NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042885

Metagenome / Metatranscriptome Family F042885

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042885
Family Type Metagenome / Metatranscriptome
Number of Sequences 157
Average Sequence Length 45 residues
Representative Sequence VSFDDWLLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPDGTIR
Number of Associated Samples 140
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.18 %
% of genes near scaffold ends (potentially truncated) 98.09 %
% of genes from short scaffolds (< 2000 bps) 96.82 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.803 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.019 % of family members)
Environment Ontology (ENVO) Unclassified
(26.115 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.955 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.11%    β-sheet: 0.00%    Coil/Unstructured: 47.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF13185GAF_2 30.57
PF069833-dmu-9_3-mt 10.19
PF00664ABC_membrane 3.82
PF12697Abhydrolase_6 2.55
PF10027DUF2269 1.91
PF00211Guanylate_cyc 1.91
PF12146Hydrolase_4 1.91
PF03411Peptidase_M74 1.27
PF02012BNR 1.27
PF13417GST_N_3 1.27
PF01872RibD_C 1.27
PF07885Ion_trans_2 0.64
PF05425CopD 0.64
PF13492GAF_3 0.64
PF12840HTH_20 0.64
PF13229Beta_helix 0.64
PF03631Virul_fac_BrkB 0.64
PF03861ANTAR 0.64
PF13460NAD_binding_10 0.64
PF00248Aldo_ket_red 0.64
PF01183Glyco_hydro_25 0.64
PF13551HTH_29 0.64
PF00528BPD_transp_1 0.64
PF00005ABC_tran 0.64
PF00589Phage_integrase 0.64
PF11821ActD 0.64
PF02371Transposase_20 0.64
PF04542Sigma70_r2 0.64
PF10646Germane 0.64
PF13376OmdA 0.64
PF03795YCII 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 157 Family Scaffolds
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 10.19
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 10.19
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.91
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.27
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.27
COG3770Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase)Cell wall/membrane/envelope biogenesis [M] 1.27
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.64
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.64
COG1276Putative copper export proteinInorganic ion transport and metabolism [P] 0.64
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.64
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.64
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.64
COG3547TransposaseMobilome: prophages, transposons [X] 0.64
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.64
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 0.64
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.44 %
UnclassifiedrootN/A16.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF02JF3WMAll Organisms → cellular organisms → Bacteria513Open in IMG/M
3300000858|JGI10213J12805_11024022Not Available536Open in IMG/M
3300000890|JGI11643J12802_11422861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300000891|JGI10214J12806_11397824All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300000891|JGI10214J12806_12805714All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300001139|JGI10220J13317_10085683All Organisms → cellular organisms → Bacteria → Terrabacteria group701Open in IMG/M
3300003997|Ga0055466_10050145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1031Open in IMG/M
3300004114|Ga0062593_102900602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300004114|Ga0062593_103341024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300004157|Ga0062590_102788487Not Available522Open in IMG/M
3300004479|Ga0062595_101362543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300004643|Ga0062591_101662100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300005093|Ga0062594_100179766Not Available1440Open in IMG/M
3300005332|Ga0066388_107180504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300005364|Ga0070673_100410653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1212Open in IMG/M
3300005435|Ga0070714_102390954Not Available513Open in IMG/M
3300005441|Ga0070700_100311835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1152Open in IMG/M
3300005457|Ga0070662_101646800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300005558|Ga0066698_10773380Not Available625Open in IMG/M
3300005564|Ga0070664_100637621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300005577|Ga0068857_101639904All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005713|Ga0066905_101812346Not Available563Open in IMG/M
3300005764|Ga0066903_102833018Not Available941Open in IMG/M
3300005764|Ga0066903_105256418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani685Open in IMG/M
3300005937|Ga0081455_10137371All Organisms → cellular organisms → Bacteria1903Open in IMG/M
3300006028|Ga0070717_10140446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2083Open in IMG/M
3300006048|Ga0075363_100919054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300006576|Ga0074047_12072972Not Available1638Open in IMG/M
3300006804|Ga0079221_11567463All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006806|Ga0079220_10583193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300006844|Ga0075428_100315474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1680Open in IMG/M
3300006854|Ga0075425_100564146All Organisms → cellular organisms → Bacteria → Terrabacteria group1310Open in IMG/M
3300006854|Ga0075425_100602309All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300006876|Ga0079217_10872848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300006880|Ga0075429_101371851All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300006881|Ga0068865_101140546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300006894|Ga0079215_11566650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300006904|Ga0075424_100661680All Organisms → cellular organisms → Bacteria → Terrabacteria group1115Open in IMG/M
3300007004|Ga0079218_11970044All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300009012|Ga0066710_103233983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300009094|Ga0111539_11357839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium825Open in IMG/M
3300009100|Ga0075418_12318748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300009100|Ga0075418_12920769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300009147|Ga0114129_12624448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300009147|Ga0114129_13070705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300009156|Ga0111538_11878435All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300009156|Ga0111538_12207783All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300009156|Ga0111538_12573176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300009174|Ga0105241_10549932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1036Open in IMG/M
3300009553|Ga0105249_10202204All Organisms → cellular organisms → Eukaryota1945Open in IMG/M
3300009822|Ga0105066_1133872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300010037|Ga0126304_10121763All Organisms → cellular organisms → Bacteria1667Open in IMG/M
3300010037|Ga0126304_10721908Not Available674Open in IMG/M
3300010046|Ga0126384_11143284All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
3300010301|Ga0134070_10266811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300010358|Ga0126370_11553274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium631Open in IMG/M
3300010359|Ga0126376_11946891Not Available628Open in IMG/M
3300010361|Ga0126378_11961154All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300010362|Ga0126377_12970276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300010366|Ga0126379_11493271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300010366|Ga0126379_13228025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300010371|Ga0134125_12195516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300010371|Ga0134125_12310093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → unclassified Sporichthyaceae → Sporichthyaceae bacterium585Open in IMG/M
3300011107|Ga0151490_1623987Not Available615Open in IMG/M
3300011412|Ga0137424_1108966All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium572Open in IMG/M
3300011440|Ga0137433_1199325Not Available656Open in IMG/M
3300011440|Ga0137433_1251371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300012022|Ga0120191_10062576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300012091|Ga0136625_1003292All Organisms → cellular organisms → Bacteria5908Open in IMG/M
3300012091|Ga0136625_1263118Not Available582Open in IMG/M
3300012358|Ga0137368_10001335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria25972Open in IMG/M
3300012360|Ga0137375_10215626All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300012901|Ga0157288_10378611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300012904|Ga0157282_10122146All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012909|Ga0157290_10371097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300012948|Ga0126375_11765686All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300012955|Ga0164298_11580221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea516Open in IMG/M
3300012961|Ga0164302_10401731Not Available935Open in IMG/M
3300012987|Ga0164307_10672052Not Available808Open in IMG/M
3300012989|Ga0164305_11314442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300013307|Ga0157372_10447684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1505Open in IMG/M
3300014318|Ga0075351_1106163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300014326|Ga0157380_12156853Not Available621Open in IMG/M
3300014965|Ga0120193_10032669All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300015077|Ga0173483_10230869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium870Open in IMG/M
3300015200|Ga0173480_10125175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1281Open in IMG/M
3300015200|Ga0173480_11164841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300015201|Ga0173478_10262915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium761Open in IMG/M
3300015359|Ga0134085_10102348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1190Open in IMG/M
3300015372|Ga0132256_101691583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300015373|Ga0132257_101792966All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300015374|Ga0132255_103163005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia702Open in IMG/M
3300017974|Ga0187777_10071671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2248Open in IMG/M
3300018054|Ga0184621_10139148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300018056|Ga0184623_10251222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300018073|Ga0184624_10197908Not Available896Open in IMG/M
3300018076|Ga0184609_10289825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300018081|Ga0184625_10647057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300018422|Ga0190265_10689488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1143Open in IMG/M
3300018432|Ga0190275_11454086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300018469|Ga0190270_10261508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1514Open in IMG/M
3300018469|Ga0190270_13376466Not Available506Open in IMG/M
3300018482|Ga0066669_11823725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300019487|Ga0187893_10270563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1233Open in IMG/M
3300020020|Ga0193738_1192313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300020215|Ga0196963_10393144Not Available621Open in IMG/M
3300021073|Ga0210378_10038502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591898Open in IMG/M
3300021073|Ga0210378_10389517All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300021475|Ga0210392_10840713Not Available686Open in IMG/M
3300021478|Ga0210402_10580176All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1040Open in IMG/M
3300022756|Ga0222622_10139831Not Available1548Open in IMG/M
3300022915|Ga0247790_10088782All Organisms → cellular organisms → Bacteria → Terrabacteria group751Open in IMG/M
3300023102|Ga0247754_1004542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2686Open in IMG/M
3300024246|Ga0247680_1025414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium858Open in IMG/M
3300025327|Ga0209751_10607258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta879Open in IMG/M
3300025893|Ga0207682_10392046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300025911|Ga0207654_10385941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales971Open in IMG/M
3300025927|Ga0207687_10221952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1489Open in IMG/M
3300025931|Ga0207644_10739862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
3300025945|Ga0207679_10523172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1061Open in IMG/M
3300025949|Ga0207667_10819224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300025981|Ga0207640_10261686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1348Open in IMG/M
3300025986|Ga0207658_11120734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium719Open in IMG/M
3300026023|Ga0207677_11294973Not Available669Open in IMG/M
3300026035|Ga0207703_11863209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300026062|Ga0208654_1017713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium894Open in IMG/M
3300026075|Ga0207708_10937403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300027511|Ga0209843_1090057All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300027650|Ga0256866_1148526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300027775|Ga0209177_10438876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
(restricted) 3300027799|Ga0233416_10192666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta699Open in IMG/M
3300027821|Ga0209811_10120437All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300027873|Ga0209814_10223124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium815Open in IMG/M
3300028587|Ga0247828_10837166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300028589|Ga0247818_10222566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1243Open in IMG/M
3300028712|Ga0307285_10217673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300028713|Ga0307303_10040993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300028716|Ga0307311_10194861All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300028716|Ga0307311_10198135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300028717|Ga0307298_10088341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300028722|Ga0307319_10156836All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300028771|Ga0307320_10476186Not Available504Open in IMG/M
3300028811|Ga0307292_10195312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300028819|Ga0307296_10364522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300028876|Ga0307286_10420428Not Available503Open in IMG/M
3300028878|Ga0307278_10109209All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300028884|Ga0307308_10496841All Organisms → cellular organisms → Bacteria → Terrabacteria group585Open in IMG/M
3300028885|Ga0307304_10231109All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300030336|Ga0247826_10838503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300031199|Ga0307495_10265914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300031455|Ga0307505_10188082Not Available950Open in IMG/M
3300031911|Ga0307412_11980582All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300031939|Ga0308174_10964497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300032075|Ga0310890_11396349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300032898|Ga0335072_10949667Not Available797Open in IMG/M
3300033475|Ga0310811_11084698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300034354|Ga0364943_0298349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.02%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.55%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.91%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.27%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.27%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.27%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.27%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.27%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.27%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.27%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.64%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.64%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.64%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.64%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.64%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.64%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FE1_028942702189573002Grass SoilMLALHVLAAFSLVSGSILFWVLVVAVRRIDTPDDTLR
JGI10213J12805_1102402223300000858SoilVSFDDWMLALHVLSAFAFVAGIIFFWVLILAARQI
JGI11643J12802_1142286133300000890SoilVSFNDWLLALHVLTAFAYVAGVVLFWILIVAVRRIDTPEETI
JGI10214J12806_1139782413300000891SoilVSFDDWILALHVLSAFSYVAGVVLFWVLVVAVRGTDTPDGTIRM
JGI10214J12806_1280571413300000891SoilVSFDDWLLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPDGTIR
JGI10220J13317_1008568313300001139SoilVSFNDWLLALHVLSAFAYVAGVVLFWILIVAVRRIDTPEETIRMGP
Ga0055466_1005014513300003997Natural And Restored WetlandsVSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPDGTIRL
Ga0062593_10290060213300004114SoilVSFDDWALALHVLSAFAYVGGMVLFWVLIVAVRKVATPQETIRMEP
Ga0062593_10334102423300004114SoilVSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPDGTIRLGP
Ga0062590_10278848723300004157SoilVGFDQWMLAFHVLSAFSLIAGLILFWVLIVVGRNIDTPGDTLR
Ga0062595_10136254313300004479SoilVSLNDWILSFHLLSAFAYVAGMVLFWVLIVAVRRADTPAA
Ga0062591_10166210023300004643SoilVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMA
Ga0062594_10017976623300005093SoilVSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIRMAPVVKVGTIGT
Ga0066388_10718050423300005332Tropical Forest SoilVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTTRMAPVVKIG
Ga0070673_10041065313300005364Switchgrass RhizosphereVTFLDWALVVHVLSAFAYVGGLVVFWVLIVAVRSVDRPAETLRMEPIVKVGGAAV
Ga0070714_10239095423300005435Agricultural SoilVSFVDWALVVHVLSAFAYVAGLVVFWVLIVAVRKTDTPAETLRMEPIVK
Ga0070700_10031183513300005441Corn, Switchgrass And Miscanthus RhizosphereVGFDDWILALHVLSAFSLVAGLVLFWALIVVGRRIDTPADTLALSPV
Ga0070662_10164680013300005457Corn RhizosphereVRFDDWMLALHVLSAFSLVAGIVLFWVLIFVGWRTDTPEGTLV
Ga0066698_1077338023300005558SoilVSFDQWMISLHVLAAFSLVAGSTLFWVLVVAVRRID
Ga0070664_10063762123300005564Corn RhizosphereVSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTDTADGTIRMAPVVKV
Ga0068857_10163990423300005577Corn RhizosphereVSFDDWILALHVLSAFSYVAGVVLFWVLVVAVRGTDTPDGTIRMDPVAKVGNAAV
Ga0066905_10181234623300005713Tropical Forest SoilVSFNQWVLAFHVLSAFAYVAAVVLFWILIVAVRRIDTPEATIRMEPIVKVG
Ga0066903_10283301823300005764Tropical Forest SoilVSFVDWALAFHVLAAFSYVGGIVLFWVLVVAVRRVDTAEETLR*
Ga0066903_10525641813300005764Tropical Forest SoilMSFDDWALALHVLSAFAYVGGMVLFWILIVAVRRIETPEETIRMEPIVKVG
Ga0081455_1013737133300005937Tabebuia Heterophylla RhizosphereVSLDDWILVLHVLAAFAFVAGMVVFWMLIYAVRRTDTPEGTIRMEPIV
Ga0070717_1014044643300006028Corn, Switchgrass And Miscanthus RhizosphereVSFDDWMLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPEETIRMEPIAKV
Ga0075363_10091905423300006048Populus EndosphereVSFNDWLLALHVLSAFAYVAGVVLFWILVVAVRRIDTPEETIRMG
Ga0074047_1207297213300006576SoilVSFDDWILALHVLSAFAYVAGMVVFWVLIVAVRKTDTPDGTIRMGPIV
Ga0079221_1156746313300006804Agricultural SoilVGFDEWLLALHVLSAFAYVAGIVLFWILIVAVRNIDTPEETIRMGPIVKVGNVVVGI
Ga0079220_1058319323300006806Agricultural SoilVSFVDWALALHVLSAFAYVAGLVLFWVLVVAVRRVDTPDETLRM
Ga0075428_10031547423300006844Populus RhizosphereVSFNDWLLALHVLSAFAYVAGVVLFWILVVAVRRIDTPEETIR
Ga0075425_10056414633300006854Populus RhizosphereVSFDAWMLALHVLSAFAYVAGIILFWVLIVAVRKTDTPDKTIRMEPIVKVGNAA
Ga0075425_10060230933300006854Populus RhizosphereVSFDDWLLALHVLSAFAYVGGIVLFWVLVVAVRKTDTPDGTIRMEPIVKVGNVAV
Ga0079217_1087284823300006876Agricultural SoilVSFDDWMLALHVLSAFALVAGVIFFWVLIVEVRRTDTPER
Ga0075429_10137185113300006880Populus RhizosphereMTFDDWLLALHVLSAAAFVAGVIVFWVVILAAREAATPGET
Ga0068865_10114054613300006881Miscanthus RhizosphereVHLDDWILALHVLSAFSLVAGLVVFWALIVIGRRT
Ga0079215_1156665023300006894Agricultural SoilVSLDEWILALHVLSAFAFVAGLILFWVLIVAVRKTDTPDGTIRM
Ga0075424_10066168033300006904Populus RhizosphereMLALHVLSAFAYVAGIILFWVLIVAVRKTDTPDKTIR
Ga0079218_1197004413300007004Agricultural SoilVSFDDWVLALHVLSAFAWVAGIVLFWILIVAVRRTDTAEGTIRTEPV
Ga0066710_10323398313300009012Grasslands SoilVSFDEWVLALHVLSAFAYVGGIVLFWILIVAVRGIDTP
Ga0111539_1135783913300009094Populus RhizosphereVSFDDWLLVLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIRMEPIVRV
Ga0075418_1231874823300009100Populus RhizosphereVRFDDWMLALHVLSAFSYVAGVVLFWVLIVAVRRTD
Ga0075418_1292076913300009100Populus RhizosphereVSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRKTDTPDGTIRM
Ga0114129_1262444813300009147Populus RhizosphereVSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIRMAPVVKVGT
Ga0114129_1307070513300009147Populus RhizosphereVSFDDWLLALHVLSAFAYVGGIVLFWVLVVAVRKTDTPDGTIRMEPIVKVGNVA
Ga0111538_1187843513300009156Populus RhizosphereVTFDDWILALHVLSAATYGASIILFWWLVVAVRSTDTAEGTLR
Ga0111538_1220778323300009156Populus RhizosphereVSFDDWVLALHVLSAFSLVAGIVLFWVTIVAVRRIDTPG
Ga0111538_1257317613300009156Populus RhizosphereVSFDDWLLLLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIRMEPIVRV
Ga0105241_1054993213300009174Corn RhizosphereVTFLDWALVVHVLSAFAYVGGLVVFWVLIVAVRSVDTPAETLRMEPIVKVG
Ga0105249_1020220413300009553Switchgrass RhizosphereVSFNDWLVALHVLSAFAYVAGVVLFWILVVAVRRIDTPEE
Ga0105066_113387223300009822Groundwater SandVSFDDWILALHVLSAFSYVAGTVLFWVLVVAVRRTD
Ga0126304_1012176333300010037Serpentine SoilVSFDDWMLALHVLSAFSYVAGLVLFWVLIVAARRTDTPG
Ga0126304_1072190813300010037Serpentine SoilVTLDDWIVALHVLSAFAYVAAIVLFWVLIVAVRRLDTPDP
Ga0126384_1114328423300010046Tropical Forest SoilVSFNDWLLALHVLSAFSYVAGIVLFWILIVAVRKIDTPEETIRME
Ga0134070_1026681123300010301Grasslands SoilVSFDDWVVALHVLSAFAYIGGIVLFWILVVAVRTIHTPGATIRME
Ga0126370_1155327413300010358Tropical Forest SoilVSFVEWALAVHVLSAFAYVGGIVLFWVLVVAVRRVDTADETLRMEPIVKVGNV
Ga0126376_1194689123300010359Tropical Forest SoilVSFVDWALVVHVLSAFAYVGGLIVFWVLVFAVRRTDTPAETMRME
Ga0126378_1196115423300010361Tropical Forest SoilVSFDEWVLALHVLSAFAYVGGIVLFWILIVAVRQIDTPGETIRMAPIVKVGNVAV
Ga0126377_1297027623300010362Tropical Forest SoilMTWTDWLLAFHLWSAFAYVAGMVLFWVLIVAVRRVDTPAATIEMEPIVKVGTIAT
Ga0126379_1149327113300010366Tropical Forest SoilVRFTDWIFALHLLSAFSLIAGLVIFWVLIVAGRTIDTPGDT
Ga0126379_1322802513300010366Tropical Forest SoilMSFDQWALALHVLSAFAYVGGMVLFWILIVAVRKVATPRETIRMEPIVKVGNVAV
Ga0134125_1219551613300010371Terrestrial SoilVSFDDWILALHLLSAFAYVAGMVVFWVLIYAIRKTDTPEGTIRMAPVVRVGIVGT
Ga0134125_1231009313300010371Terrestrial SoilVSFVDWALAVHVLSAFAYVGGLVVFWVLIAAVRRVDTPQETLRMEPI
Ga0151490_162398723300011107SoilVGFNQWMLAFHVLSAFSLVAGSTLFWVLVVAVRRIDT
Ga0137424_110896613300011412SoilVSFDDWVLALHVLSAFSLVAGIVLFWVLVVVGRRIDTPADTLRLSPI
Ga0137433_119932523300011440SoilVSFDDWLLALHVLSAFALVAGLILFWVLIIAVRRTDTPDGTIRMAPVAKVGNAAAG
Ga0137433_125137123300011440SoilVSFDDWVLALHVLSAVAYGAGIILFWVLVVAVRTTDTAEGTL
Ga0120191_1006257613300012022TerrestrialVSFDDWILALHVLSAFAYVAGMVLFWILIVAVRRTDLPDGTIRMAP
Ga0136625_100329263300012091Polar Desert SandVSFDDWILALHVLSAFAFVGGIVLFWVLIVASRSIDTAADTIR
Ga0136625_126311823300012091Polar Desert SandVSVDDWILALHVLSAFAFVGGIVLFWVLIVASRSIDTAADTIR
Ga0137368_1000133513300012358Vadose Zone SoilMSFDDWMLALHVLSAFAWVAGIIVFWVLIAAVRQTDTPEGTIR
Ga0137375_1021562613300012360Vadose Zone SoilVSFDDSIRALHVLSAFAYVAGLVLLWIVVVAVRRTGLREGTGRMAPVVKV
Ga0157288_1037861113300012901SoilLSFDDWLLVLHVLSAFAFVAGMVVFWVLIVAVRRTDTPQGTIRMAPIV
Ga0157282_1012214623300012904SoilVSFDDWILALHVLSAFSYVAGVVLFWVLVVAVRGTDTPDGTIRMDPVAKVG
Ga0157290_1037109713300012909SoilVSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPDGTIRLGPVVKVGNAS
Ga0126375_1176568623300012948Tropical Forest SoilVSFDDWMLALHVLSAFSYVAGIVLFWVLIVAVRKTDTPEGTIRMEPIVKVG
Ga0164298_1158022123300012955SoilVSLDDWILALHLLAAFALVASMVGFWTVVVAARTAERPSGV
Ga0164302_1040173133300012961SoilVRFNDWMLALHVLAAFSLVAGSILFWVLVVAVRRID
Ga0164307_1067205223300012987SoilVGFNQWMLAFHVLSAFSLVAGSTLFWVLVVAVRRIDTPDDTLRLG
Ga0164305_1131444223300012989SoilVRFDDWMLARHVLSAFSLVAGLILFWALIVVGRRIDTPEAT
Ga0157372_1044768433300013307Corn RhizosphereVSFVDWALAVHVLSAFAYAAGLVLVWVVVVFVRRVDTP*
Ga0075351_110616323300014318Natural And Restored WetlandsMTYDWLLALHVVSAFVMTAALVLFTVLVIAVRRLDSPS
Ga0157380_1215685313300014326Switchgrass RhizosphereVRFDDWMLALHVLSAFSLVAGIVLFWVLIFVGWRTDTPEGTL
Ga0120193_1003266913300014965TerrestrialVSFDDWMLALHVLSAFALVAGIIFFWVLIVEVRRTDTPEGTLRLGPLSRIAETTV
Ga0173483_1023086923300015077SoilVSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPD
Ga0173480_1012517513300015200SoilVSFDDWLLVLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIR
Ga0173480_1116484113300015200SoilVSFVHWALVVHVLSAFAYVGGLVVFWVLIVAVRSVDTPAETLRMEPIVKV
Ga0173478_1026291523300015201SoilVSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTDTADGTIRMA
Ga0134085_1010234833300015359Grasslands SoilVSFDQWMISLHVLAAFSLVAGSILFWVLVVAVRRIDTPDDTLRLGP
Ga0132256_10169158323300015372Arabidopsis RhizosphereVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRKTD
Ga0132257_10179296623300015373Arabidopsis RhizosphereVSLDDWLLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPDG
Ga0132255_10316300513300015374Arabidopsis RhizosphereVRFDDWMLALHVLSAFALVAGLILFWTLIVVGRRMDTPE
Ga0187777_1007167113300017974Tropical PeatlandVSFDDWALAVHVLSAFAYVGGIVLFWVLVVAVRRVDTPEGTLRM
Ga0184621_1013914813300018054Groundwater SedimentVTFDDWVLALHVLSAFAYAAGIVLFWVLVVAVRQTDTPEGTIRLEP
Ga0184623_1025122223300018056Groundwater SedimentVSFDDWILSLHVLSAFAYVAGIVLFWILIVAVRRTDSPDGTIRMEPIVKVG
Ga0184624_1019790833300018073Groundwater SedimentVGFNQWMLALHVLAAFSLVAGSTLFWVLVVAIRRIDTP
Ga0184609_1028982513300018076Groundwater SedimentVSFDDWILALHVLSAFAYVAGVVLFWVLVVAVRRTDTPEGTIRMEPVVKVGNAAVGI
Ga0184625_1064705713300018081Groundwater SedimentVSFDDWMLALHVLSAFAMVAGMTLFWVLVVAGWRTDTPADILRMGPLS
Ga0190265_1068948823300018422SoilVSLDDWILAVHVLSGFAYVGAIVLFWTLIVAVRRTDT
Ga0190275_1145408623300018432SoilVSLDDWILALHVLSAFAYVAGIVLFWVLVVAVRKADTPDGTI
Ga0190270_1026150823300018469SoilVSFDDWMLALHVLSAFAMVAGMTLFWVLVVAGWRTDTPA
Ga0190270_1337646623300018469SoilVSFDDWVLALHVLAAFSLVAGIVLFWVLVVVGRRIDTPADTL
Ga0066669_1182372513300018482Grasslands SoilVSFDAWVLALHVLSAFAYIAGVVLFWILIIAVRRIDTPEE
Ga0187893_1027056323300019487Microbial Mat On RocksVSLDQWILALHVLSAFAYVAAIVLFWVLAVAVRATDTPDGTLRMGPI
Ga0193738_119231313300020020SoilVSFDDWILALHVLSAFAYVAGVVLFWILVVAVRKTDTPDGTIRMEPVVKVGNASVGI
Ga0196963_1039314413300020215SoilVSFDDWMLALHVVSAFAFGGAIVLFWVLIVAVRRTDSPEY
Ga0210378_1003850213300021073Groundwater SedimentVSFDDWILALHVLSAFAYVAGVVLFWVLVVAVRRTDTP
Ga0210378_1038951723300021073Groundwater SedimentVSLDDWILALHVLSAFAYVAGIVLFWILVVAIRQIDTPEGTIRLWPVVKVGN
Ga0210392_1084071323300021475SoilVSFVDWALALHVLSAFAYMGAIVLFWVLIVAVRRI
Ga0210402_1058017613300021478SoilVSFDDWALVVHVLSAFAYVAGIVLFWVLIVAVRSVDTAEE
Ga0222622_1013983123300022756Groundwater SedimentVSFDDWILALHVLSAFAYVAGMVLFWVLIVAVRRTDTPEGNIRMGPAVM
Ga0247790_1008878223300022915SoilVSFNDWLLALHVLSAFAYVAGVVLFWILIVAVRRID
Ga0247754_100454243300023102SoilVSFDDWLLVLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIRMEPIVKV
Ga0247680_102541423300024246SoilVSFVDWALVVHVLSAFAYVAGLVVFWVLIVAVRKTDTPAETLRMEPI
Ga0209751_1060725823300025327SoilVSLDDWILSLHVLSAFAYVAGIVLFWVLVVAVRRIDTPEGTIR
Ga0207682_1039204613300025893Miscanthus RhizosphereVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPVVKVGTIGT
Ga0207654_1038594113300025911Corn RhizosphereVTFLDWALAVHVLSAFAYVGGLVVFWVLIVAVRSVDTP
Ga0207687_1022195223300025927Miscanthus RhizosphereVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPVVKV
Ga0207644_1073986223300025931Switchgrass RhizosphereVDFYDWMLALHVLSAFAYVGGIVLFWVLVVAVRKTDTPEGTIRME
Ga0207679_1052317213300025945Corn RhizosphereVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTETPEGTI
Ga0207667_1081922413300025949Corn RhizosphereVTFLDWALAVHVLSAFAYVGGLVVFWVLIVAVRSVDTPAETLRMEPIVKVGG
Ga0207640_1026168623300025981Corn RhizosphereVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPV
Ga0207658_1112073413300025986Switchgrass RhizosphereVSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIR
Ga0207677_1129497323300026023Miscanthus RhizosphereVRFDDWMLALHVLSAFSLVAGIVLFWVLIFVGWRTDTPEGTLVLNPVAKV
Ga0207703_1186320923300026035Switchgrass RhizosphereLSFDDWVLALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPVVKI
Ga0208654_101771323300026062Natural And Restored WetlandsVSLDEWILALHVLSAFAYVAGMIVFWVLVVAVRRTDTPDETIRMGPIVKVGN
Ga0207708_1093740323300026075Corn, Switchgrass And Miscanthus RhizosphereVSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTDTADGTIR
Ga0209843_109005713300027511Groundwater SandVTFDDWILALHVLSAFAFVAGMVIFWVLIVAVRRTDTPEGT
Ga0256866_114852613300027650SoilVSFDDSMLALHVVSAFAFVAAVVLFWVLVVAVRRTDSPAVTAGVEPIVTV
Ga0209177_1043887623300027775Agricultural SoilVSFVDWALALHVLSAFAYVAGLVLFWVLVVAVRRVDTPDET
(restricted) Ga0233416_1019266623300027799SedimentVSLDDWILALHVLSAFALVSGMVLFWIVIVAVRNVDTVGQT
Ga0209811_1012043713300027821Surface SoilVRFDDWMLALHVLSAFSLVAGLVVFWALIVVGRRIDTPEGTLSL
Ga0209814_1022312423300027873Populus RhizosphereMSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRRTDTPD
Ga0247828_1083716613300028587SoilVTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIR
Ga0247818_1022256633300028589SoilVSFDDWVLALHVLSAFALVAGLVLFWVIVVAVRRIDTPGDTLRLGPIAKVGN
Ga0307285_1021767313300028712SoilVTVDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIRM
Ga0307303_1004099333300028713SoilVGFDDWILALHVLSAFSLVAGLVLFWALIVVGRRIDT
Ga0307311_1019486123300028716SoilVSFDDWLLALHVIGAFAYVAGVVLFWILVVAVRKVDTPEGTIRMEPIVKVGNVAV
Ga0307311_1019813523300028716SoilVTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTMRMEPI
Ga0307298_1008834123300028717SoilVTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTVRMGPIVKIG
Ga0307319_1015683623300028722SoilVSFDDWVLALHVLSAFAYVAGVVLFWVLVVAVRRTDTPEGTIRMAP
Ga0307320_1047618623300028771SoilVTFDDWVLALHVLSAVAYGAGIILFWVLVVAVRTTDTAEGTLRLTPS
Ga0307292_1019531223300028811SoilVTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDG
Ga0307296_1036452213300028819SoilVTFDDWVLALHVLSAFAYAAGIVLFWVLVVAVRQTDTPEGTIRMEPVV
Ga0307286_1042042813300028876SoilVSFDDWMLALHVVSAFVLVAGLVLFWVLIVAVRRIGTPGATLAMGPLTKVADA
Ga0307278_1010920913300028878SoilMTFDSWILALHVLSAFAYVAGMVLFWVLVVAVRRTDTPAGTIRH
Ga0307308_1049684113300028884SoilLSFDDWMLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPEGT
Ga0307304_1023110913300028885SoilMTFDSWILALHVLSAFAYVAGMVLFWVLVVAVRRTDTPAGTIRME
Ga0247826_1083850313300030336SoilVSFDQWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTADGTIR
Ga0307495_1026591423300031199SoilVSFVDWALAVHVLSAFAYVGGLVLFWVLIVAVRRVDTPEQT
Ga0307505_1018808213300031455SoilVGFNQWMLALHVLAAFSLVAGSTLFWVLIVAVRRIDTP
Ga0307412_1198058213300031911RhizosphereVSFDEWLMALHVLSAFAYVAGVVLFWMLIVAVRKIDT
Ga0308174_1096449723300031939SoilVSFVDWALAVHVLSAFAYVGGLVVFWVLIAAVRRVDTPQETLRM
Ga0310890_1139634913300032075SoilVSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTD
Ga0335072_1094966723300032898SoilVSFVQWALAVHVLSAFAYVAGIVLFWVLVVAVRRVDTPEETLRM
Ga0310811_1108469823300033475SoilVRFDDWMLALHVLSAFSLVAGLILFWTLIVVGRRMDTPVATLSLS
Ga0364943_0298349_475_6093300034354SedimentVSFDDWMLALHVLSAFAYVAGIVLFWVLVVVVRRTDAPDGTIRMG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.