| Basic Information | |
|---|---|
| Family ID | F042948 |
| Family Type | Metagenome |
| Number of Sequences | 157 |
| Average Sequence Length | 49 residues |
| Representative Sequence | QGYISGVPSLFSTDFNTAFIFKNTEQAESFITEFADELHNPQILDCP |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.55 % |
| % of genes near scaffold ends (potentially truncated) | 96.82 % |
| % of genes from short scaffolds (< 2000 bps) | 90.45 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.433 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (11.465 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.134 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.064 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.00% β-sheet: 0.00% Coil/Unstructured: 68.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF12844 | HTH_19 | 50.96 |
| PF01381 | HTH_3 | 5.73 |
| PF04255 | DUF433 | 1.91 |
| PF09903 | DUF2130 | 1.27 |
| PF00899 | ThiF | 0.64 |
| PF06114 | Peptidase_M78 | 0.64 |
| PF00383 | dCMP_cyt_deam_1 | 0.64 |
| PF02661 | Fic | 0.64 |
| PF01380 | SIS | 0.64 |
| PF12728 | HTH_17 | 0.64 |
| PF08751 | TrwC | 0.64 |
| PF02641 | DUF190 | 0.64 |
| PF13560 | HTH_31 | 0.64 |
| PF05016 | ParE_toxin | 0.64 |
| PF03061 | 4HBT | 0.64 |
| PF01548 | DEDD_Tnp_IS110 | 0.64 |
| PF00072 | Response_reg | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.91 |
| COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.64 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.43 % |
| All Organisms | root | All Organisms | 23.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 10.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.82% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 2.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.91% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.27% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.64% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.64% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.64% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.64% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.64% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1016264632 | 3300000364 | Soil | VTFQGYISGIPRLFSTDFNTAFIFANREQAEAFITEFADELYNPQILDYR* |
| CNAas_10057213 | 3300000532 | Quercus Rhizosphere | QGYISGVPNLFSKHFNTAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| JGI1027J12803_1012264171 | 3300000955 | Soil | IVVTFHGYISGVPSLFSSDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| JGI25406J46586_102342141 | 3300003203 | Tabebuia Heterophylla Rhizosphere | IIVTFQGYISGIPSLFSRDFNTAFIFKNTEQAESFIREFADELHNPQILDCP* |
| soilL2_100743912 | 3300003319 | Sugarcane Root And Bulk Soil | GVIIVTFQGYVSGVPNLFSADFNTAFIFKNTEQADAFITEFTDELHNPQILDCP* |
| soilL2_100780308 | 3300003319 | Sugarcane Root And Bulk Soil | SGIPSLFSTDFNAAFIFKDTQQAEAFITEFTDELHSPQILDCP* |
| Ga0062590_1024510011 | 3300004157 | Soil | IDAAGGETESGVIIVTFQGFISGVPNLFSRDFNTAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0063356_1034516912 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LQGYISGVPSLFSTDFNTAFIFKNTEQAKSFITEFADELHNPQILDCP* |
| Ga0062595_1017565371 | 3300004479 | Soil | KLNKRRKGKIIVTFQGYLSGIPNLFTKDFNAAFIFKNAEQAETFITEFADELHNPQILDCP* |
| Ga0062595_1021577903 | 3300004479 | Soil | GETETGIIIVTFQGYISGIPKLFSTDFNTAFIFKNREQAEAFITEFADELYNPQILDYR* |
| Ga0065715_101346561 | 3300005293 | Miscanthus Rhizosphere | PSLFSSDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0070676_114044902 | 3300005328 | Miscanthus Rhizosphere | TFQGYISGVPSLFSNDFNTAFIFKNKEQAEAFITEFADELHNPQVLDCP* |
| Ga0068869_1015622751 | 3300005334 | Miscanthus Rhizosphere | GVIIVTFQGYISGIPSLFSADFNMAFIFKNTGQAEAFIAEFSEELNNPQILNCA* |
| Ga0070691_104491473 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | IDAAGGETETGVIIVTFQGYISGVPSLFSTDFNTAFIFKNTEQAESFITEFAESFTIRRFSTARNPTSE* |
| Ga0070691_108145762 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | ISGVPSLFSTDFDTAFIFNNREQAEAFIAEFADELHNPQILDCP* |
| Ga0070687_1007920712 | 3300005343 | Switchgrass Rhizosphere | GVIIVTFHGYISGVPSLFSRDFNTAFVFKNKEQAEGFITEFVDEVHNPQILDCP* |
| Ga0070692_103752941 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IIVTFQGYISGIPSLFSTDFNTAFIFKNTDQAEAFVTEFADELHNPQILDCP* |
| Ga0070692_113342271 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGETETGVIIVTFQGYISGVPSLFSRNFNTAFIFKNTDQAESFITEFADELHNPQILDCP* |
| Ga0070673_1016694401 | 3300005364 | Switchgrass Rhizosphere | GGETETAIIIVTFQGYISGIPRLFSTDFNTAFIFKNREQAASFITEFADELYNPQILDYR |
| Ga0070701_100390271 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PSLFSSDFNTAFVFKNKEQAEGFITEFADELHNPQILDCP* |
| Ga0070705_1014781701 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ETGVIIVTFQGYISGVPSLFSKDFNSAFIFKNTDQAEAFITEFANELHNPQILDCP* |
| Ga0070700_1006565261 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VIIVTFQGYISGIPSLFSTDFNTAFVFKNTEQAGAFITEFADELHNPQILNCP* |
| Ga0070694_10000253114 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TGIIIVTFQGYISGIPKLFSTDFNTAFIFNREQAEAFITEFADELYNPQILDYR* |
| Ga0070694_1000227401 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GETETGVIIVTFQGYVSGVPNLFSTDFNTAFLFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0070694_1003717762 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGETETGVIIVTFQGYLSGIPNLFTKDFNAAFIFKNAEQAETFITEFADELHNPQILDCP* |
| Ga0070707_1005730171 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SGIPKLFSTDFNTAFIFKNREQAASFITEFADELYNPQILDYR* |
| Ga0070672_1019151691 | 3300005543 | Miscanthus Rhizosphere | VPSLFSSDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0070696_1002212353 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GYISGVPSLFSKDFNTAFIFKNREQAEAFITEFADELYNPQILDYR* |
| Ga0070693_1000276694 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VTFQGYISGVPNLFSTDFNTAFIFKDREQAEAFITEFADELHNPQILDCP* |
| Ga0070693_1006858261 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GIPSLFSTDFNTAFIFKNKEQAETFITEFAAELHNPQILDCP* |
| Ga0070704_1004422544 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGETETAIIIVTFQGYISGIPRLFSTDFNTAFIFKNREQAEAFITEFAEELYNPQILDYR* |
| Ga0070664_1013770051 | 3300005564 | Corn Rhizosphere | GVIIVTFQGYISGVPSLFSTDFNTAFIFRNTEQAETFITEFADELCSPQILDCP* |
| Ga0070702_1001064853 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ETETGVIIVTFQGYISGVPSLFSTDFNTAFIFKNTEQAESFIKEFADELHNPQILDCP* |
| Ga0070702_1012752191 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ISGVPSLFSSDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0070702_1018552182 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GYISGIPTLFSTDFNAAFIFKNKEQAEAFITEFAVELHNPQILDCQ* |
| Ga0068852_1016837901 | 3300005616 | Corn Rhizosphere | ETETGVIIVTFLGYISGIPKLFSTDFNSAFVFKNREQAKAFITEFADELHHPQILDCP* |
| Ga0068859_1011137773 | 3300005617 | Switchgrass Rhizosphere | GYISGVPSLFSSDFDTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0068859_1015178661 | 3300005617 | Switchgrass Rhizosphere | DFDTAFVFKNKEQAEAFITEFVDELHNPKVLDCP* |
| Ga0068859_1017303652 | 3300005617 | Switchgrass Rhizosphere | SGIPRLFSTDFNTAFIFKNREQAEAFITEFAEELYNPQILDYR* |
| Ga0068861_1013837841 | 3300005719 | Switchgrass Rhizosphere | GVIIVTFQGYISGVPNLFSRDFHTAFIFKNTEQAEAFIAEFADELHNPQILDCP* |
| Ga0068863_1016741641 | 3300005841 | Switchgrass Rhizosphere | LFSNDFNTAFIFKDTEQAKAFITEFADELHNPQILDCP* |
| Ga0068863_1025113551 | 3300005841 | Switchgrass Rhizosphere | TGVIIVTFHGYISGVPSLFSSDFNTAFVFKNKEQAEAFVTEFADELHNPQILDCP* |
| Ga0068860_1000713426 | 3300005843 | Switchgrass Rhizosphere | SLFSSDFDTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0068860_1004687361 | 3300005843 | Switchgrass Rhizosphere | TGVIIVTFQGYISGVPSLFSTDFNAAFIFKDKEEAEAFITEFADELHNPQILDCC* |
| Ga0068860_1018609053 | 3300005843 | Switchgrass Rhizosphere | FHGYISGVPSLFSSDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0068862_1027354302 | 3300005844 | Switchgrass Rhizosphere | VPDLFCTDFNAAFLFKDTEQAEAFITEFAEELFHPQILNCP* |
| Ga0097621_10000709511 | 3300006237 | Miscanthus Rhizosphere | SRDFNTAFIFKNTDQAEEFVTEFANELHNPQILDCP* |
| Ga0079222_117517593 | 3300006755 | Agricultural Soil | LFSSDFDTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0079222_118796652 | 3300006755 | Agricultural Soil | GYISDIPNLFSTDFNTAFIFKDKEQAETFIAEFADELHNPQILDCP* |
| Ga0075433_112690323 | 3300006852 | Populus Rhizosphere | SLFSSDFNTAFVFKNKEQAEAFVTEFADELHNPQILDCP* |
| Ga0075434_1016719891 | 3300006871 | Populus Rhizosphere | FSTDFNTAFIFKNTEQAESFITEFADELHNPQILDCP* |
| Ga0079215_115870151 | 3300006894 | Agricultural Soil | TDFNTAFIFKDKEQAETFITEFADELHNPQILVCL* |
| Ga0079218_123136711 | 3300007004 | Agricultural Soil | IIVTFQGYISGIPRLFSTDFNTAFIFKNREQAASFITEFADELYNPQILDYR* |
| Ga0105240_126250072 | 3300009093 | Corn Rhizosphere | GETETGVIIVTFQGYISGVPSLFSTDFNTAFVFKNTEQAESFITEFADELHNPQILDCP* |
| Ga0105247_100189363 | 3300009101 | Switchgrass Rhizosphere | MVNISGVPSLFSSDLNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0105247_102224941 | 3300009101 | Switchgrass Rhizosphere | AGGETETAIIIVTFQGYISGIPRLFSTDFNTAFIFKNREQAASFITEFADELYNPQILDYR* |
| Ga0105247_110056041 | 3300009101 | Switchgrass Rhizosphere | YISGIPTLFSRDFDSAFIFKNTEQAKAFITEFTDELHNPQILDCP* |
| Ga0114129_113661751 | 3300009147 | Populus Rhizosphere | FSTDFNTAFIFKNTEQAETFIAEFADELHNPLILDCP* |
| Ga0105243_1000319916 | 3300009148 | Miscanthus Rhizosphere | AAGGETETGVIIVTFQGYISGVPTLFSTNFNTAFIFKNKEQAEAFITEFADELHNPQIIDCP* |
| Ga0105243_100444907 | 3300009148 | Miscanthus Rhizosphere | PSLFSTDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0105243_120239312 | 3300009148 | Miscanthus Rhizosphere | AGIPSLFSSDFNSAFIFKNSEQAEAFITEFAVELHNPQILDCP* |
| Ga0111538_136147481 | 3300009156 | Populus Rhizosphere | ETETGVIIVTFQGYISGIPSLFSTDFNTAFVFKNTEQAKAFITEFADELHNPQILDCP* |
| Ga0075423_108426411 | 3300009162 | Populus Rhizosphere | GYISGIPSLFSSDFDTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0105241_105315602 | 3300009174 | Corn Rhizosphere | FQGYISGVPSLFSTDFNTAFIFKNTEQAESVIKEFADELHNPQILNCP* |
| Ga0105241_117139352 | 3300009174 | Corn Rhizosphere | FQGYISGIPSLFSTDFNTAFIFKNTEQAEAFITEFADELHNPQILDRP* |
| Ga0105241_118245131 | 3300009174 | Corn Rhizosphere | VTFQGYISGIPSLFSSDFDTAFVFKNKEQAEAFIAEFADELHNPQILDCP* |
| Ga0105242_100730656 | 3300009176 | Miscanthus Rhizosphere | QGYIRGIPNLFSTNFNAAFVFKNTEQAEGFITDIAAELHNPQIIDCP* |
| Ga0105237_114645421 | 3300009545 | Corn Rhizosphere | GGETETGVIIVTFQGYISGVPSLFSTDFNTAFIFKNTEQAESFIKEFADELHNPQILDCP |
| Ga0105237_125303361 | 3300009545 | Corn Rhizosphere | GVPSLFSTDFNTGFIFKDAEQAQAFIAEFADELHNPQILDCP* |
| Ga0105249_113397442 | 3300009553 | Switchgrass Rhizosphere | IIVTFQGYISGVPSLFSNDFSTAFIFKNAEQAESFIAEFADELNNPQILDCP* |
| Ga0126315_104704311 | 3300010038 | Serpentine Soil | FSTDFNTAFIFKDKEQAETFIAEFADELHNPQILDCP* |
| Ga0126312_111287281 | 3300010041 | Serpentine Soil | VTFHGYISGVSSLFSSDFNTAFVFKNKEQAEAFITEFADELHNPQILNCP* |
| Ga0126312_113538892 | 3300010041 | Serpentine Soil | LFSTDFNTSFIFKNTEQAESFITEFADELHNPQILDCP* |
| Ga0126314_101509735 | 3300010042 | Serpentine Soil | LFSTDFNTAFIFKNREQAASFITEFADELYNPQILDYR* |
| Ga0126314_104582381 | 3300010042 | Serpentine Soil | IPRPFSTDFNTAFIFKDKEQAETFIAEFADELHNPQILDCP* |
| Ga0126376_126672951 | 3300010359 | Tropical Forest Soil | TETGVIVVTFQGYISGIPKLFSTDFNTAFLFKDIKQAAAFITEFADELHNPQIIDYP* |
| Ga0126372_112808841 | 3300010360 | Tropical Forest Soil | GVPSLFSTDFNSAFIFQNTEHTKAFVTEFADELHNPQILDCP* |
| Ga0126377_119123612 | 3300010362 | Tropical Forest Soil | DFNTAFIFKNSEQAERFITEFADELHNPQILDCP* |
| Ga0134128_102255914 | 3300010373 | Terrestrial Soil | SGVPSLFSTDFNTAFIFKNTEQAESFIKEFADELHNPQILDCP* |
| Ga0134128_115948351 | 3300010373 | Terrestrial Soil | NLFARDFNTAFIFKNTDQAEAFIAEFSEELNNPQILNCA* |
| Ga0134128_120776151 | 3300010373 | Terrestrial Soil | ETETGVTIVTFQGYIAGIPSLFSSDFNSAFIFKNSEQAEAFITEFADELHNPQILDCP* |
| Ga0105239_122883031 | 3300010375 | Corn Rhizosphere | ETGVIIVTFQGYISGVPSLFSTDFNTAFIFKDTEQAESFITEFADELHTPQILDCP* |
| Ga0134126_116878151 | 3300010396 | Terrestrial Soil | IPSLFSTDFNTAFIFENTDQAEAFIAEFSEELNNPQILNCA* |
| Ga0134126_118544711 | 3300010396 | Terrestrial Soil | VTFQGYISGVPSLFSTDFNTAFIFKNTEQAESFIKEFADEL |
| Ga0134126_125536852 | 3300010396 | Terrestrial Soil | TDFNTAFIFKNTKQAESFITEFADELHNPQILDCP* |
| Ga0134127_101028261 | 3300010399 | Terrestrial Soil | TFHGYISGVPSLFSTDFNTAFVFKNKEQAEAFIAEFADELHNPQILDCP* |
| Ga0134127_120615921 | 3300010399 | Terrestrial Soil | ETDTGVIIVTFHGYISGVPSLFSTDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0134127_121248691 | 3300010399 | Terrestrial Soil | TGIIIVTFQGYISGIPRLFSTDFNTAFIFKNREQAEAFITEFADELHNPQILNCP* |
| Ga0134127_121740971 | 3300010399 | Terrestrial Soil | TDFNTAFIFKNTEQAEAFITEFADELHNPQTLDCP* |
| Ga0134127_122456652 | 3300010399 | Terrestrial Soil | DAAGGETGTGVIIVTFQGYISGVPSLFSTDFNTAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0134122_128955032 | 3300010400 | Terrestrial Soil | GVPNLFSRNFNTAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0134123_110051453 | 3300010403 | Terrestrial Soil | DFNTAFIFKNTEQAESFIKEFTDELHNPQILDCP* |
| Ga0134123_126247362 | 3300010403 | Terrestrial Soil | YISGIPSLFTTDFNTAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0134123_129488711 | 3300010403 | Terrestrial Soil | IVTFQGYISGIPRLFSTDFNTAFIFKNREQAASFITEFADELYNPQILDYR* |
| Ga0134123_133534331 | 3300010403 | Terrestrial Soil | LSGVPNLFSTDFNTAFIFKNTEQAEAFLTEFADELHNPQILDCP* |
| Ga0105246_113059671 | 3300011119 | Miscanthus Rhizosphere | VIIVTFQGYISGVPSLFSIDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0105246_123395582 | 3300011119 | Miscanthus Rhizosphere | DFNTAFIFKNTEQAESFITEFADELHNPQILDCP* |
| Ga0120187_10047773 | 3300012015 | Terrestrial | ISGIPRLFSTDFNTAFIFANREQAEAFITEFAEELHNPQILDYR* |
| Ga0164306_106891471 | 3300012988 | Soil | AAGGETETGVIIVTFHGYISGVPSLFSTDFNTAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0157373_115218442 | 3300013100 | Corn Rhizosphere | VTFHGYISGVPSLFSSDFNTAFVFKNKEQAEAFITEFANELHNPQILDCP* |
| Ga0157374_127645502 | 3300013296 | Miscanthus Rhizosphere | ETGVIIVTFQGYVSGVPNPFSTDFNTAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0157378_127243081 | 3300013297 | Miscanthus Rhizosphere | VTFQGYISGIPSLFSTDFNTAFIFKDTEQAETFIAEFADELHNPQILDCP* |
| Ga0157372_124233742 | 3300013307 | Corn Rhizosphere | FSTDFNTAFIFKNTEQAETFITEFADELHNPQILDCP* |
| Ga0157372_127472441 | 3300013307 | Corn Rhizosphere | IVTFHGYISGIPTLFSTDFDTAFIFKNREQAEAFMTEFADELHNPQILDCP* |
| Ga0163163_110166251 | 3300014325 | Switchgrass Rhizosphere | RLFSTDFNTAFIFANREQAEAFITEFADELHKPQILDYR* |
| Ga0163163_111919003 | 3300014325 | Switchgrass Rhizosphere | FQGYISGIPRLFSTDFNTAFIFKNREQAASFITEFADELYNPQILDYR* |
| Ga0163163_118212131 | 3300014325 | Switchgrass Rhizosphere | IPTLFSTDFNTAVIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0163163_131678022 | 3300014325 | Switchgrass Rhizosphere | SGVPSLFSTDFNSAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0182000_105569212 | 3300014487 | Soil | VTFHGYISGVPSLFSTDFNTAFIFKNTEQAKSFITEFADELHNPQILDCP* |
| Ga0157377_112694531 | 3300014745 | Miscanthus Rhizosphere | DAAGGETETGVIIVTFQGYISGVPRLFSTDFNTAFIFKNKEQAESFITEFADELHKPQILDCP* |
| Ga0157379_116329352 | 3300014968 | Switchgrass Rhizosphere | GVIIVTLLGYISGVPSLFSTDFNTAFIFKNTEQAESFIKEFANELHNPQILDCP* |
| Ga0157376_128751041 | 3300014969 | Miscanthus Rhizosphere | LFSSDFNSAFIFKNTEQAEAFITEFADELHNPQILDCP* |
| Ga0132258_118711731 | 3300015371 | Arabidopsis Rhizosphere | AFVFKNKEQAEAFITEFADELHNPQILDCRNPTSS* |
| Ga0132257_1004298073 | 3300015373 | Arabidopsis Rhizosphere | DAAGGETETGVIIVTFHGYISGVPSLFSTDFNSAFIFKNTEQAEAFITEFVDELHNPQILDCP* |
| Ga0132257_1017306902 | 3300015373 | Arabidopsis Rhizosphere | SLYSSDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP* |
| Ga0132255_1009285024 | 3300015374 | Arabidopsis Rhizosphere | AAGGETETGVIIVTFHGYISGVPSLFSTDFNAAFIFKNTEQAEAFIAEFADELYNPQILDCP* |
| Ga0132255_1010553913 | 3300015374 | Arabidopsis Rhizosphere | FSTDFNTAFIFKNSEQAEAFITEFAEELHNPQILDCP* |
| Ga0190265_106589993 | 3300018422 | Soil | SGIPSLFSTDFNTAFIFKDTEQAETFIAEFADELHNPQILDYR |
| Ga0190275_120880672 | 3300018432 | Soil | TFQGYISGIPSLFSMDFNTAFVFKNYEQAEAFITEFADELHNPQILDCP |
| Ga0190269_111830002 | 3300018465 | Soil | ETETGVIIVTFHGYISGIPCLFSTDFNTAFIFKDTEQAESFITEFADELHNPQILDCPNLTSE |
| Ga0190268_117891002 | 3300018466 | Soil | YISGVPSLFSRDFNTAFIFKNTDQAEAFITEFAYELQNPQILDCP |
| Ga0190274_124282452 | 3300018476 | Soil | ETETGVIIVTFQGYISGVPTLFSTDFNTAFIFKDKEQAEAFITEFADELHNPQILDCL |
| Ga0187893_104381172 | 3300019487 | Microbial Mat On Rocks | VTFQGYISGVPSLFATDFNTAFIFNNTEQAESFIAEFADELHNPQILDCP |
| Ga0190267_105545871 | 3300019767 | Soil | IVVTFQGYISGVPSLFSSDFNTAFVFKNKEQAAAFITEFADELHKPRFSTARDPTSE |
| Ga0247678_10634722 | 3300024325 | Soil | SSDFNTAFVFKNKEQAEAFITEFADELHNPKVLDCP |
| Ga0207697_102047921 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | DAAGGETETGVIIVTFHGYISGVPSLFSTDFNTAFIFKNTEQAESFITEFADELHNPQILDCP |
| Ga0207656_103194662 | 3300025321 | Corn Rhizosphere | YISGIPNLFSTDFNTAFIFKNTEQAEVFITEFADELHNPQILDCP |
| Ga0207696_11350041 | 3300025711 | Switchgrass Rhizosphere | ETGVIIVTFQGYISGVPSLFSSDFNTAFIFKNTEQAEAFITEFADELHNPQILDCP |
| Ga0207642_110616212 | 3300025899 | Miscanthus Rhizosphere | ETETGIIVVTFLGYISGVPSLFSNDFNTAFIFKDTEQAKAFITEFADELHNPQILDCP |
| Ga0207710_100010346 | 3300025900 | Switchgrass Rhizosphere | MVNISGVPSLFSSDLNTAFVFKNKEQAEAFITEFADELHNPQILDCP |
| Ga0207707_107745321 | 3300025912 | Corn Rhizosphere | GYISGVPSLFTTDFNAAFIFKNTEQAEAFIAEFADELHSPQILDCP |
| Ga0207671_112972161 | 3300025914 | Corn Rhizosphere | RIDAAGGETDTGAIIVTFQGYISGVPSLFSTDFNTAFIFKNTEQAESFIKEFADELLNPQILDCP |
| Ga0207660_105498141 | 3300025917 | Corn Rhizosphere | VPSLFSTDFNTAFIFKNTEQAESFIKEFANELHNPQILDCP |
| Ga0207681_104583033 | 3300025923 | Switchgrass Rhizosphere | SGVPCLFSTDFNTAFIFKNTEQAAAFITEFADELHNPQILDCP |
| Ga0207650_109430351 | 3300025925 | Switchgrass Rhizosphere | IVTFQGYISGIPKLFSTDFNTAFIFKNREQAEAFITEFADELYNPQILDYR |
| Ga0207659_103587191 | 3300025926 | Miscanthus Rhizosphere | SLFSTDFNSAFIFQNTEQAEAFITEFADELHNPQILDYA |
| Ga0207686_100449392 | 3300025934 | Miscanthus Rhizosphere | FHGYISGVPNLFSTDFNSAFMFKNTEQAEAFVTEFADELHNPQILDCP |
| Ga0207709_101229661 | 3300025935 | Miscanthus Rhizosphere | TYQGYISGIPNLFSTDFNTAFVFKNTEQAEAFITEFADELHNPQIIDCP |
| Ga0207711_108327592 | 3300025941 | Switchgrass Rhizosphere | FSNDFNTAFVFKNKEQAEAFITEFADELHNPQILDCP |
| Ga0207689_114050762 | 3300025942 | Miscanthus Rhizosphere | VIIVTFQGYISGIPSLFSADFNMAFIFKNTGQAEAFIAEFSEELNNPQILNCA |
| Ga0207679_114313772 | 3300025945 | Corn Rhizosphere | SGIPRLFSTDFNTAFIFANREQAEAFITEFADELHNPQILDCP |
| Ga0207679_116557622 | 3300025945 | Corn Rhizosphere | VIIVTFQGYISGVPSLFSTDFNTAFIFRNTEQAETFITEFADELCSPQILDCP |
| Ga0207712_109814542 | 3300025961 | Switchgrass Rhizosphere | IIVTFQGYISGVPSLFSNDFSTAFIFKNAEQAESFIAEFADELNNPQILDCP |
| Ga0207639_109631731 | 3300026041 | Corn Rhizosphere | ISGVPSLFSADFNTAFIFKNTEQAEAFIKEFVDELHNPQILDCP |
| Ga0207641_101728771 | 3300026088 | Switchgrass Rhizosphere | GVIIVTFQGYISGVPTLFSRDFNTAFIFKDKEQAETFITEFADELHNPQTLLCL |
| Ga0207641_107431422 | 3300026088 | Switchgrass Rhizosphere | GYISGVPSLFSTDFNTAFIFKNTEQAESFIKEFTDELHNPQILDCP |
| Ga0207676_108631001 | 3300026095 | Switchgrass Rhizosphere | VTFQGYISGIPSLFSNDFDMAFVFKNKEQAEAFITEFADELHNPQILDCP |
| Ga0209215_10432112 | 3300027266 | Forest Soil | RIDAAGGETETGVIIVTFQGYISGVPSLFSSDFNTAFIFKNTGQAESFIKEFADELHNPQILDCP |
| Ga0209387_11688361 | 3300027639 | Agricultural Soil | TDFYTAFIFKNREQAEAFITEFADELYNPQILDYR |
| Ga0209074_105034441 | 3300027787 | Agricultural Soil | QGYISGVPSLFSTDFNTAFIFKNTEQAESFITEFADELHNPQILDCP |
| Ga0268265_112699271 | 3300028380 | Switchgrass Rhizosphere | AGGETETGVIIVTFQGYISGVPSLFSTDFNTAFIFRNTEQAESFIKEFTDELHNPQILDC |
| Ga0268264_105742073 | 3300028381 | Switchgrass Rhizosphere | GGETETGVIIVTFQGYISGVPSLFSTDFNAAFIFKDKEEAEAFITEFADELHNPQILDCC |
| Ga0268264_108536882 | 3300028381 | Switchgrass Rhizosphere | SGVPSLFSTDFNTAFIFKNTEQAEAFIAEFADELHNPQILDSP |
| Ga0310904_106068531 | 3300031854 | Soil | GVIIVTFHGYISGVPSLFSTDFNTAFIFKNTEQAETFIKEFADELHNPQILDCP |
| Ga0307406_113933222 | 3300031901 | Rhizosphere | VTFQGYISGVPSLFSSDFNTAFVFKNKEQAKAFITEFADELHNPQILDCP |
| Ga0307416_1035459992 | 3300032002 | Rhizosphere | TGVIIVTFQGYISGIPSLFSTDFNAAFIFKNTEQAESFITEFADELHNPQILDCP |
| Ga0307414_122981001 | 3300032004 | Rhizosphere | GGETETGVIIVTFQGYISGVPNLFSRDFNTAFIFKNTEQAEAFITEFADELHNPQILDCP |
| ⦗Top⦘ |