| Basic Information | |
|---|---|
| Family ID | F042885 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VSFDDWLLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPDGTIR |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.18 % |
| % of genes near scaffold ends (potentially truncated) | 98.09 % |
| % of genes from short scaffolds (< 2000 bps) | 96.82 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.803 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.019 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.115 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.955 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF13185 | GAF_2 | 30.57 |
| PF06983 | 3-dmu-9_3-mt | 10.19 |
| PF00664 | ABC_membrane | 3.82 |
| PF12697 | Abhydrolase_6 | 2.55 |
| PF10027 | DUF2269 | 1.91 |
| PF00211 | Guanylate_cyc | 1.91 |
| PF12146 | Hydrolase_4 | 1.91 |
| PF03411 | Peptidase_M74 | 1.27 |
| PF02012 | BNR | 1.27 |
| PF13417 | GST_N_3 | 1.27 |
| PF01872 | RibD_C | 1.27 |
| PF07885 | Ion_trans_2 | 0.64 |
| PF05425 | CopD | 0.64 |
| PF13492 | GAF_3 | 0.64 |
| PF12840 | HTH_20 | 0.64 |
| PF13229 | Beta_helix | 0.64 |
| PF03631 | Virul_fac_BrkB | 0.64 |
| PF03861 | ANTAR | 0.64 |
| PF13460 | NAD_binding_10 | 0.64 |
| PF00248 | Aldo_ket_red | 0.64 |
| PF01183 | Glyco_hydro_25 | 0.64 |
| PF13551 | HTH_29 | 0.64 |
| PF00528 | BPD_transp_1 | 0.64 |
| PF00005 | ABC_tran | 0.64 |
| PF00589 | Phage_integrase | 0.64 |
| PF11821 | ActD | 0.64 |
| PF02371 | Transposase_20 | 0.64 |
| PF04542 | Sigma70_r2 | 0.64 |
| PF10646 | Germane | 0.64 |
| PF13376 | OmdA | 0.64 |
| PF03795 | YCII | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 10.19 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 10.19 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.91 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.27 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.27 |
| COG3770 | Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase) | Cell wall/membrane/envelope biogenesis [M] | 1.27 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.64 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.64 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.64 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.64 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.64 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.64 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.64 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.44 % |
| Unclassified | root | N/A | 16.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF02JF3WM | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300000858|JGI10213J12805_11024022 | Not Available | 536 | Open in IMG/M |
| 3300000890|JGI11643J12802_11422861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300000891|JGI10214J12806_11397824 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300000891|JGI10214J12806_12805714 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300001139|JGI10220J13317_10085683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
| 3300003997|Ga0055466_10050145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1031 | Open in IMG/M |
| 3300004114|Ga0062593_102900602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300004114|Ga0062593_103341024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300004157|Ga0062590_102788487 | Not Available | 522 | Open in IMG/M |
| 3300004479|Ga0062595_101362543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300004643|Ga0062591_101662100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300005093|Ga0062594_100179766 | Not Available | 1440 | Open in IMG/M |
| 3300005332|Ga0066388_107180504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300005364|Ga0070673_100410653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1212 | Open in IMG/M |
| 3300005435|Ga0070714_102390954 | Not Available | 513 | Open in IMG/M |
| 3300005441|Ga0070700_100311835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1152 | Open in IMG/M |
| 3300005457|Ga0070662_101646800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300005558|Ga0066698_10773380 | Not Available | 625 | Open in IMG/M |
| 3300005564|Ga0070664_100637621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 990 | Open in IMG/M |
| 3300005577|Ga0068857_101639904 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005713|Ga0066905_101812346 | Not Available | 563 | Open in IMG/M |
| 3300005764|Ga0066903_102833018 | Not Available | 941 | Open in IMG/M |
| 3300005764|Ga0066903_105256418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 685 | Open in IMG/M |
| 3300005937|Ga0081455_10137371 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300006028|Ga0070717_10140446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2083 | Open in IMG/M |
| 3300006048|Ga0075363_100919054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300006576|Ga0074047_12072972 | Not Available | 1638 | Open in IMG/M |
| 3300006804|Ga0079221_11567463 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006806|Ga0079220_10583193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300006844|Ga0075428_100315474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1680 | Open in IMG/M |
| 3300006854|Ga0075425_100564146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1310 | Open in IMG/M |
| 3300006854|Ga0075425_100602309 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300006876|Ga0079217_10872848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300006880|Ga0075429_101371851 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006881|Ga0068865_101140546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300006894|Ga0079215_11566650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300006904|Ga0075424_100661680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1115 | Open in IMG/M |
| 3300007004|Ga0079218_11970044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300009012|Ga0066710_103233983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300009094|Ga0111539_11357839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
| 3300009100|Ga0075418_12318748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300009100|Ga0075418_12920769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300009147|Ga0114129_12624448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300009147|Ga0114129_13070705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300009156|Ga0111538_11878435 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300009156|Ga0111538_12207783 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300009156|Ga0111538_12573176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300009174|Ga0105241_10549932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1036 | Open in IMG/M |
| 3300009553|Ga0105249_10202204 | All Organisms → cellular organisms → Eukaryota | 1945 | Open in IMG/M |
| 3300009822|Ga0105066_1133872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300010037|Ga0126304_10121763 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300010037|Ga0126304_10721908 | Not Available | 674 | Open in IMG/M |
| 3300010046|Ga0126384_11143284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
| 3300010301|Ga0134070_10266811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300010358|Ga0126370_11553274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300010359|Ga0126376_11946891 | Not Available | 628 | Open in IMG/M |
| 3300010361|Ga0126378_11961154 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010362|Ga0126377_12970276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300010366|Ga0126379_11493271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300010366|Ga0126379_13228025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300010371|Ga0134125_12195516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300010371|Ga0134125_12310093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → unclassified Sporichthyaceae → Sporichthyaceae bacterium | 585 | Open in IMG/M |
| 3300011107|Ga0151490_1623987 | Not Available | 615 | Open in IMG/M |
| 3300011412|Ga0137424_1108966 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
| 3300011440|Ga0137433_1199325 | Not Available | 656 | Open in IMG/M |
| 3300011440|Ga0137433_1251371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300012022|Ga0120191_10062576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300012091|Ga0136625_1003292 | All Organisms → cellular organisms → Bacteria | 5908 | Open in IMG/M |
| 3300012091|Ga0136625_1263118 | Not Available | 582 | Open in IMG/M |
| 3300012358|Ga0137368_10001335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25972 | Open in IMG/M |
| 3300012360|Ga0137375_10215626 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300012901|Ga0157288_10378611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300012904|Ga0157282_10122146 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012909|Ga0157290_10371097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300012948|Ga0126375_11765686 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012955|Ga0164298_11580221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 516 | Open in IMG/M |
| 3300012961|Ga0164302_10401731 | Not Available | 935 | Open in IMG/M |
| 3300012987|Ga0164307_10672052 | Not Available | 808 | Open in IMG/M |
| 3300012989|Ga0164305_11314442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300013307|Ga0157372_10447684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1505 | Open in IMG/M |
| 3300014318|Ga0075351_1106163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300014326|Ga0157380_12156853 | Not Available | 621 | Open in IMG/M |
| 3300014965|Ga0120193_10032669 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300015077|Ga0173483_10230869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 870 | Open in IMG/M |
| 3300015200|Ga0173480_10125175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1281 | Open in IMG/M |
| 3300015200|Ga0173480_11164841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300015201|Ga0173478_10262915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300015359|Ga0134085_10102348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1190 | Open in IMG/M |
| 3300015372|Ga0132256_101691583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
| 3300015373|Ga0132257_101792966 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300015374|Ga0132255_103163005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300017974|Ga0187777_10071671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2248 | Open in IMG/M |
| 3300018054|Ga0184621_10139148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300018056|Ga0184623_10251222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300018073|Ga0184624_10197908 | Not Available | 896 | Open in IMG/M |
| 3300018076|Ga0184609_10289825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
| 3300018081|Ga0184625_10647057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300018422|Ga0190265_10689488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1143 | Open in IMG/M |
| 3300018432|Ga0190275_11454086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300018469|Ga0190270_10261508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1514 | Open in IMG/M |
| 3300018469|Ga0190270_13376466 | Not Available | 506 | Open in IMG/M |
| 3300018482|Ga0066669_11823725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300019487|Ga0187893_10270563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1233 | Open in IMG/M |
| 3300020020|Ga0193738_1192313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300020215|Ga0196963_10393144 | Not Available | 621 | Open in IMG/M |
| 3300021073|Ga0210378_10038502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1898 | Open in IMG/M |
| 3300021073|Ga0210378_10389517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300021475|Ga0210392_10840713 | Not Available | 686 | Open in IMG/M |
| 3300021478|Ga0210402_10580176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1040 | Open in IMG/M |
| 3300022756|Ga0222622_10139831 | Not Available | 1548 | Open in IMG/M |
| 3300022915|Ga0247790_10088782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300023102|Ga0247754_1004542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2686 | Open in IMG/M |
| 3300024246|Ga0247680_1025414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
| 3300025327|Ga0209751_10607258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 879 | Open in IMG/M |
| 3300025893|Ga0207682_10392046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300025911|Ga0207654_10385941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 971 | Open in IMG/M |
| 3300025927|Ga0207687_10221952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1489 | Open in IMG/M |
| 3300025931|Ga0207644_10739862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300025945|Ga0207679_10523172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1061 | Open in IMG/M |
| 3300025949|Ga0207667_10819224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
| 3300025981|Ga0207640_10261686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1348 | Open in IMG/M |
| 3300025986|Ga0207658_11120734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
| 3300026023|Ga0207677_11294973 | Not Available | 669 | Open in IMG/M |
| 3300026035|Ga0207703_11863209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300026062|Ga0208654_1017713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 894 | Open in IMG/M |
| 3300026075|Ga0207708_10937403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300027511|Ga0209843_1090057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300027650|Ga0256866_1148526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300027775|Ga0209177_10438876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10192666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 699 | Open in IMG/M |
| 3300027821|Ga0209811_10120437 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300027873|Ga0209814_10223124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
| 3300028587|Ga0247828_10837166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300028589|Ga0247818_10222566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1243 | Open in IMG/M |
| 3300028712|Ga0307285_10217673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300028713|Ga0307303_10040993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300028716|Ga0307311_10194861 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300028716|Ga0307311_10198135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300028717|Ga0307298_10088341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
| 3300028722|Ga0307319_10156836 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300028771|Ga0307320_10476186 | Not Available | 504 | Open in IMG/M |
| 3300028811|Ga0307292_10195312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
| 3300028819|Ga0307296_10364522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300028876|Ga0307286_10420428 | Not Available | 503 | Open in IMG/M |
| 3300028878|Ga0307278_10109209 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300028884|Ga0307308_10496841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
| 3300028885|Ga0307304_10231109 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300030336|Ga0247826_10838503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300031199|Ga0307495_10265914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300031455|Ga0307505_10188082 | Not Available | 950 | Open in IMG/M |
| 3300031911|Ga0307412_11980582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300031939|Ga0308174_10964497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300032075|Ga0310890_11396349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300032898|Ga0335072_10949667 | Not Available | 797 | Open in IMG/M |
| 3300033475|Ga0310811_11084698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300034354|Ga0364943_0298349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.02% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.27% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.27% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.27% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.27% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.27% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.64% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.64% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.64% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.64% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.64% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_02894270 | 2189573002 | Grass Soil | MLALHVLAAFSLVSGSILFWVLVVAVRRIDTPDDTLR |
| JGI10213J12805_110240222 | 3300000858 | Soil | VSFDDWMLALHVLSAFAFVAGIIFFWVLILAARQI |
| JGI11643J12802_114228613 | 3300000890 | Soil | VSFNDWLLALHVLTAFAYVAGVVLFWILIVAVRRIDTPEETI |
| JGI10214J12806_113978241 | 3300000891 | Soil | VSFDDWILALHVLSAFSYVAGVVLFWVLVVAVRGTDTPDGTIRM |
| JGI10214J12806_128057141 | 3300000891 | Soil | VSFDDWLLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPDGTIR |
| JGI10220J13317_100856831 | 3300001139 | Soil | VSFNDWLLALHVLSAFAYVAGVVLFWILIVAVRRIDTPEETIRMGP |
| Ga0055466_100501451 | 3300003997 | Natural And Restored Wetlands | VSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPDGTIRL |
| Ga0062593_1029006021 | 3300004114 | Soil | VSFDDWALALHVLSAFAYVGGMVLFWVLIVAVRKVATPQETIRMEP |
| Ga0062593_1033410242 | 3300004114 | Soil | VSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPDGTIRLGP |
| Ga0062590_1027884872 | 3300004157 | Soil | VGFDQWMLAFHVLSAFSLIAGLILFWVLIVVGRNIDTPGDTLR |
| Ga0062595_1013625431 | 3300004479 | Soil | VSLNDWILSFHLLSAFAYVAGMVLFWVLIVAVRRADTPAA |
| Ga0062591_1016621002 | 3300004643 | Soil | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMA |
| Ga0062594_1001797662 | 3300005093 | Soil | VSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIRMAPVVKVGTIGT |
| Ga0066388_1071805042 | 3300005332 | Tropical Forest Soil | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTTRMAPVVKIG |
| Ga0070673_1004106531 | 3300005364 | Switchgrass Rhizosphere | VTFLDWALVVHVLSAFAYVGGLVVFWVLIVAVRSVDRPAETLRMEPIVKVGGAAV |
| Ga0070714_1023909542 | 3300005435 | Agricultural Soil | VSFVDWALVVHVLSAFAYVAGLVVFWVLIVAVRKTDTPAETLRMEPIVK |
| Ga0070700_1003118351 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VGFDDWILALHVLSAFSLVAGLVLFWALIVVGRRIDTPADTLALSPV |
| Ga0070662_1016468001 | 3300005457 | Corn Rhizosphere | VRFDDWMLALHVLSAFSLVAGIVLFWVLIFVGWRTDTPEGTLV |
| Ga0066698_107733802 | 3300005558 | Soil | VSFDQWMISLHVLAAFSLVAGSTLFWVLVVAVRRID |
| Ga0070664_1006376212 | 3300005564 | Corn Rhizosphere | VSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTDTADGTIRMAPVVKV |
| Ga0068857_1016399042 | 3300005577 | Corn Rhizosphere | VSFDDWILALHVLSAFSYVAGVVLFWVLVVAVRGTDTPDGTIRMDPVAKVGNAAV |
| Ga0066905_1018123462 | 3300005713 | Tropical Forest Soil | VSFNQWVLAFHVLSAFAYVAAVVLFWILIVAVRRIDTPEATIRMEPIVKVG |
| Ga0066903_1028330182 | 3300005764 | Tropical Forest Soil | VSFVDWALAFHVLAAFSYVGGIVLFWVLVVAVRRVDTAEETLR* |
| Ga0066903_1052564181 | 3300005764 | Tropical Forest Soil | MSFDDWALALHVLSAFAYVGGMVLFWILIVAVRRIETPEETIRMEPIVKVG |
| Ga0081455_101373713 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VSLDDWILVLHVLAAFAFVAGMVVFWMLIYAVRRTDTPEGTIRMEPIV |
| Ga0070717_101404464 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFDDWMLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPEETIRMEPIAKV |
| Ga0075363_1009190542 | 3300006048 | Populus Endosphere | VSFNDWLLALHVLSAFAYVAGVVLFWILVVAVRRIDTPEETIRMG |
| Ga0074047_120729721 | 3300006576 | Soil | VSFDDWILALHVLSAFAYVAGMVVFWVLIVAVRKTDTPDGTIRMGPIV |
| Ga0079221_115674631 | 3300006804 | Agricultural Soil | VGFDEWLLALHVLSAFAYVAGIVLFWILIVAVRNIDTPEETIRMGPIVKVGNVVVGI |
| Ga0079220_105831932 | 3300006806 | Agricultural Soil | VSFVDWALALHVLSAFAYVAGLVLFWVLVVAVRRVDTPDETLRM |
| Ga0075428_1003154742 | 3300006844 | Populus Rhizosphere | VSFNDWLLALHVLSAFAYVAGVVLFWILVVAVRRIDTPEETIR |
| Ga0075425_1005641463 | 3300006854 | Populus Rhizosphere | VSFDAWMLALHVLSAFAYVAGIILFWVLIVAVRKTDTPDKTIRMEPIVKVGNAA |
| Ga0075425_1006023093 | 3300006854 | Populus Rhizosphere | VSFDDWLLALHVLSAFAYVGGIVLFWVLVVAVRKTDTPDGTIRMEPIVKVGNVAV |
| Ga0079217_108728482 | 3300006876 | Agricultural Soil | VSFDDWMLALHVLSAFALVAGVIFFWVLIVEVRRTDTPER |
| Ga0075429_1013718511 | 3300006880 | Populus Rhizosphere | MTFDDWLLALHVLSAAAFVAGVIVFWVVILAAREAATPGET |
| Ga0068865_1011405461 | 3300006881 | Miscanthus Rhizosphere | VHLDDWILALHVLSAFSLVAGLVVFWALIVIGRRT |
| Ga0079215_115666502 | 3300006894 | Agricultural Soil | VSLDEWILALHVLSAFAFVAGLILFWVLIVAVRKTDTPDGTIRM |
| Ga0075424_1006616803 | 3300006904 | Populus Rhizosphere | MLALHVLSAFAYVAGIILFWVLIVAVRKTDTPDKTIR |
| Ga0079218_119700441 | 3300007004 | Agricultural Soil | VSFDDWVLALHVLSAFAWVAGIVLFWILIVAVRRTDTAEGTIRTEPV |
| Ga0066710_1032339831 | 3300009012 | Grasslands Soil | VSFDEWVLALHVLSAFAYVGGIVLFWILIVAVRGIDTP |
| Ga0111539_113578391 | 3300009094 | Populus Rhizosphere | VSFDDWLLVLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIRMEPIVRV |
| Ga0075418_123187482 | 3300009100 | Populus Rhizosphere | VRFDDWMLALHVLSAFSYVAGVVLFWVLIVAVRRTD |
| Ga0075418_129207691 | 3300009100 | Populus Rhizosphere | VSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRKTDTPDGTIRM |
| Ga0114129_126244481 | 3300009147 | Populus Rhizosphere | VSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIRMAPVVKVGT |
| Ga0114129_130707051 | 3300009147 | Populus Rhizosphere | VSFDDWLLALHVLSAFAYVGGIVLFWVLVVAVRKTDTPDGTIRMEPIVKVGNVA |
| Ga0111538_118784351 | 3300009156 | Populus Rhizosphere | VTFDDWILALHVLSAATYGASIILFWWLVVAVRSTDTAEGTLR |
| Ga0111538_122077832 | 3300009156 | Populus Rhizosphere | VSFDDWVLALHVLSAFSLVAGIVLFWVTIVAVRRIDTPG |
| Ga0111538_125731761 | 3300009156 | Populus Rhizosphere | VSFDDWLLLLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIRMEPIVRV |
| Ga0105241_105499321 | 3300009174 | Corn Rhizosphere | VTFLDWALVVHVLSAFAYVGGLVVFWVLIVAVRSVDTPAETLRMEPIVKVG |
| Ga0105249_102022041 | 3300009553 | Switchgrass Rhizosphere | VSFNDWLVALHVLSAFAYVAGVVLFWILVVAVRRIDTPEE |
| Ga0105066_11338722 | 3300009822 | Groundwater Sand | VSFDDWILALHVLSAFSYVAGTVLFWVLVVAVRRTD |
| Ga0126304_101217633 | 3300010037 | Serpentine Soil | VSFDDWMLALHVLSAFSYVAGLVLFWVLIVAARRTDTPG |
| Ga0126304_107219081 | 3300010037 | Serpentine Soil | VTLDDWIVALHVLSAFAYVAAIVLFWVLIVAVRRLDTPDP |
| Ga0126384_111432842 | 3300010046 | Tropical Forest Soil | VSFNDWLLALHVLSAFSYVAGIVLFWILIVAVRKIDTPEETIRME |
| Ga0134070_102668112 | 3300010301 | Grasslands Soil | VSFDDWVVALHVLSAFAYIGGIVLFWILVVAVRTIHTPGATIRME |
| Ga0126370_115532741 | 3300010358 | Tropical Forest Soil | VSFVEWALAVHVLSAFAYVGGIVLFWVLVVAVRRVDTADETLRMEPIVKVGNV |
| Ga0126376_119468912 | 3300010359 | Tropical Forest Soil | VSFVDWALVVHVLSAFAYVGGLIVFWVLVFAVRRTDTPAETMRME |
| Ga0126378_119611542 | 3300010361 | Tropical Forest Soil | VSFDEWVLALHVLSAFAYVGGIVLFWILIVAVRQIDTPGETIRMAPIVKVGNVAV |
| Ga0126377_129702762 | 3300010362 | Tropical Forest Soil | MTWTDWLLAFHLWSAFAYVAGMVLFWVLIVAVRRVDTPAATIEMEPIVKVGTIAT |
| Ga0126379_114932711 | 3300010366 | Tropical Forest Soil | VRFTDWIFALHLLSAFSLIAGLVIFWVLIVAGRTIDTPGDT |
| Ga0126379_132280251 | 3300010366 | Tropical Forest Soil | MSFDQWALALHVLSAFAYVGGMVLFWILIVAVRKVATPRETIRMEPIVKVGNVAV |
| Ga0134125_121955161 | 3300010371 | Terrestrial Soil | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAIRKTDTPEGTIRMAPVVRVGIVGT |
| Ga0134125_123100931 | 3300010371 | Terrestrial Soil | VSFVDWALAVHVLSAFAYVGGLVVFWVLIAAVRRVDTPQETLRMEPI |
| Ga0151490_16239872 | 3300011107 | Soil | VGFNQWMLAFHVLSAFSLVAGSTLFWVLVVAVRRIDT |
| Ga0137424_11089661 | 3300011412 | Soil | VSFDDWVLALHVLSAFSLVAGIVLFWVLVVVGRRIDTPADTLRLSPI |
| Ga0137433_11993252 | 3300011440 | Soil | VSFDDWLLALHVLSAFALVAGLILFWVLIIAVRRTDTPDGTIRMAPVAKVGNAAAG |
| Ga0137433_12513712 | 3300011440 | Soil | VSFDDWVLALHVLSAVAYGAGIILFWVLVVAVRTTDTAEGTL |
| Ga0120191_100625761 | 3300012022 | Terrestrial | VSFDDWILALHVLSAFAYVAGMVLFWILIVAVRRTDLPDGTIRMAP |
| Ga0136625_10032926 | 3300012091 | Polar Desert Sand | VSFDDWILALHVLSAFAFVGGIVLFWVLIVASRSIDTAADTIR |
| Ga0136625_12631182 | 3300012091 | Polar Desert Sand | VSVDDWILALHVLSAFAFVGGIVLFWVLIVASRSIDTAADTIR |
| Ga0137368_100013351 | 3300012358 | Vadose Zone Soil | MSFDDWMLALHVLSAFAWVAGIIVFWVLIAAVRQTDTPEGTIR |
| Ga0137375_102156261 | 3300012360 | Vadose Zone Soil | VSFDDSIRALHVLSAFAYVAGLVLLWIVVVAVRRTGLREGTGRMAPVVKV |
| Ga0157288_103786111 | 3300012901 | Soil | LSFDDWLLVLHVLSAFAFVAGMVVFWVLIVAVRRTDTPQGTIRMAPIV |
| Ga0157282_101221462 | 3300012904 | Soil | VSFDDWILALHVLSAFSYVAGVVLFWVLVVAVRGTDTPDGTIRMDPVAKVG |
| Ga0157290_103710971 | 3300012909 | Soil | VSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPDGTIRLGPVVKVGNAS |
| Ga0126375_117656862 | 3300012948 | Tropical Forest Soil | VSFDDWMLALHVLSAFSYVAGIVLFWVLIVAVRKTDTPEGTIRMEPIVKVG |
| Ga0164298_115802212 | 3300012955 | Soil | VSLDDWILALHLLAAFALVASMVGFWTVVVAARTAERPSGV |
| Ga0164302_104017313 | 3300012961 | Soil | VRFNDWMLALHVLAAFSLVAGSILFWVLVVAVRRID |
| Ga0164307_106720522 | 3300012987 | Soil | VGFNQWMLAFHVLSAFSLVAGSTLFWVLVVAVRRIDTPDDTLRLG |
| Ga0164305_113144422 | 3300012989 | Soil | VRFDDWMLARHVLSAFSLVAGLILFWALIVVGRRIDTPEAT |
| Ga0157372_104476843 | 3300013307 | Corn Rhizosphere | VSFVDWALAVHVLSAFAYAAGLVLVWVVVVFVRRVDTP* |
| Ga0075351_11061632 | 3300014318 | Natural And Restored Wetlands | MTYDWLLALHVVSAFVMTAALVLFTVLVIAVRRLDSPS |
| Ga0157380_121568531 | 3300014326 | Switchgrass Rhizosphere | VRFDDWMLALHVLSAFSLVAGIVLFWVLIFVGWRTDTPEGTL |
| Ga0120193_100326691 | 3300014965 | Terrestrial | VSFDDWMLALHVLSAFALVAGIIFFWVLIVEVRRTDTPEGTLRLGPLSRIAETTV |
| Ga0173483_102308692 | 3300015077 | Soil | VSFDDWLLVLHVLSAFAYVAGIVLFWTLVVAVRTTDTPD |
| Ga0173480_101251751 | 3300015200 | Soil | VSFDDWLLVLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIR |
| Ga0173480_111648411 | 3300015200 | Soil | VSFVHWALVVHVLSAFAYVGGLVVFWVLIVAVRSVDTPAETLRMEPIVKV |
| Ga0173478_102629152 | 3300015201 | Soil | VSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTDTADGTIRMA |
| Ga0134085_101023483 | 3300015359 | Grasslands Soil | VSFDQWMISLHVLAAFSLVAGSILFWVLVVAVRRIDTPDDTLRLGP |
| Ga0132256_1016915832 | 3300015372 | Arabidopsis Rhizosphere | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRKTD |
| Ga0132257_1017929662 | 3300015373 | Arabidopsis Rhizosphere | VSLDDWLLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPDG |
| Ga0132255_1031630051 | 3300015374 | Arabidopsis Rhizosphere | VRFDDWMLALHVLSAFALVAGLILFWTLIVVGRRMDTPE |
| Ga0187777_100716711 | 3300017974 | Tropical Peatland | VSFDDWALAVHVLSAFAYVGGIVLFWVLVVAVRRVDTPEGTLRM |
| Ga0184621_101391481 | 3300018054 | Groundwater Sediment | VTFDDWVLALHVLSAFAYAAGIVLFWVLVVAVRQTDTPEGTIRLEP |
| Ga0184623_102512222 | 3300018056 | Groundwater Sediment | VSFDDWILSLHVLSAFAYVAGIVLFWILIVAVRRTDSPDGTIRMEPIVKVG |
| Ga0184624_101979083 | 3300018073 | Groundwater Sediment | VGFNQWMLALHVLAAFSLVAGSTLFWVLVVAIRRIDTP |
| Ga0184609_102898251 | 3300018076 | Groundwater Sediment | VSFDDWILALHVLSAFAYVAGVVLFWVLVVAVRRTDTPEGTIRMEPVVKVGNAAVGI |
| Ga0184625_106470571 | 3300018081 | Groundwater Sediment | VSFDDWMLALHVLSAFAMVAGMTLFWVLVVAGWRTDTPADILRMGPLS |
| Ga0190265_106894882 | 3300018422 | Soil | VSLDDWILAVHVLSGFAYVGAIVLFWTLIVAVRRTDT |
| Ga0190275_114540862 | 3300018432 | Soil | VSLDDWILALHVLSAFAYVAGIVLFWVLVVAVRKADTPDGTI |
| Ga0190270_102615082 | 3300018469 | Soil | VSFDDWMLALHVLSAFAMVAGMTLFWVLVVAGWRTDTPA |
| Ga0190270_133764662 | 3300018469 | Soil | VSFDDWVLALHVLAAFSLVAGIVLFWVLVVVGRRIDTPADTL |
| Ga0066669_118237251 | 3300018482 | Grasslands Soil | VSFDAWVLALHVLSAFAYIAGVVLFWILIIAVRRIDTPEE |
| Ga0187893_102705632 | 3300019487 | Microbial Mat On Rocks | VSLDQWILALHVLSAFAYVAAIVLFWVLAVAVRATDTPDGTLRMGPI |
| Ga0193738_11923131 | 3300020020 | Soil | VSFDDWILALHVLSAFAYVAGVVLFWILVVAVRKTDTPDGTIRMEPVVKVGNASVGI |
| Ga0196963_103931441 | 3300020215 | Soil | VSFDDWMLALHVVSAFAFGGAIVLFWVLIVAVRRTDSPEY |
| Ga0210378_100385021 | 3300021073 | Groundwater Sediment | VSFDDWILALHVLSAFAYVAGVVLFWVLVVAVRRTDTP |
| Ga0210378_103895172 | 3300021073 | Groundwater Sediment | VSLDDWILALHVLSAFAYVAGIVLFWILVVAIRQIDTPEGTIRLWPVVKVGN |
| Ga0210392_108407132 | 3300021475 | Soil | VSFVDWALALHVLSAFAYMGAIVLFWVLIVAVRRI |
| Ga0210402_105801761 | 3300021478 | Soil | VSFDDWALVVHVLSAFAYVAGIVLFWVLIVAVRSVDTAEE |
| Ga0222622_101398312 | 3300022756 | Groundwater Sediment | VSFDDWILALHVLSAFAYVAGMVLFWVLIVAVRRTDTPEGNIRMGPAVM |
| Ga0247790_100887822 | 3300022915 | Soil | VSFNDWLLALHVLSAFAYVAGVVLFWILIVAVRRID |
| Ga0247754_10045424 | 3300023102 | Soil | VSFDDWLLVLHVLSAFAFVAGTILFWMLIVAVRRTDTPDGTIRMEPIVKV |
| Ga0247680_10254142 | 3300024246 | Soil | VSFVDWALVVHVLSAFAYVAGLVVFWVLIVAVRKTDTPAETLRMEPI |
| Ga0209751_106072582 | 3300025327 | Soil | VSLDDWILSLHVLSAFAYVAGIVLFWVLVVAVRRIDTPEGTIR |
| Ga0207682_103920461 | 3300025893 | Miscanthus Rhizosphere | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPVVKVGTIGT |
| Ga0207654_103859411 | 3300025911 | Corn Rhizosphere | VTFLDWALAVHVLSAFAYVGGLVVFWVLIVAVRSVDTP |
| Ga0207687_102219522 | 3300025927 | Miscanthus Rhizosphere | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPVVKV |
| Ga0207644_107398622 | 3300025931 | Switchgrass Rhizosphere | VDFYDWMLALHVLSAFAYVGGIVLFWVLVVAVRKTDTPEGTIRME |
| Ga0207679_105231721 | 3300025945 | Corn Rhizosphere | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTETPEGTI |
| Ga0207667_108192241 | 3300025949 | Corn Rhizosphere | VTFLDWALAVHVLSAFAYVGGLVVFWVLIVAVRSVDTPAETLRMEPIVKVGG |
| Ga0207640_102616862 | 3300025981 | Corn Rhizosphere | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPV |
| Ga0207658_111207341 | 3300025986 | Switchgrass Rhizosphere | VSFDDWILALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIR |
| Ga0207677_112949732 | 3300026023 | Miscanthus Rhizosphere | VRFDDWMLALHVLSAFSLVAGIVLFWVLIFVGWRTDTPEGTLVLNPVAKV |
| Ga0207703_118632092 | 3300026035 | Switchgrass Rhizosphere | LSFDDWVLALHLLSAFAYVAGMVVFWVLIYAVRRTDTPEGTIRMAPVVKI |
| Ga0208654_10177132 | 3300026062 | Natural And Restored Wetlands | VSLDEWILALHVLSAFAYVAGMIVFWVLVVAVRRTDTPDETIRMGPIVKVGN |
| Ga0207708_109374032 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTDTADGTIR |
| Ga0209843_10900571 | 3300027511 | Groundwater Sand | VTFDDWILALHVLSAFAFVAGMVIFWVLIVAVRRTDTPEGT |
| Ga0256866_11485261 | 3300027650 | Soil | VSFDDSMLALHVVSAFAFVAAVVLFWVLVVAVRRTDSPAVTAGVEPIVTV |
| Ga0209177_104388762 | 3300027775 | Agricultural Soil | VSFVDWALALHVLSAFAYVAGLVLFWVLVVAVRRVDTPDET |
| (restricted) Ga0233416_101926662 | 3300027799 | Sediment | VSLDDWILALHVLSAFALVSGMVLFWIVIVAVRNVDTVGQT |
| Ga0209811_101204371 | 3300027821 | Surface Soil | VRFDDWMLALHVLSAFSLVAGLVVFWALIVVGRRIDTPEGTLSL |
| Ga0209814_102231242 | 3300027873 | Populus Rhizosphere | MSFDDWILALHLLSAFAYVAGMIVFWVLIVAVRRTDTPD |
| Ga0247828_108371661 | 3300028587 | Soil | VTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIR |
| Ga0247818_102225663 | 3300028589 | Soil | VSFDDWVLALHVLSAFALVAGLVLFWVIVVAVRRIDTPGDTLRLGPIAKVGN |
| Ga0307285_102176731 | 3300028712 | Soil | VTVDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTIRM |
| Ga0307303_100409933 | 3300028713 | Soil | VGFDDWILALHVLSAFSLVAGLVLFWALIVVGRRIDT |
| Ga0307311_101948612 | 3300028716 | Soil | VSFDDWLLALHVIGAFAYVAGVVLFWILVVAVRKVDTPEGTIRMEPIVKVGNVAV |
| Ga0307311_101981352 | 3300028716 | Soil | VTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTMRMEPI |
| Ga0307298_100883412 | 3300028717 | Soil | VTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDGTVRMGPIVKIG |
| Ga0307319_101568362 | 3300028722 | Soil | VSFDDWVLALHVLSAFAYVAGVVLFWVLVVAVRRTDTPEGTIRMAP |
| Ga0307320_104761862 | 3300028771 | Soil | VTFDDWVLALHVLSAVAYGAGIILFWVLVVAVRTTDTAEGTLRLTPS |
| Ga0307292_101953122 | 3300028811 | Soil | VTFDDWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTPDG |
| Ga0307296_103645221 | 3300028819 | Soil | VTFDDWVLALHVLSAFAYAAGIVLFWVLVVAVRQTDTPEGTIRMEPVV |
| Ga0307286_104204281 | 3300028876 | Soil | VSFDDWMLALHVVSAFVLVAGLVLFWVLIVAVRRIGTPGATLAMGPLTKVADA |
| Ga0307278_101092091 | 3300028878 | Soil | MTFDSWILALHVLSAFAYVAGMVLFWVLVVAVRRTDTPAGTIRH |
| Ga0307308_104968411 | 3300028884 | Soil | LSFDDWMLALHVLSAFAYVAGIVLFWVLVVAVRKTDTPEGT |
| Ga0307304_102311091 | 3300028885 | Soil | MTFDSWILALHVLSAFAYVAGMVLFWVLVVAVRRTDTPAGTIRME |
| Ga0247826_108385031 | 3300030336 | Soil | VSFDQWILALHVLSAFAYVAGMIVFWVLIVAVRRTDTADGTIR |
| Ga0307495_102659142 | 3300031199 | Soil | VSFVDWALAVHVLSAFAYVGGLVLFWVLIVAVRRVDTPEQT |
| Ga0307505_101880821 | 3300031455 | Soil | VGFNQWMLALHVLAAFSLVAGSTLFWVLIVAVRRIDTP |
| Ga0307412_119805821 | 3300031911 | Rhizosphere | VSFDEWLMALHVLSAFAYVAGVVLFWMLIVAVRKIDT |
| Ga0308174_109644972 | 3300031939 | Soil | VSFVDWALAVHVLSAFAYVGGLVVFWVLIAAVRRVDTPQETLRM |
| Ga0310890_113963491 | 3300032075 | Soil | VSLDQWILALHVLSAFAYVAGMIVFWVLIVAVRKTD |
| Ga0335072_109496672 | 3300032898 | Soil | VSFVQWALAVHVLSAFAYVAGIVLFWVLVVAVRRVDTPEETLRM |
| Ga0310811_110846982 | 3300033475 | Soil | VRFDDWMLALHVLSAFSLVAGLILFWTLIVVGRRMDTPVATLSLS |
| Ga0364943_0298349_475_609 | 3300034354 | Sediment | VSFDDWMLALHVLSAFAYVAGIVLFWVLVVVVRRTDAPDGTIRMG |
| ⦗Top⦘ |