NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042527

Metagenome / Metatranscriptome Family F042527

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042527
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 40 residues
Representative Sequence SGDAFQKKYFDAIQRDPAVVIEHAELARLFNNEPPDSSTP
Number of Associated Samples 132
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.37 %
% of genes from short scaffolds (< 2000 bps) 90.51 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.937 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.253 % of family members)
Environment Ontology (ENVO) Unclassified
(31.013 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.532 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.71%    β-sheet: 0.00%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF14684Tricorn_C1 23.42
PF02245Pur_DNA_glyco 17.09
PF13590DUF4136 13.92
PF14542Acetyltransf_CG 8.86
PF06902Fer4_19 2.53
PF02678Pirin 2.53
PF02518HATPase_c 2.53
PF00072Response_reg 1.90
PF13847Methyltransf_31 1.90
PF05726Pirin_C 1.27
PF07589PEP-CTERM 1.27
PF08281Sigma70_r4_2 1.27
PF13432TPR_16 0.63
PF03795YCII 0.63
PF03544TonB_C 0.63
PF17152CHASE8 0.63
PF13187Fer4_9 0.63
PF12681Glyoxalase_2 0.63
PF00920ILVD_EDD 0.63
PF07366SnoaL 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG20943-methyladenine DNA glycosylase MpgReplication, recombination and repair [L] 17.09
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 3.80
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 1.27
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.63
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.94 %
UnclassifiedrootN/A5.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01B3LUKAll Organisms → cellular organisms → Bacteria506Open in IMG/M
3300001593|JGI12635J15846_10079736All Organisms → cellular organisms → Bacteria2398Open in IMG/M
3300002245|JGIcombinedJ26739_101436629All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300002245|JGIcombinedJ26739_101447897All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300002907|JGI25613J43889_10020786All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300002914|JGI25617J43924_10248666All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300004082|Ga0062384_100931378All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300004091|Ga0062387_100149601All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300005175|Ga0066673_10074168All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300005541|Ga0070733_10968077All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005591|Ga0070761_10067740All Organisms → cellular organisms → Bacteria2023Open in IMG/M
3300005764|Ga0066903_105493571All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005764|Ga0066903_107700198All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300006173|Ga0070716_100101166All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300006176|Ga0070765_100062487All Organisms → cellular organisms → Bacteria3091Open in IMG/M
3300006755|Ga0079222_10594831All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300006854|Ga0075425_100747780All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300009012|Ga0066710_101430118All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300009089|Ga0099828_10913624Not Available784Open in IMG/M
3300009090|Ga0099827_10073338All Organisms → cellular organisms → Bacteria2650Open in IMG/M
3300009090|Ga0099827_11914746All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300009137|Ga0066709_100025859All Organisms → cellular organisms → Bacteria6073Open in IMG/M
3300009545|Ga0105237_10483348All Organisms → cellular organisms → Bacteria → Acidobacteria1245Open in IMG/M
3300009698|Ga0116216_10869961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300010043|Ga0126380_11423473All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300010048|Ga0126373_10213232All Organisms → cellular organisms → Bacteria → Acidobacteria1879Open in IMG/M
3300010048|Ga0126373_11184150All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300010320|Ga0134109_10117552All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300010343|Ga0074044_10454589All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300010358|Ga0126370_11919019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300010361|Ga0126378_10467425All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300010361|Ga0126378_10584630All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300010361|Ga0126378_13391475All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300011120|Ga0150983_14473137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes880Open in IMG/M
3300011270|Ga0137391_10209505All Organisms → cellular organisms → Bacteria → Acidobacteria1694Open in IMG/M
3300011271|Ga0137393_10961577All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300011271|Ga0137393_11492946All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300012096|Ga0137389_10952673All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300012096|Ga0137389_11370202All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300012202|Ga0137363_10004677All Organisms → cellular organisms → Bacteria → Acidobacteria8411Open in IMG/M
3300012202|Ga0137363_10965338All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012202|Ga0137363_11076212All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300012203|Ga0137399_11211234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga636Open in IMG/M
3300012208|Ga0137376_10806895All Organisms → cellular organisms → Bacteria → Acidobacteria808Open in IMG/M
3300012210|Ga0137378_10502352All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300012285|Ga0137370_10168328All Organisms → cellular organisms → Bacteria1274Open in IMG/M
3300012361|Ga0137360_11594164All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300012922|Ga0137394_11512274All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300012923|Ga0137359_10194297All Organisms → cellular organisms → Bacteria → Acidobacteria1813Open in IMG/M
3300012924|Ga0137413_11314811All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300012929|Ga0137404_10308754All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300012944|Ga0137410_12090636All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012960|Ga0164301_10521700All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300012971|Ga0126369_10375593Not Available1452Open in IMG/M
3300013832|Ga0120132_1015543All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300014154|Ga0134075_10396145All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300014200|Ga0181526_10222760All Organisms → cellular organisms → Bacteria → Acidobacteria1205Open in IMG/M
3300014325|Ga0163163_10895161All Organisms → cellular organisms → Bacteria → Acidobacteria951Open in IMG/M
3300015245|Ga0137409_10450206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1107Open in IMG/M
3300016319|Ga0182033_10323592All Organisms → cellular organisms → Bacteria → Acidobacteria1280Open in IMG/M
3300016319|Ga0182033_11435985All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300016341|Ga0182035_10149720Not Available1790Open in IMG/M
3300016341|Ga0182035_11640734All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300016404|Ga0182037_11518105All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300017934|Ga0187803_10431640All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300017961|Ga0187778_10468723All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300017966|Ga0187776_10644163All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300017975|Ga0187782_11481712All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300018468|Ga0066662_11437396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga715Open in IMG/M
3300019788|Ga0182028_1408159All Organisms → cellular organisms → Bacteria1757Open in IMG/M
3300020199|Ga0179592_10080138All Organisms → cellular organisms → Bacteria → Acidobacteria1497Open in IMG/M
3300020579|Ga0210407_10537809All Organisms → cellular organisms → Bacteria → Acidobacteria912Open in IMG/M
3300020580|Ga0210403_10133172All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300020580|Ga0210403_10214987All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300020580|Ga0210403_10314410All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300020580|Ga0210403_11115088All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300020582|Ga0210395_10036267All Organisms → cellular organisms → Bacteria3616Open in IMG/M
3300021171|Ga0210405_10295626All Organisms → cellular organisms → Bacteria → Acidobacteria1280Open in IMG/M
3300021181|Ga0210388_11769784All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300021402|Ga0210385_10437146All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300021403|Ga0210397_10190287All Organisms → cellular organisms → Bacteria → Acidobacteria1461Open in IMG/M
3300021403|Ga0210397_11011858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter645Open in IMG/M
3300021404|Ga0210389_10433338Not Available1034Open in IMG/M
3300021405|Ga0210387_10096580All Organisms → cellular organisms → Bacteria → Acidobacteria2464Open in IMG/M
3300021420|Ga0210394_11311493All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300021479|Ga0210410_10340200All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300021559|Ga0210409_10240137All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300021559|Ga0210409_10644050All Organisms → cellular organisms → Bacteria → Acidobacteria929Open in IMG/M
3300021559|Ga0210409_11072235All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300021559|Ga0210409_11710132All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300021560|Ga0126371_12557287All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300022557|Ga0212123_10293232All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300022722|Ga0242657_1033636All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300024186|Ga0247688_1009074All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300024186|Ga0247688_1014387All Organisms → cellular organisms → Bacteria → Acidobacteria1129Open in IMG/M
3300025905|Ga0207685_10128006All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300025906|Ga0207699_10256225All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300025914|Ga0207671_10376138All Organisms → cellular organisms → Bacteria → Acidobacteria1128Open in IMG/M
3300025916|Ga0207663_10109157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1875Open in IMG/M
3300025916|Ga0207663_11172200All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300025934|Ga0207686_11584398All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300025939|Ga0207665_10158257All Organisms → cellular organisms → Bacteria → Acidobacteria1627Open in IMG/M
3300026333|Ga0209158_1229688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga638Open in IMG/M
3300026889|Ga0207745_1021431All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300027000|Ga0207803_1016751All Organisms → cellular organisms → Bacteria → Acidobacteria972Open in IMG/M
3300027045|Ga0207726_1034278All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300027439|Ga0209332_1098190All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300027546|Ga0208984_1049453All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300027651|Ga0209217_1040615All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1431Open in IMG/M
3300027671|Ga0209588_1118512All Organisms → cellular organisms → Bacteria → Acidobacteria848Open in IMG/M
3300027674|Ga0209118_1009871All Organisms → cellular organisms → Bacteria3291Open in IMG/M
3300027826|Ga0209060_10259304Not Available796Open in IMG/M
3300027842|Ga0209580_10585361All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300027846|Ga0209180_10075892All Organisms → cellular organisms → Bacteria1892Open in IMG/M
3300027846|Ga0209180_10349272All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300027862|Ga0209701_10021572All Organisms → cellular organisms → Bacteria4200Open in IMG/M
3300027875|Ga0209283_10080262All Organisms → cellular organisms → Bacteria → Acidobacteria2113Open in IMG/M
3300027882|Ga0209590_10246430All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300027884|Ga0209275_10115567All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300027895|Ga0209624_11095634All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300027903|Ga0209488_10385961All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300027908|Ga0209006_10170163All Organisms → cellular organisms → Bacteria1904Open in IMG/M
3300028016|Ga0265354_1006409All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300028536|Ga0137415_10023334All Organisms → cellular organisms → Bacteria6116Open in IMG/M
3300028775|Ga0302231_10432262All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300028776|Ga0302303_10026735All Organisms → cellular organisms → Bacteria2428Open in IMG/M
3300030707|Ga0310038_10232930Not Available861Open in IMG/M
3300030759|Ga0265745_1007027All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300030813|Ga0265750_1009595All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300030879|Ga0265765_1023159All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300030945|Ga0075373_10207184All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300030991|Ga0073994_10052854All Organisms → cellular organisms → Bacteria → Proteobacteria2413Open in IMG/M
3300030991|Ga0073994_11654302All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300031057|Ga0170834_101657560All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300031090|Ga0265760_10064790All Organisms → cellular organisms → Bacteria → Acidobacteria1115Open in IMG/M
3300031474|Ga0170818_101731143All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300031561|Ga0318528_10314254Not Available841Open in IMG/M
3300031681|Ga0318572_10476119All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300031718|Ga0307474_10460490All Organisms → cellular organisms → Bacteria → Acidobacteria995Open in IMG/M
3300031753|Ga0307477_11083313All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300031754|Ga0307475_10156489All Organisms → cellular organisms → Bacteria → Acidobacteria1811Open in IMG/M
3300031820|Ga0307473_10833613All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300031820|Ga0307473_10896376All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031823|Ga0307478_11126387All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300031890|Ga0306925_10375915Not Available1524Open in IMG/M
3300031941|Ga0310912_10343499All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300031942|Ga0310916_10976890All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300031962|Ga0307479_10606122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1077Open in IMG/M
3300031962|Ga0307479_10787309All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300031962|Ga0307479_11841822All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300031981|Ga0318531_10558185All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300032035|Ga0310911_10463255All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300032052|Ga0318506_10303647All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300032174|Ga0307470_11547783All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300032180|Ga0307471_101559205All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300032205|Ga0307472_101302225All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300032783|Ga0335079_10268090All Organisms → cellular organisms → Bacteria → Acidobacteria1872Open in IMG/M
3300032805|Ga0335078_11089059All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.25%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.59%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.16%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.90%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.27%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.27%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.27%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.63%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.63%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.63%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.63%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.63%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.63%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026889Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes)EnvironmentalOpen in IMG/M
3300027000Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030759Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_103606602189573000Grass SoilFVPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEPADAAWR
JGI12635J15846_1007973613300001593Forest SoilFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP*
JGIcombinedJ26739_10143662913300002245Forest SoilFAPSEWGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT*
JGIcombinedJ26739_10144789713300002245Forest SoilLFVPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEQSGD*
JGI25613J43889_1002078663300002907Grasslands SoilSGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP*
JGI25617J43924_1024866613300002914Grasslands SoilSGDAFQKKYFDAIQRDPAVVIEHAELARLFNNEPPDSSTP*
Ga0062384_10093137813300004082Bog Forest SoilESGDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP*
Ga0062387_10014960133300004091Bog Forest SoilSESGDAFQKKYYDAIQMDPAVVIDHAQLARLFNDEPPDVSSQ*
Ga0066673_1007416813300005175SoilTESGDHFQKKYFDAIQNDPAVVIEHAELAKLFNNEPPDSSAA*
Ga0070733_1096807723300005541Surface SoilAEEGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSTT*
Ga0070761_1006774013300005591SoilESGDAFQKKYYDAIQLDPAVVIDHAELARLFNNEPPDVSST*
Ga0066903_10549357123300005764Tropical Forest SoilETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDRE*
Ga0066903_10770019813300005764Tropical Forest SoilNFQKKYFAAIQNDPAVVIEHAELAKLFNNEPPDSSAA*
Ga0070716_10010116613300006173Corn, Switchgrass And Miscanthus RhizosphereTESGDSFQKRYYDAIQRDPTVVMEHAELARLFGSEPREAENQ*
Ga0070765_10006248713300006176SoilKKYFDAIQRDPAVVIDHAELARLFNNEPPDSPNP*
Ga0079222_1059483113300006755Agricultural SoilKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAT*
Ga0075425_10074778033300006854Populus RhizosphereSGDNFQKKYFAAIQNDPAVVIEHAELAKLFNNEPPDSSAA*
Ga0066710_10143011823300009012Grasslands SoilSDNGDGFQKLYYDAIQRDPLVVMEHAELARLFAQEPPDPPTPAR
Ga0099828_1091362423300009089Vadose Zone SoilFQKKYFDAIQNDPAVVMEHAELARLFLNEPAERESE*
Ga0099827_1007333813300009090Vadose Zone SoilESGDAFQKKYFDAIQRDPTVVIEHAELARLFNNEPPDSSTP*
Ga0099827_1191474613300009090Vadose Zone SoilTESGDSFQKKYFEAIQRDPVVVIDHAELVRLFNNEPPDSANP*
Ga0066709_10002585973300009137Grasslands SoilFQKLYYDAIQRDPLVVMEHAELARLFAQEPPDPPTPAR*
Ga0105237_1048334813300009545Corn RhizosphereESGDSFQKRYFDAIQRDPAVVMVHADLAKVFANEPRQQAAS*
Ga0116216_1086996123300009698Peatlands SoilGFQKKYFDAIQKDPAVVMEHAELVRLFHNAPPDAENE*
Ga0126380_1142347323300010043Tropical Forest SoilQKRHFDAIQRDPAVVMEHAELAKIFANEPGETPAS*
Ga0126373_1021323253300010048Tropical Forest SoilVPTESGDGFQKKYFDAIQSDPAVVIEHAELARLFNNEPPDSSGA*
Ga0126373_1118415033300010048Tropical Forest SoilVPTESGDGFQKKYFDAIQSDPAVVIEHAELARLFNNEPPDFSGA*
Ga0134109_1011755213300010320Grasslands SoilKKYFDAIQNDPAVVIEHAELAKLFNNEPPDSSAA*
Ga0074044_1045458913300010343Bog Forest SoilKKYFDAIQKDPAVVIEHAELARLFHNEPLDREGE*
Ga0126370_1191901923300010358Tropical Forest SoilAPSESGDAFQKRYFAAIQRDPSVVMEHAELARLFSNEPSDPGS*
Ga0126378_1046742543300010361Tropical Forest SoilDGFQKQYFDAIQRDPAVVMEHAELARLFNNEPPDREGE*
Ga0126378_1058463033300010361Tropical Forest SoilAPTEAGDGFQKQYFDAIQRDPTVVMEHAELVRLFNNEPPDRESD*
Ga0126378_1339147513300010361Tropical Forest SoilGDGFQKKYFDAIQSDPAVVIEHAELARLFNNEPPDFSGA*
Ga0150983_1447313713300011120Forest SoilGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP*
Ga0137391_1020950513300011270Vadose Zone SoilVPTESGDAFQKKYFDAIQNDPAVVIDHAELARLFNNEPPDSSTP*
Ga0137393_1096157723300011271Vadose Zone SoilEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM*
Ga0137393_1149294613300011271Vadose Zone SoilKRYFDAIQRDPAVVMEHAELARLFANEPSDASPTY*
Ga0137389_1095267323300012096Vadose Zone SoilESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSTP*
Ga0137389_1137020223300012096Vadose Zone SoilFAPSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM*
Ga0137363_1000467713300012202Vadose Zone SoilKKYFDAIQNDPAVVIDHAELARLFNNEPPDSSTP*
Ga0137363_1096533833300012202Vadose Zone SoilFQKKYFDAIQRDPTVVMEHAELARLFNNEPPDTGSL*
Ga0137363_1107621223300012202Vadose Zone SoilAPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT*
Ga0137399_1121123433300012203Vadose Zone SoilSGDSFQKKYFDAIQRDPAVVIEHAELARLFNNEPPDSASS*
Ga0137376_1080689523300012208Vadose Zone SoilFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAM*
Ga0137378_1050235233300012210Vadose Zone SoilDAFQKKYFDAIQRDPAVVIDHAELARLFNTEPPDSPTV*
Ga0137370_1016832833300012285Vadose Zone SoilESGVAFQKQYFDAIQRDPAVVIDHAELARLFNNEPCDSPTP*
Ga0137360_1159416413300012361Vadose Zone SoilTGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEV*
Ga0137394_1151227413300012922Vadose Zone SoilMFAPSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM*
Ga0137359_1019429733300012923Vadose Zone SoilDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAT*
Ga0137413_1131481113300012924Vadose Zone SoilPSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAM*
Ga0137404_1030875413300012929Vadose Zone SoilPTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP*
Ga0137410_1209063623300012944Vadose Zone SoilESGDAFQKKYFDAIQLDPAVVIDHAELARLFNNEPPDVSPP*
Ga0164301_1052170023300012960SoilSESGDAFQKKYFDAIQSDPAVVIDHAELARLFNNAPPDASSL*
Ga0126369_1037559343300012971Tropical Forest SoilGDGFQKKYFDAIQKDPAVVMEHAQLARLFNTEPADREPG*
Ga0120132_101554313300013832PermafrostESGDAFQKRYFDAIQRDPAVVMEHAELARLFNNEPADSGAA*
Ga0134075_1039614513300014154Grasslands SoilGDGFQKLYYDAIQRDPLVVMEHAELARLFAQEPPDPPTPAR*
Ga0181526_1022276013300014200BogGDGFQKKYFDAIHKDPAVVMEHAELARLFHNEPLDRETE*
Ga0163163_1089516113300014325Switchgrass RhizosphereMFAPSDVGDAFQKRYYDAIQRDPTVVMEHAELARLFLNEPLDSPP*
Ga0137409_1045020633300015245Vadose Zone SoilTETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDVEA*
Ga0182033_1032359233300016319SoilFQKKYFDAIQSDPTVVMEHAELVRLFNNEPTEREVE
Ga0182033_1143598513300016319SoilSERGDGFQKKYFDAIQRDPAVVMEHAELARLFQSEPQEREGE
Ga0182035_1014972013300016341SoilIFAPSESGDGFQKKYFDAIQRDPSVVMEHAVLVRLFSNEPADSEGS
Ga0182035_1164073413300016341SoilFAPTEAGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDRESE
Ga0182037_1151810523300016404SoilSESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNVPGDSDGT
Ga0187803_1043164023300017934Freshwater SedimentFQKKYFDAIQKDPAVVMEHADLARLFHNEPVDPENE
Ga0187778_1046872313300017961Tropical PeatlandGDGFQKQYFDAIQRDPAVVMEHAELARLFNNEPPDQ
Ga0187776_1064416323300017966Tropical PeatlandETGDGFQKKYFDAIQKDPAVVMEHAELARLFHNEPVDHEGE
Ga0187782_1148171213300017975Tropical PeatlandDAFQKRYFAAIQRDPAVVMEHAELARLFSNEPPETSGT
Ga0066662_1143739613300018468Grasslands SoilTESGDTFQKKYFVAIQRDPAVVIEHAELARLFNNEPPDSATP
Ga0182028_140815913300019788FenTGDGFQKKYFDAIQKDPAVVMEHAELVRLFHIEPPGAENQ
Ga0179592_1008013813300020199Vadose Zone SoilAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAM
Ga0210407_1053780923300020579SoilAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT
Ga0210403_1013317233300020580SoilVPTRSGEAFQKKYFDAIQNDPAVVIDHAELARLFNNEPPDSSNP
Ga0210403_1021498713300020580SoilGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPSDPEG
Ga0210403_1031441013300020580SoilFQKQYFDAIQRDPAVVMEHAELVRLFNTEPPDAEG
Ga0210403_1111508813300020580SoilPTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSATP
Ga0210395_1003626743300020582SoilFTPNESGDSFQKKYYGAIHGDPTVVMDHAELARLFNSEPSDAGAAQ
Ga0210405_1029562623300021171SoilDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDVNPT
Ga0210388_1176978423300021181SoilAPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDVNPT
Ga0210385_1043714623300021402SoilEAGDAFQKRYFDAIQRDPAVVMVHAELARIFANEPGEAAGT
Ga0210397_1019028723300021403SoilPSESGDAFQKRYFDAIQREPAVVMVHADLAKIFANEPGEQTAG
Ga0210397_1101185823300021403SoilGDGFQKRYFDAIQRDPAVVMEHAELARLFANEPADPAPS
Ga0210389_1043333813300021404SoilDGFQKKYFEAIHKDPAVVMEHAELARMFLTEPVDGEG
Ga0210387_1009658013300021405SoilDGFQKRYFDAIQRDPAVVMEHAELARLFANEPADPAPS
Ga0210394_1131149323300021420SoilESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT
Ga0210410_1034020033300021479SoilFAPTETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPSDPEG
Ga0210409_1024013713300021559SoilTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP
Ga0210409_1064405013300021559SoilTDSGDGFQKKYFAAIQRDPAVVIDHAELARLFNIEPPDSPTP
Ga0210409_1107223533300021559SoilSGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSAP
Ga0210409_1171013213300021559SoilPTETGDGFQKKYFEAIHKDPAVVMEHAELARMFLTEPVDGEG
Ga0126371_1255728713300021560Tropical Forest SoilDGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDFDGT
Ga0212123_1029323213300022557Iron-Sulfur Acid SpringVPSKSGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEPDVRG
Ga0242657_103363633300022722SoilMFAPSESGDAFQKKYYDAIQLDPAVVIDHAELARLFNNEPPDVSST
Ga0247688_100907413300024186SoilSEMGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEA
Ga0247688_101438723300024186SoilSEEGDAFQKRYFTAIQRDPSVVMEHAELARLFANEPADSTP
Ga0207685_1012800613300025905Corn, Switchgrass And Miscanthus RhizosphereFQKRYFDAIQRDPTVVMEHAELAKLFANEPSDTGTM
Ga0207699_1025622533300025906Corn, Switchgrass And Miscanthus RhizosphereDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEA
Ga0207671_1037613823300025914Corn RhizosphereFQKRYFDAIQRDPAVVMVHADLAKVFANEPGEQAAS
Ga0207663_1010915713300025916Corn, Switchgrass And Miscanthus RhizosphereGDSFQKRYYDAIQRDPTVVMEHAELARLFGSEPREAENQ
Ga0207663_1117220013300025916Corn, Switchgrass And Miscanthus RhizosphereAIQKRYFDAIQRDPAVVMEHAELARLFNSEPEVRG
Ga0207686_1158439823300025934Miscanthus RhizosphereKMFAPSDVGDAFQKRYYDAIQRDPTVVMEHAELARLFLNEPLDSPP
Ga0207665_1015825733300025939Corn, Switchgrass And Miscanthus RhizosphereSGDSFQKRYYDAIQRDPTVVMEHAELARLFGSEPREAENQ
Ga0209158_122968833300026333SoilAFQKKYFDAIQRDPAVVIDHAELARLFNNEPLDSSTP
Ga0207745_102143123300026889Tropical Forest SoilAPSESGDGFQKKYFDAIQRDPSVVMEHAELVRLFSNEPADSEGT
Ga0207803_101675123300027000Tropical Forest SoilQKKYFDAIQNDPAVVMEHAELVRLFNNEPGDREAE
Ga0207726_103427833300027045Tropical Forest SoilGDGFQKKYFDAIQRDPSVVMEHAELVRLFSNEPADSEGT
Ga0209332_109819023300027439Forest SoilSESGDAFQKRYFHAIQRDPTVVMEHAELAKLFANEPPDAGTM
Ga0208984_104945313300027546Forest SoilDAFQKRYFDAIQRDPAVVMEHAELARLFNSEPVEPSAT
Ga0209217_104061533300027651Forest SoilSGDGFQKKYYHAIQKDPAVVMEHAELARLFQQEPSEAEKD
Ga0209588_111851213300027671Vadose Zone SoilFVPTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSTP
Ga0209118_100987153300027674Forest SoilFQKKYFDAIQRDPAVVIEHAELARLFNNEPLDSSIP
Ga0209060_1025930423300027826Surface SoilTGDGFQKKYYDAIQADPTVVMQHAELAKMFLNERADT
Ga0209580_1058536123300027842Surface SoilDAFQKRYFDAIQRDPTVVMEHAELAKLFANEPPDTGTM
Ga0209180_1007589253300027846Vadose Zone SoilFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSTP
Ga0209180_1034927223300027846Vadose Zone SoilSGDSFQKKYFDAIQLDPAVVMEHAELARLFANEPSEKDNR
Ga0209701_1002157213300027862Vadose Zone SoilFQKKYFEAIQLDPAVVIEHAELARLFNNEPPDSASP
Ga0209283_1008026213300027875Vadose Zone SoilFAPSESGDAFQKRYFDAIQRDPTVVMEHAELAKLFANEPSDAGTM
Ga0209590_1024643013300027882Vadose Zone SoilSGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPLDSSTP
Ga0209275_1011556733300027884SoilPSESGDAFQKKYYDAIQLDPAVVIDHAELARLFNNEPPDVSSQ
Ga0209624_1109563423300027895Forest SoilSGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEPAEPSAT
Ga0209488_1038596143300027903Vadose Zone SoilVPTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTAAP
Ga0209006_1017016313300027908Forest SoilAPAETGDGFQKQYFYAIQRDPAVVMEHAELVRLFNNEPPDAEG
Ga0265354_100640913300028016RhizospherePSESGDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP
Ga0137415_1002333413300028536Vadose Zone SoilMFAPSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM
Ga0302231_1043226233300028775PalsaAFQKKYFDAIQRDPAVVMDHAEMARLFNSEPGDSTTA
Ga0302303_1002673553300028776PalsaTESGDAFQKKYFDAIQRDPAVVMDHAEMARLFNSEPGDSTTA
Ga0310038_1023293023300030707Peatlands SoilTETGDGFQKKYFDAIQKDPAVVMEHAELVRLFHNEPLDAENQ
Ga0265745_100702723300030759SoilFQKKYFDAIQLDPAVVIDHAELARLFNNEPPDVSSP
Ga0265750_100959533300030813SoilGDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP
Ga0265765_102315913300030879SoilSESGDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP
Ga0075373_1020718423300030945SoilTGDGFQKQYFHAIQRDPAVVMEHAELVRLFNNEPPDAEG
Ga0073994_1005285413300030991SoilFAPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT
Ga0073994_1165430213300030991SoilQKRYFDAIQRDPTVVMEHAELAKLFANEPSDTGTM
Ga0170834_10165756023300031057Forest SoilFAPTETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEV
Ga0265760_1006479013300031090SoilPTESGDSFQKRYYDAIQRDPAVVMEHAELARLFGNEPKDAENQ
Ga0170818_10173114313300031474Forest SoilSGDSFQKRYYDAIQKDPTVVMEHAELARLFGSEPREAENQ
Ga0318528_1031425413300031561SoilSESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT
Ga0318572_1047611913300031681SoilQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT
Ga0307474_1046049013300031718Hardwood Forest SoilFQKRYFDAIQRDPAVVIEHAELAKIFANEPGEQAAS
Ga0307477_1108331323300031753Hardwood Forest SoilQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSPVP
Ga0307475_1015648933300031754Hardwood Forest SoilFQKRYFDAIQRDPAVVMEHAELARLFANEPSDVSPT
Ga0307473_1083361333300031820Hardwood Forest SoilSGDNFQKKYFDAIQNDPAVVIEHVELAKLFNNEPPDSSAA
Ga0307473_1089637613300031820Hardwood Forest SoilMFVPAESGDSFQKQYFDAIQKEPAVVMEHAELARLFNAEPPEPAAP
Ga0307478_1112638723300031823Hardwood Forest SoilQKRYFDAIQRDPTVVMEHAELARLFANEPSDPGPA
Ga0306925_1037591513300031890SoilESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT
Ga0310912_1034349913300031941SoilPSESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT
Ga0310916_1097689013300031942SoilDGFQKKYFDAIQKDPAVVMEHAQLARLFNTEPADREPG
Ga0307479_1060612223300031962Hardwood Forest SoilAPSETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEG
Ga0307479_1078730943300031962Hardwood Forest SoilFQKNYFAAIQRDPAVVIDHAELVRLFNNEPPDSSIP
Ga0307479_1184182223300031962Hardwood Forest SoilFAPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAT
Ga0318531_1055818523300031981SoilGFQKKYFDAIQKDPAVVMEHAQLARLFNTEPADREPG
Ga0310911_1046325513300032035SoilGFQKKYFDAIQRDPTVVMEHAGLVRLFLTEPGDGEK
Ga0318506_1030364723300032052SoilPSERGDGFQKKYFDAIQRDPAVVMEHAELARLFQSEPQEREGE
Ga0307470_1154778323300032174Hardwood Forest SoilSGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAT
Ga0307471_10155920523300032180Hardwood Forest SoilTETGDGFQKQYFHAIQRDPAVVMEHAELVRLFNNEPPDAEG
Ga0307472_10130222523300032205Hardwood Forest SoilESGDGFQKKYYDAIQTDPSVVMEHAELVRIFNTEAGEPEDA
Ga0335079_1026809013300032783SoilIFAPTESGDGFQKKYFDAIQRDPAVVMEHAELARIFNNEPVDCESD
Ga0335078_1108905913300032805SoilFQKKYFDAIQKDPAVVMEHAQLARMFNNEPPDRENS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.