| Basic Information | |
|---|---|
| Family ID | F042877 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 31.21 % |
| % of genes near scaffold ends (potentially truncated) | 45.22 % |
| % of genes from short scaffolds (< 2000 bps) | 78.34 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (79.618 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (30.573 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.694 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.631 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF05766 | NinG | 64.97 |
| PF01555 | N6_N4_Mtase | 3.82 |
| PF13443 | HTH_26 | 2.55 |
| PF02954 | HTH_8 | 1.91 |
| PF04466 | Terminase_3 | 1.27 |
| PF08291 | Peptidase_M15_3 | 0.64 |
| PF00145 | DNA_methylase | 0.64 |
| PF03629 | SASA | 0.64 |
| PF12728 | HTH_17 | 0.64 |
| PF02195 | ParBc | 0.64 |
| PF13508 | Acetyltransf_7 | 0.64 |
| PF01844 | HNH | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.82 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.82 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.82 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.27 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.45 % |
| Unclassified | root | N/A | 9.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2222084010|2225746594 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5761 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10052527 | All Organisms → Viruses → Predicted Viral | 1596 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10088405 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1051 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10116064 | Not Available | 846 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10226496 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 508 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10018005 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3756 | Open in IMG/M |
| 3300001349|JGI20160J14292_10230254 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 521 | Open in IMG/M |
| 3300001965|GOS2243_1003580 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1887 | Open in IMG/M |
| 3300002930|Water_100132 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 17473 | Open in IMG/M |
| 3300002930|Water_100146 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 16544 | Open in IMG/M |
| 3300002930|Water_100365 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 10059 | Open in IMG/M |
| 3300002930|Water_100547 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 7756 | Open in IMG/M |
| 3300002930|Water_100657 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 6931 | Open in IMG/M |
| 3300002930|Water_101975 | All Organisms → Viruses → Predicted Viral | 3662 | Open in IMG/M |
| 3300002930|Water_102803 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2937 | Open in IMG/M |
| 3300004097|Ga0055584_101619252 | Not Available | 670 | Open in IMG/M |
| 3300005239|Ga0073579_1623165 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 851 | Open in IMG/M |
| 3300005346|Ga0074242_10898112 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300005512|Ga0074648_1009236 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 6734 | Open in IMG/M |
| 3300005512|Ga0074648_1010722 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 6060 | Open in IMG/M |
| 3300006025|Ga0075474_10107920 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 896 | Open in IMG/M |
| 3300006026|Ga0075478_10101235 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 920 | Open in IMG/M |
| 3300006027|Ga0075462_10259426 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 514 | Open in IMG/M |
| 3300006029|Ga0075466_1086886 | Not Available | 865 | Open in IMG/M |
| 3300006029|Ga0075466_1149743 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 601 | Open in IMG/M |
| 3300006637|Ga0075461_10036513 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1610 | Open in IMG/M |
| 3300006734|Ga0098073_1002031 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5253 | Open in IMG/M |
| 3300006734|Ga0098073_1007540 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
| 3300006734|Ga0098073_1015086 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1225 | Open in IMG/M |
| 3300006734|Ga0098073_1019386 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1031 | Open in IMG/M |
| 3300006734|Ga0098073_1026421 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 837 | Open in IMG/M |
| 3300006790|Ga0098074_1018119 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2159 | Open in IMG/M |
| 3300006790|Ga0098074_1022344 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1902 | Open in IMG/M |
| 3300006790|Ga0098074_1037998 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1380 | Open in IMG/M |
| 3300006790|Ga0098074_1073310 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 931 | Open in IMG/M |
| 3300006793|Ga0098055_1012290 | All Organisms → Viruses → Predicted Viral | 3803 | Open in IMG/M |
| 3300006802|Ga0070749_10299685 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 901 | Open in IMG/M |
| 3300006802|Ga0070749_10542140 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 631 | Open in IMG/M |
| 3300006802|Ga0070749_10604770 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 591 | Open in IMG/M |
| 3300006802|Ga0070749_10622138 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 581 | Open in IMG/M |
| 3300006802|Ga0070749_10664623 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 558 | Open in IMG/M |
| 3300006802|Ga0070749_10714158 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 535 | Open in IMG/M |
| 3300006803|Ga0075467_10161775 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1276 | Open in IMG/M |
| 3300006803|Ga0075467_10472168 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 647 | Open in IMG/M |
| 3300006803|Ga0075467_10584182 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 571 | Open in IMG/M |
| 3300006810|Ga0070754_10030706 | All Organisms → cellular organisms → Bacteria | 3003 | Open in IMG/M |
| 3300006869|Ga0075477_10244312 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 724 | Open in IMG/M |
| 3300006916|Ga0070750_10357863 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 615 | Open in IMG/M |
| 3300006919|Ga0070746_10053713 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2094 | Open in IMG/M |
| 3300006919|Ga0070746_10154197 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300006919|Ga0070746_10423699 | Not Available | 594 | Open in IMG/M |
| 3300006920|Ga0070748_1353981 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 517 | Open in IMG/M |
| 3300007234|Ga0075460_10150715 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 811 | Open in IMG/M |
| 3300007236|Ga0075463_10232843 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 592 | Open in IMG/M |
| 3300007346|Ga0070753_1205909 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 726 | Open in IMG/M |
| 3300007346|Ga0070753_1294226 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 581 | Open in IMG/M |
| 3300007540|Ga0099847_1095797 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 906 | Open in IMG/M |
| 3300007953|Ga0105738_1064538 | Not Available | 616 | Open in IMG/M |
| 3300009071|Ga0115566_10252916 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1055 | Open in IMG/M |
| 3300009086|Ga0102812_10447242 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 705 | Open in IMG/M |
| 3300009124|Ga0118687_10281150 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 623 | Open in IMG/M |
| 3300009438|Ga0115559_1025215 | All Organisms → Viruses → Predicted Viral | 2861 | Open in IMG/M |
| 3300009447|Ga0115560_1083386 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
| 3300009467|Ga0115565_10019543 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3633 | Open in IMG/M |
| 3300009476|Ga0115555_1192995 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 841 | Open in IMG/M |
| 3300009550|Ga0115013_10025189 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3187 | Open in IMG/M |
| 3300010149|Ga0098049_1230361 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 565 | Open in IMG/M |
| 3300012920|Ga0160423_10323399 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1059 | Open in IMG/M |
| 3300013010|Ga0129327_10051145 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2065 | Open in IMG/M |
| 3300016737|Ga0182047_1220507 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 570 | Open in IMG/M |
| 3300016776|Ga0182046_1434986 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 501 | Open in IMG/M |
| 3300016797|Ga0182090_1474564 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 759 | Open in IMG/M |
| 3300017708|Ga0181369_1015792 | Not Available | 1874 | Open in IMG/M |
| 3300017708|Ga0181369_1129870 | Not Available | 506 | Open in IMG/M |
| 3300017721|Ga0181373_1100836 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 509 | Open in IMG/M |
| 3300017733|Ga0181426_1111700 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 549 | Open in IMG/M |
| 3300017748|Ga0181393_1052484 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1110 | Open in IMG/M |
| 3300017770|Ga0187217_1185150 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 691 | Open in IMG/M |
| 3300017776|Ga0181394_1150876 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 722 | Open in IMG/M |
| 3300017782|Ga0181380_1006196 | All Organisms → Viruses | 4799 | Open in IMG/M |
| 3300017782|Ga0181380_1011089 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3468 | Open in IMG/M |
| 3300017813|Ga0188953_10276 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 6592 | Open in IMG/M |
| 3300017824|Ga0181552_10158188 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1201 | Open in IMG/M |
| 3300017951|Ga0181577_10172603 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1459 | Open in IMG/M |
| 3300017951|Ga0181577_10238412 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1200 | Open in IMG/M |
| 3300017951|Ga0181577_10276193 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300017951|Ga0181577_10344422 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 959 | Open in IMG/M |
| 3300017951|Ga0181577_10570584 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 700 | Open in IMG/M |
| 3300017951|Ga0181577_10690344 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 622 | Open in IMG/M |
| 3300017951|Ga0181577_10909274 | Not Available | 524 | Open in IMG/M |
| 3300017957|Ga0181571_10947242 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 504 | Open in IMG/M |
| 3300017963|Ga0180437_10700352 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 734 | Open in IMG/M |
| 3300017967|Ga0181590_10459983 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 893 | Open in IMG/M |
| 3300018080|Ga0180433_11160881 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 561 | Open in IMG/M |
| 3300018410|Ga0181561_10152821 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1179 | Open in IMG/M |
| 3300018410|Ga0181561_10236978 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 874 | Open in IMG/M |
| 3300018415|Ga0181559_10741230 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 525 | Open in IMG/M |
| 3300018416|Ga0181553_10668678 | Not Available | 545 | Open in IMG/M |
| 3300018416|Ga0181553_10750427 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 507 | Open in IMG/M |
| 3300018417|Ga0181558_10581508 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 577 | Open in IMG/M |
| 3300018420|Ga0181563_10223898 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1134 | Open in IMG/M |
| 3300018420|Ga0181563_10230390 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
| 3300018420|Ga0181563_10566736 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 633 | Open in IMG/M |
| 3300019459|Ga0181562_10384532 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 681 | Open in IMG/M |
| 3300020166|Ga0206128_1001094 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 28605 | Open in IMG/M |
| 3300020166|Ga0206128_1227469 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 699 | Open in IMG/M |
| 3300020166|Ga0206128_1322387 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 542 | Open in IMG/M |
| 3300020175|Ga0206124_10127085 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1040 | Open in IMG/M |
| 3300020176|Ga0181556_1024862 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3508 | Open in IMG/M |
| 3300020176|Ga0181556_1153184 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 943 | Open in IMG/M |
| 3300020185|Ga0206131_10177901 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1074 | Open in IMG/M |
| 3300021335|Ga0213867_1084251 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1159 | Open in IMG/M |
| 3300021335|Ga0213867_1091814 | Not Available | 1097 | Open in IMG/M |
| 3300021356|Ga0213858_10006878 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5358 | Open in IMG/M |
| 3300021364|Ga0213859_10094270 | Not Available | 1419 | Open in IMG/M |
| 3300021957|Ga0222717_10191752 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1218 | Open in IMG/M |
| 3300021957|Ga0222717_10419785 | Not Available | 736 | Open in IMG/M |
| 3300021958|Ga0222718_10153544 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1297 | Open in IMG/M |
| 3300021959|Ga0222716_10003727 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 12117 | Open in IMG/M |
| 3300021959|Ga0222716_10285251 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1004 | Open in IMG/M |
| 3300021959|Ga0222716_10599024 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 602 | Open in IMG/M |
| 3300022061|Ga0212023_1057611 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 539 | Open in IMG/M |
| 3300022068|Ga0212021_1057109 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 795 | Open in IMG/M |
| 3300022069|Ga0212026_1065118 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 553 | Open in IMG/M |
| 3300022071|Ga0212028_1044528 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 825 | Open in IMG/M |
| 3300022072|Ga0196889_1023710 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1268 | Open in IMG/M |
| 3300022074|Ga0224906_1010877 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3514 | Open in IMG/M |
| 3300022074|Ga0224906_1025847 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2053 | Open in IMG/M |
| 3300022178|Ga0196887_1067064 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 871 | Open in IMG/M |
| 3300022178|Ga0196887_1070454 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 841 | Open in IMG/M |
| 3300022187|Ga0196899_1211828 | Not Available | 509 | Open in IMG/M |
| 3300022206|Ga0224499_10083175 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1078 | Open in IMG/M |
| 3300024343|Ga0244777_10172243 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
| 3300025093|Ga0208794_1002119 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 7938 | Open in IMG/M |
| 3300025093|Ga0208794_1023327 | Not Available | 1273 | Open in IMG/M |
| 3300025093|Ga0208794_1040613 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 877 | Open in IMG/M |
| 3300025151|Ga0209645_1017953 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2730 | Open in IMG/M |
| 3300025168|Ga0209337_1013593 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5005 | Open in IMG/M |
| 3300025508|Ga0208148_1078583 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 749 | Open in IMG/M |
| 3300025630|Ga0208004_1037262 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
| 3300025641|Ga0209833_1068719 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300025654|Ga0209196_1137959 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 683 | Open in IMG/M |
| 3300025671|Ga0208898_1092071 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 944 | Open in IMG/M |
| 3300025674|Ga0208162_1042787 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1568 | Open in IMG/M |
| 3300025759|Ga0208899_1115032 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 977 | Open in IMG/M |
| 3300025803|Ga0208425_1092944 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 710 | Open in IMG/M |
| 3300025803|Ga0208425_1152071 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 513 | Open in IMG/M |
| 3300025810|Ga0208543_1019182 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1739 | Open in IMG/M |
| 3300025818|Ga0208542_1127676 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 708 | Open in IMG/M |
| 3300025853|Ga0208645_1124114 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1024 | Open in IMG/M |
| 3300025886|Ga0209632_10079391 | All Organisms → Viruses → Predicted Viral | 1978 | Open in IMG/M |
| 3300025889|Ga0208644_1142173 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1113 | Open in IMG/M |
| 3300027582|Ga0208971_1067946 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 909 | Open in IMG/M |
| 3300029309|Ga0183683_1000291 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 29687 | Open in IMG/M |
| 3300031774|Ga0315331_10818738 | Not Available | 648 | Open in IMG/M |
| 3300034375|Ga0348336_192133 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 555 | Open in IMG/M |
| 3300034418|Ga0348337_077692 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1174 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 30.57% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.92% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.74% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.10% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 4.46% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.46% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.82% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.18% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.18% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.55% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.27% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.27% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.27% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.27% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.64% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.64% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.64% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.64% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.64% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.64% |
| Coastal Lagoon | Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon | 0.64% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.64% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.64% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Saline Water | 0.64% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084010 | Coastal lagoon microbial communities from Mar Menor, Spain - Sample 1 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007953 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017813 | Saline water viral communities from Saloum River inverse estuary, Senegal ? P2 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025093 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2225143256 | 2222084010 | Coastal Lagoon | MSQGLFAAIAILSFAQIGVEYYQENQVRVFGLVIVLLSCLGIVA |
| DelMOSum2011_100525273 | 3300000115 | Marine | MIYGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| DelMOSum2011_100884053 | 3300000115 | Marine | ILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| DelMOSum2011_101160643 | 3300000115 | Marine | MIYGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACL |
| DelMOSum2011_102264962 | 3300000115 | Marine | RPRTNQATGMIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| DelMOWin2010_100180052 | 3300000117 | Marine | MTQGLFAAIAVLSFAQLGIEFFQEHQVRVFGIVIFLLSCLGLFA* |
| JGI20160J14292_102302542 | 3300001349 | Pelagic Marine | MIQGILVAIAILTFAQVGAEFYQEHQVRLXNLVVLLLACLALFV* |
| GOS2243_10035806 | 3300001965 | Marine | MTQGILAAIAVLSFAQLGVEYFQENQVRIFGLVIFLLSCLGVAA* |
| Water_10013219 | 3300002930 | Estuary Water | MIHGILVAIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV* |
| Water_10014618 | 3300002930 | Estuary Water | MIHGILVAILVLTFAQVGVEFYQENQVRLFNLVVLLLSCLALFV* |
| Water_10036514 | 3300002930 | Estuary Water | MTEGILAAIAILSFAQLGVEYFQEHQVRLFNLVILLLVCLGLAS* |
| Water_10054715 | 3300002930 | Estuary Water | MIQGILVAIAILTFAQVGAEYYQEHQVRLFNLVVLLLSCLALFV* |
| Water_1006573 | 3300002930 | Estuary Water | MIEGILVAIAILTFAQVGAEYYQEHQVRLFNLVVLLLSCLALFV* |
| Water_1019752 | 3300002930 | Estuary Water | MIQGILVAIAILTFAQVGAEYYQEHQVRLFNLVILVLSCLALFL* |
| Water_1028037 | 3300002930 | Estuary Water | MIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| Ga0055584_1016192522 | 3300004097 | Pelagic Marine | MTEGILAAIAVLSFAQLGVEYFQEHQVRLFNLVILLLVCLGLAS* |
| Ga0073579_16231652 | 3300005239 | Marine | MIEGILAAIAVLSFAQVGVEYFQENQVRLFNLVIFCLSCLGLAS* |
| Ga0074242_108981122 | 3300005346 | Saline Water And Sediment | MIHGILVAILVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV* |
| Ga0074648_10092362 | 3300005512 | Saline Water And Sediment | MSQGLFAAIAVLSFAQIGVEYFQEHQVRLFALVILLLSCLGIVA* |
| Ga0074648_10107225 | 3300005512 | Saline Water And Sediment | MTHGILAAIALLTFAQLGVEYFQENQVRVFGIVTLLLSCLGLLA* |
| Ga0075474_101079203 | 3300006025 | Aqueous | MTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0075478_101012351 | 3300006026 | Aqueous | LLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0075462_102594261 | 3300006027 | Aqueous | QWFARAAEGYIVDRRGPHRPRRNQTPGMIHGILVAILVLTFAQVGVEFYQENQVRLFNLVVLLLSCLALFV* |
| Ga0075466_10868862 | 3300006029 | Aqueous | MIHGILVAILVLTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| Ga0075466_11497432 | 3300006029 | Aqueous | MTEGILAAIAVLSFAQLGVEYFQEHQVRLFNLVILL |
| Ga0075461_100365131 | 3300006637 | Aqueous | GDCRRPYRTRTNQTQMIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA* |
| Ga0098073_100203111 | 3300006734 | Marine | MSDGIFAAIAILTFAQVGVEYYSENQVRLFSLVVFALACVGLLA* |
| Ga0098073_10075404 | 3300006734 | Marine | MTQGILVAIAVLTFAQVGVEYYQEHQVRLFNLVVFLLSCLGLLL* |
| Ga0098073_10150862 | 3300006734 | Marine | MTPGILLAIAILSFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0098073_10193863 | 3300006734 | Marine | LGPHQAQGMTQGILVAIAVLTFAQVGVEYYQEHQVRLFNLVVFLLSCLGLLL* |
| Ga0098073_10264212 | 3300006734 | Marine | MTQGILVAIAVLVFAQVGVEYYQEHQVRLFNLVVFLLACLGLAV* |
| Ga0098074_10181193 | 3300006790 | Marine | MSNGIFAAIAIITFAQVGAEYYTEHQVRLFNLVVLVLACVGLFA* |
| Ga0098074_10223442 | 3300006790 | Marine | MTTGLFAAIAVLSFAQLGVEYFQENQVRVFGLVILLLSCLGILA* |
| Ga0098074_10379983 | 3300006790 | Marine | MTHGLLAAIAVLSFAQLGIEYFTENQVRVFGLVILLLACLGLVG* |
| Ga0098074_10733103 | 3300006790 | Marine | MTSGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLSCLGLFV* |
| Ga0098055_10122903 | 3300006793 | Marine | MIHGILVAIAVLTFAQVGAEYYQEHQVRLFNIVVLFLSCLALFV* |
| Ga0070749_102996851 | 3300006802 | Aqueous | PGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA* |
| Ga0070749_105421402 | 3300006802 | Aqueous | MIYGILVAIAVLTFAQVGVEYFQENQVRLFSLVVFLLACLGLFV* |
| Ga0070749_106047702 | 3300006802 | Aqueous | MIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA* |
| Ga0070749_106221383 | 3300006802 | Aqueous | GLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA* |
| Ga0070749_106646232 | 3300006802 | Aqueous | RGPHRARRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0070749_107141581 | 3300006802 | Aqueous | RNQTPGMIHGILVAILVLTFAQVGVEFYQENQVRLFNLVVLLLSCLALFV* |
| Ga0075467_101617751 | 3300006803 | Aqueous | IAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0075467_104721682 | 3300006803 | Aqueous | MIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVL |
| Ga0075467_105841821 | 3300006803 | Aqueous | VAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| Ga0070754_100307068 | 3300006810 | Aqueous | MSQGLFAAIAVLSFAQIGVEYFQENQVRLFALVILLLSCLGIVA* |
| Ga0075477_102443122 | 3300006869 | Aqueous | MTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVF |
| Ga0070750_103578631 | 3300006916 | Aqueous | DQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0070746_100537131 | 3300006919 | Aqueous | GMIHGILVAILVLTFAQVGVEFYQENQVRLFNLVVLLLSCLALFV* |
| Ga0070746_101541974 | 3300006919 | Aqueous | ALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA* |
| Ga0070746_104236992 | 3300006919 | Aqueous | MTTGLLAAIAVLSFAQLGIEYFTENQVRVFGLVILLLACLGLVG* |
| Ga0070748_13539811 | 3300006920 | Aqueous | MTEGILAAIAVLSFAQLGVEYFQEHQVRLFNLVILLLV |
| Ga0075460_101507153 | 3300007234 | Aqueous | IAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA* |
| Ga0075463_102328431 | 3300007236 | Aqueous | TEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0070753_12059092 | 3300007346 | Aqueous | MIQGILVAIAILTFAQVGAEIYQEHQVRLFNLVVLLLACLALFV* |
| Ga0070753_12942262 | 3300007346 | Aqueous | RRGPHRARRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV* |
| Ga0099847_10957972 | 3300007540 | Aqueous | MIHGIIVAIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV* |
| Ga0105738_10645381 | 3300007953 | Estuary Water | AVLSFAQLGVEYFQEHQVRLFNLVILLLVCLGLAS* |
| Ga0115566_102529162 | 3300009071 | Pelagic Marine | MIQGILVAIAVLTFAQVGSEFYQEHQIRLFNLVVFFLACLALFV* |
| Ga0102812_104472422 | 3300009086 | Estuarine | MIHGILVAIAVLTFAQVGAEYYQEHQVRLFNIVVLLLSCLALFV* |
| Ga0118687_102811502 | 3300009124 | Sediment | MTPGILLAIAILTFAQIGAEYYHEHQVRLFTVVVFLLSCLGLFV* |
| Ga0115559_10252151 | 3300009438 | Pelagic Marine | PYRPRPNQAPGMIHGILVAIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV* |
| Ga0115560_10833861 | 3300009447 | Pelagic Marine | AIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV* |
| Ga0115565_1001954310 | 3300009467 | Pelagic Marine | AILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| Ga0115555_11929952 | 3300009476 | Pelagic Marine | MIQGILVAIAVLTFAQVGSEFYQEHQIRLFNLVAFFLACLALFV* |
| Ga0115013_100251892 | 3300009550 | Marine | MTQGILAAIAVLSFAQLGVEYFQEHQVRIFGLVIFLLACLGVVA* |
| Ga0098049_12303611 | 3300010149 | Marine | MIEGILAAIAVLSFAQLGVEYFQENSVRLFNLVIFCLSCLGLAS* |
| Ga0160423_103233993 | 3300012920 | Surface Seawater | MTQGLFAAIAILSFAQLGIEFFQENQVRVFGIVIFLLSCLGLFA* |
| Ga0129327_100511451 | 3300013010 | Freshwater To Marine Saline Gradient | RTNQATGMIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV* |
| Ga0182047_12205071 | 3300016737 | Salt Marsh | RTRRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0182046_14349862 | 3300016776 | Salt Marsh | RARRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0182090_14745643 | 3300016797 | Salt Marsh | GILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0181369_10157924 | 3300017708 | Marine | MTQGILAAIAVLSFAQLGVEYFQENQVRIFGLVIFLLSCLGILA |
| Ga0181369_11298702 | 3300017708 | Marine | MTQGILAAIAVLSFAQLGVEYFQEHQVRIFGLVIFLLACLGVVA |
| Ga0181373_11008362 | 3300017721 | Marine | MTQGILAAIAILSFAQLGVEYFQEHQVRIFGLVIFLLACLGVVA |
| Ga0181426_11117001 | 3300017733 | Seawater | MTQGILAAIAVLSFAQLGVEYFQEHQVRIFGLVIFL |
| Ga0181393_10524843 | 3300017748 | Seawater | TQGILAAIAVLSFAQLGVEYFQEHQVRIFGLVIFLLACLGVVA |
| Ga0187217_11851502 | 3300017770 | Seawater | MTQGILAAIAVLSFAQLGVEYFQEHQVRIFGLVIFLLACLGV |
| Ga0181394_11508762 | 3300017776 | Seawater | MIQGILVAIAILTFAQVGAEYYQEHQVRLFNLVILVLSCLALFL |
| Ga0181380_100619614 | 3300017782 | Seawater | AAIAVLSFAQLGVEYFQEDQVRIFGLVIFLLACLGVAA |
| Ga0181380_10110891 | 3300017782 | Seawater | MTQGILAAIAVLSFAQLGVEYFQEDQVRIFGLVIFLLACLGVAA |
| Ga0188953_1027610 | 3300017813 | Saline Water | MSQGLFAAIAVLSFAQIGVEYFQEHQVRLFALVILLLSCLGIVA |
| Ga0181552_101581882 | 3300017824 | Salt Marsh | MTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0181577_101726033 | 3300017951 | Salt Marsh | MTSGILLAIAILSFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0181577_102384123 | 3300017951 | Salt Marsh | MTQGILVAIAVLTFAQVGVEYYQEHQVRLFNLVVFLLSCLGLLL |
| Ga0181577_102761932 | 3300017951 | Salt Marsh | MSDGIFAAIAILTFAQVGVEYYSENQVRLFSLVVFALACVGLLA |
| Ga0181577_103444222 | 3300017951 | Salt Marsh | MTTGLFAAIAVLSFAQLGVEYFQEHQVRVFGIVILLLACLGILA |
| Ga0181577_105705841 | 3300017951 | Salt Marsh | MSTGIFAAIAIITFAQVGAEYFTEHQVRLFNLVVFILACVGLWA |
| Ga0181577_106903442 | 3300017951 | Salt Marsh | MTPGILLAIAILTFAQIGAEYYLEHQVRLFNLVVFLLACLGLFV |
| Ga0181577_109092742 | 3300017951 | Salt Marsh | RGPHRPRANQTAGMSTGIFAAIAIITFAQVGAEYFTEHQVRLFNLVVFILACVGLWA |
| Ga0181571_109472422 | 3300017957 | Salt Marsh | FAAIAIITFAQVGAEYFTEHQVRLFNLVVFILACVGLWA |
| Ga0180437_107003522 | 3300017963 | Hypersaline Lake Sediment | MTHGILAAIALLTFAQLGVEYFQENQVRVFGIVTLLLSCLGLLA |
| Ga0181590_104599831 | 3300017967 | Salt Marsh | LLAIAILSFAQLGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0180433_111608812 | 3300018080 | Hypersaline Lake Sediment | MTPGILLAIAILTFAQIGAESYQEHQVRLFNLVVFLLAGLGLCVCPERNSAPA |
| Ga0181561_101528212 | 3300018410 | Salt Marsh | MTPGILLAIAILSFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0181561_102369782 | 3300018410 | Salt Marsh | MIHGILVAILVLTFAQVGVEFYQEHQVRLFNLVVLLLSCLALFV |
| Ga0181559_107412302 | 3300018415 | Salt Marsh | GPDRARRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0181553_106686782 | 3300018416 | Salt Marsh | MTTGLFAAIAVLSFAQLGVEYFQENQVRVFGIVILLLACLGILA |
| Ga0181553_107504272 | 3300018416 | Salt Marsh | LVDRRGPHRARRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0181558_105815081 | 3300018417 | Salt Marsh | TTSNTHDMIHGILVAILVLTFAQVGVEYYQEHQVRLFNLVVLLLSCLALFV |
| Ga0181563_102238983 | 3300018420 | Salt Marsh | MIHGILVAILVLTFAQVGVEYYQEHQVRLFNLVVLLLSCLALFV |
| Ga0181563_102303903 | 3300018420 | Salt Marsh | MIPGILLAIALLTFAQVGVEYFQEYQVRLFHIIVFLLACLGLFV |
| Ga0181563_105667361 | 3300018420 | Salt Marsh | DQTEMTPGILLAIAILSFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0181562_103845322 | 3300019459 | Salt Marsh | MTPGILLAIAILSFAQIGAEYYLEHQVRLFNLVVFLLACLGLFV |
| Ga0206128_10010947 | 3300020166 | Seawater | MIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV |
| Ga0206128_12274691 | 3300020166 | Seawater | RPRTNQATGMIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV |
| Ga0206128_13223872 | 3300020166 | Seawater | MIHGILVAIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV |
| Ga0206124_101270852 | 3300020175 | Seawater | MIQGILVAIAILTFAQVGAEFYQEHQVRLFTLVVLLLACLALFV |
| Ga0181556_102486212 | 3300020176 | Salt Marsh | MTPGILLAIAILSFAQIGAEYYQEHQVRLFNLVVFLLSCLGLFV |
| Ga0181556_11531842 | 3300020176 | Salt Marsh | MTSGILLAIAILSFAQIGAEYYQEHQVRLFNLVVFLLSCLGLFV |
| Ga0206131_101779013 | 3300020185 | Seawater | ATGMIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV |
| Ga0213867_10842513 | 3300021335 | Seawater | MIHGILVAILVLTFAQVGVEFYQENQVRLFNLVVLLLSCLALFV |
| Ga0213867_10918143 | 3300021335 | Seawater | MIHGILVAILVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV |
| Ga0213858_100068788 | 3300021356 | Seawater | MSDGIFAAIAILTFAQVGVEYYTEHQVRLFSLVVFALACVGLLA |
| Ga0213859_100942704 | 3300021364 | Seawater | NQTQMTTGLFAAIAVLSFAQLGVEYFQEHQVRVFGIVILLLSCLGILA |
| Ga0222717_101917521 | 3300021957 | Estuarine Water | MTEGILAAIAVLSFAQLGVEYFQEHQVRLFNLVIL |
| Ga0222717_104197851 | 3300021957 | Estuarine Water | IAVLSFAQLGVEYFQEHQVRLFNLVILLLVCLGLAS |
| Ga0222718_101535442 | 3300021958 | Estuarine Water | MIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA |
| Ga0222716_100037275 | 3300021959 | Estuarine Water | MIEGILAAIAVLSFAQLGVEYFQENSVRLFNLVIFCLSCLGLAS |
| Ga0222716_102852511 | 3300021959 | Estuarine Water | MIQGILVAIAVLTFAQVGSEFYQEHQIRLFNLVVFFLACLALFV |
| Ga0222716_105990242 | 3300021959 | Estuarine Water | MIHGILVAIAVLTFAQVGAEYYQEHQVRLFNIVVLLLSCLALFV |
| Ga0212023_10576111 | 3300022061 | Aqueous | MTEGILAAIAVLSFAQLGVEYFQEHQVRLFNLVILLL |
| Ga0212021_10571091 | 3300022068 | Aqueous | YIGNRRRPYRTRTNQTQMIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLF |
| Ga0212026_10651181 | 3300022069 | Aqueous | DQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0212028_10445283 | 3300022071 | Aqueous | MTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLL |
| Ga0196889_10237103 | 3300022072 | Aqueous | MIHGILVAILVLTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV |
| Ga0224906_10108772 | 3300022074 | Seawater | MTQGILAAIAVLSFAQLGVEYFQEDQVRIFGLVIFLLSCLGVAA |
| Ga0224906_10258476 | 3300022074 | Seawater | MTQGILAAIAVLSFAQIGVEYFQENQVRIFGLVIFLLSCLGVAA |
| Ga0196887_10670643 | 3300022178 | Aqueous | MIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLA |
| Ga0196887_10704541 | 3300022178 | Aqueous | PISKAFGHTRGAQGYIGHRKGSYRPRTNQATGMIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV |
| Ga0196899_12118282 | 3300022187 | Aqueous | MSQGLFAAIAVLSFAQIGVEYFQENQVRLFALVILLLSCLGIVA |
| Ga0224499_100831753 | 3300022206 | Sediment | RGPNRARRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0244777_101722433 | 3300024343 | Estuarine | MTEGILAAIAVLSFAQLGVEYFQEHQVRLFNLVILLLVCLGLAS |
| Ga0208794_10021193 | 3300025093 | Marine | MTTGLFAAIAVLSFAQLGVEYFQENQVRVFGLVILLLSCLGILA |
| Ga0208794_10233273 | 3300025093 | Marine | MSNGIFAAIAIITFAQVGAEYYTEHQVRLFNLVVLVLACVGLFA |
| Ga0208794_10406132 | 3300025093 | Marine | MTQGILVAIAVLVFAQVGVEYYQEHQVRLFNLVVFLLACLGLAV |
| Ga0209645_10179537 | 3300025151 | Marine | MTQGLFAAIAVLSFAQLGIEFFQEHQVRVFGIVIFLLSCLGLFA |
| Ga0209337_101359313 | 3300025168 | Marine | MIEGILAAIAILTFAQVGVEYFQENQVRLFHLVIFCLSCLALAS |
| Ga0208148_10785833 | 3300025508 | Aqueous | YIGHCKGSYRPRTNQATGMIQGILVAIAILTFAQVGAEFYQEHQVRLFNLVVLLLACLALFV |
| Ga0208004_10372624 | 3300025630 | Aqueous | GDCRRPYRTRTNQTQMIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA |
| Ga0209833_10687191 | 3300025641 | Pelagic Marine | PYRPRPNQAPGMIHGILVAIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV |
| Ga0209196_11379593 | 3300025654 | Pelagic Marine | GMIHGILVAIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV |
| Ga0208898_10920711 | 3300025671 | Aqueous | IGNRRRPYRTRTNQTQMIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA |
| Ga0208162_10427872 | 3300025674 | Aqueous | MIYGILVAIAVLTFAQVGVEYFQENQVRLFSLVVFLLACLGLFV |
| Ga0208899_11150323 | 3300025759 | Aqueous | QTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLFV |
| Ga0208425_10929441 | 3300025803 | Aqueous | MIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLAC |
| Ga0208425_11520712 | 3300025803 | Aqueous | RTNQTQMIPGLLIAIALLTFAQVGVEYFQENQVRLFNLVVFLLACLGLFA |
| Ga0208543_10191821 | 3300025810 | Aqueous | MTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLAC |
| Ga0208542_11276763 | 3300025818 | Aqueous | YLVDRRGPHRTRRDQTEMTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLGLF |
| Ga0208645_11241141 | 3300025853 | Aqueous | MIHGILVAILVLTFAQVGVEFYQENQVRLFNLVVL |
| Ga0209632_100793911 | 3300025886 | Pelagic Marine | GYIANRRGPYRPRPNQAPGMIHGILVAIAVLTFAQVGVEYYQENQVRLFNLVVLLLSCLALFV |
| Ga0208644_11421731 | 3300025889 | Aqueous | MTHGLLAAIAVLSFAQLGIEYFTENQVRVFGLVILLL |
| Ga0208971_10679461 | 3300027582 | Marine | MTEGILAAIAVLSFAQLGVEYFQEHQVRLFNLVILLLVCLGLA |
| Ga0183683_100029119 | 3300029309 | Marine | MTQGILAAIAVLSFAQLGVEYFQEDQVRIFGLVIFLLACLGVVA |
| Ga0315331_108187381 | 3300031774 | Seawater | EGILAAIAVLSFAQLGVEYFQEHQVRLFNLVILLLVCLGLAS |
| Ga0348336_192133_57_191 | 3300034375 | Aqueous | MTHGLLAAIAVLSFAQLGIEYFTENQVRVFGLVILLLACLGLVG |
| Ga0348337_077692_3_125 | 3300034418 | Aqueous | MTPGILLAIAILTFAQIGAEYYQEHQVRLFNLVVFLLACLG |
| ⦗Top⦘ |