Sediment | VRLARECGALDEAHGMAERYADEARASLLAFEPSPYREALEALPGFILARDH |
| Ga0307411_121546852 | 3300032005 | Rhizosphere | REQLLRLARETGALDEARKEADRYAAAARQDLLVFDRSPYREALTALPDFILARDR |
| Ga0310899_103268761 | 3300032017 | Soil | ARALAERYADLAREDLSALEPSPNREALSVLPDFILARDH |
| Ga0307470_103707252 | 3300032174 | Hardwood Forest Soil | EARAMAERYADEARASLLAFEPSPYREALDALPGFILARDH |
| Ga0316191_113464722 | 3300032258 | Worm Burrow | AGSLAERYAEAARRDLRVFEPSPYREALEALPGFILARDH |
| Ga0316188_101219581 | 3300032276 | Worm Burrow | RDHGALEEAGSLAERYAEAARRDLQVFEPSPYREALEALPGFILARDH |
| Ga0315287_118012192 | 3300032397 | Sediment | ERYAALARRDLLAFDPSPYRDALLALPGFILARDH |
| Ga0335085_108622373 | 3300032770 | Soil | EEYADAARRDLLGFERSAYCEALAALPDFILARDH |
| Ga0335077_110860173 | 3300033158 | Soil | VSAEELVRLARECSALDEARALAEDYADRARRDLLAFERSPYREALAVLPDFILARDH |
| Ga0316605_104517522 | 3300033408 | Soil | MAERYAEEARRELLAFEPSDYREALEALPGFILARDH |
| Ga0316619_110736131 | 3300033414 | Soil | AFSRVTRDELVRMARDCGALDEAREMAERYADLARRDLLAFEPSPCREALDALPGFILARDH |
| Ga0316622_1011742531 | 3300033416 | Soil | AVLDDRAFSRVTREELVRMARECGALEEARAMAERYADSARHDLLAFDPSPYREALEALPGFILGRDH |
| Ga0316622_1016795361 | 3300033416 | Soil | AEHYAELARRDLAVFEPSPYRDALEALPGFILARDH |
| Ga0316622_1021343051 | 3300033416 | Soil | ELAERYAELARRDLLAFEPSEYRDALEALPGFILARDH |
| Ga0316622_1028419852 | 3300033416 | Soil | ALDEARELAAVYAEQARRQLDVFEPSEYRDTLLALPGFILARDH |
| Ga0316625_1024444511 | 3300033418 | Soil | ALDEASGLAERYAERARRDLLAFEPSQYRDALEALPGFILARDH |
| Ga0316601_1023450941 | 3300033419 | Soil | VRMARECGALDEAREMAERYADLARRDLLAFEPSPYRDALEALPGFILARDH |
| Ga0316193_104309182 | 3300033429 | Sediment | GSLAERYAEAARRDLRVFEPSPYREALEALPGFILARDH |
| Ga0316193_116239221 | 3300033429 | Sediment | AGSLAERYAEAARQALRAFEPSPYRDALEALPGFILARDH |
| Ga0316600_109998961 | 3300033481 | Soil | ARDCGALDEAREMAERYADLARRDLLAFEPSPYREALDALPGFILSRDH |
| Ga0316629_107622002 | 3300033483 | Soil | RVTRDELVRMAGECGALEEAQEMAERYADFARRDLLAFDPSPYREALEALPGFILGRDH |
| Ga0326732_10860442 | 3300033501 | Peat Soil | LVRMARDCGALEEARRMAERYAEEARRELLAFEPSEYREALLALPGFILARDH |
| Ga0316616_1000943223 | 3300033521 | Soil | MARDCGALEEARELAERYADLARRDLLAFDPSPYREALEALPSFILARDH |
| Ga0316616_1010484311 | 3300033521 | Soil | ELVRMARECGALDEAREMAERYAGRARRDLLAFEPSPYREALDALPGFILSRDH |
| Ga0316616_1028411302 | 3300033521 | Soil | EDARRMAERYAEEARRELLAFEPSEYREALEALPGFILARDH |
| Ga0247829_116081671 | 3300033550 | Soil | EARGLAEQYAERARRDLAAFERSPYREALAVLPDFILARDH |
| Ga0364932_0415031_378_506 | 3300034177 | Sediment | DEARALAEQYAEKARRDLLVFDRSPYREALEILPDFILARDH |
| Ga0364934_0341372_422_565 | 3300034178 | Sediment | ECGALEEARRLAERYAEAARRELMGFERSPHREALLALPDFILARDH |
| ⦗Top⦘ |