| Basic Information | |
|---|---|
| Family ID | F042527 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 40 residues |
| Representative Sequence | SGDAFQKKYFDAIQRDPAVVIEHAELARLFNNEPPDSSTP |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.37 % |
| % of genes from short scaffolds (< 2000 bps) | 90.51 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.937 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.253 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.013 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.532 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF14684 | Tricorn_C1 | 23.42 |
| PF02245 | Pur_DNA_glyco | 17.09 |
| PF13590 | DUF4136 | 13.92 |
| PF14542 | Acetyltransf_CG | 8.86 |
| PF06902 | Fer4_19 | 2.53 |
| PF02678 | Pirin | 2.53 |
| PF02518 | HATPase_c | 2.53 |
| PF00072 | Response_reg | 1.90 |
| PF13847 | Methyltransf_31 | 1.90 |
| PF05726 | Pirin_C | 1.27 |
| PF07589 | PEP-CTERM | 1.27 |
| PF08281 | Sigma70_r4_2 | 1.27 |
| PF13432 | TPR_16 | 0.63 |
| PF03795 | YCII | 0.63 |
| PF03544 | TonB_C | 0.63 |
| PF17152 | CHASE8 | 0.63 |
| PF13187 | Fer4_9 | 0.63 |
| PF12681 | Glyoxalase_2 | 0.63 |
| PF00920 | ILVD_EDD | 0.63 |
| PF07366 | SnoaL | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 17.09 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 3.80 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.27 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.94 % |
| Unclassified | root | N/A | 5.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01B3LUK | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300001593|JGI12635J15846_10079736 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101436629 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101447897 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300002907|JGI25613J43889_10020786 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300002914|JGI25617J43924_10248666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300004082|Ga0062384_100931378 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300004091|Ga0062387_100149601 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300005175|Ga0066673_10074168 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300005541|Ga0070733_10968077 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005591|Ga0070761_10067740 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300005764|Ga0066903_105493571 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005764|Ga0066903_107700198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300006173|Ga0070716_100101166 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300006176|Ga0070765_100062487 | All Organisms → cellular organisms → Bacteria | 3091 | Open in IMG/M |
| 3300006755|Ga0079222_10594831 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006854|Ga0075425_100747780 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300009012|Ga0066710_101430118 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300009089|Ga0099828_10913624 | Not Available | 784 | Open in IMG/M |
| 3300009090|Ga0099827_10073338 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
| 3300009090|Ga0099827_11914746 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009137|Ga0066709_100025859 | All Organisms → cellular organisms → Bacteria | 6073 | Open in IMG/M |
| 3300009545|Ga0105237_10483348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300009698|Ga0116216_10869961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300010043|Ga0126380_11423473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300010048|Ga0126373_10213232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1879 | Open in IMG/M |
| 3300010048|Ga0126373_11184150 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300010320|Ga0134109_10117552 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300010343|Ga0074044_10454589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300010358|Ga0126370_11919019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300010361|Ga0126378_10467425 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300010361|Ga0126378_10584630 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300010361|Ga0126378_13391475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300011120|Ga0150983_14473137 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 880 | Open in IMG/M |
| 3300011270|Ga0137391_10209505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1694 | Open in IMG/M |
| 3300011271|Ga0137393_10961577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300011271|Ga0137393_11492946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012096|Ga0137389_10952673 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012096|Ga0137389_11370202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300012202|Ga0137363_10004677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8411 | Open in IMG/M |
| 3300012202|Ga0137363_10965338 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012202|Ga0137363_11076212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012203|Ga0137399_11211234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga | 636 | Open in IMG/M |
| 3300012208|Ga0137376_10806895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300012210|Ga0137378_10502352 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300012285|Ga0137370_10168328 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300012361|Ga0137360_11594164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012922|Ga0137394_11512274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012923|Ga0137359_10194297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1813 | Open in IMG/M |
| 3300012924|Ga0137413_11314811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012929|Ga0137404_10308754 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300012944|Ga0137410_12090636 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012960|Ga0164301_10521700 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300012971|Ga0126369_10375593 | Not Available | 1452 | Open in IMG/M |
| 3300013832|Ga0120132_1015543 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300014154|Ga0134075_10396145 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300014200|Ga0181526_10222760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300014325|Ga0163163_10895161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300015245|Ga0137409_10450206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1107 | Open in IMG/M |
| 3300016319|Ga0182033_10323592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300016319|Ga0182033_11435985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300016341|Ga0182035_10149720 | Not Available | 1790 | Open in IMG/M |
| 3300016341|Ga0182035_11640734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300016404|Ga0182037_11518105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300017934|Ga0187803_10431640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300017961|Ga0187778_10468723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300017966|Ga0187776_10644163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300017975|Ga0187782_11481712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300018468|Ga0066662_11437396 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga | 715 | Open in IMG/M |
| 3300019788|Ga0182028_1408159 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300020199|Ga0179592_10080138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
| 3300020579|Ga0210407_10537809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300020580|Ga0210403_10133172 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300020580|Ga0210403_10214987 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300020580|Ga0210403_10314410 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300020580|Ga0210403_11115088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300020582|Ga0210395_10036267 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
| 3300021171|Ga0210405_10295626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300021181|Ga0210388_11769784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300021402|Ga0210385_10437146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300021403|Ga0210397_10190287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1461 | Open in IMG/M |
| 3300021403|Ga0210397_11011858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 645 | Open in IMG/M |
| 3300021404|Ga0210389_10433338 | Not Available | 1034 | Open in IMG/M |
| 3300021405|Ga0210387_10096580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2464 | Open in IMG/M |
| 3300021420|Ga0210394_11311493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300021479|Ga0210410_10340200 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300021559|Ga0210409_10240137 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300021559|Ga0210409_10644050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300021559|Ga0210409_11072235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300021559|Ga0210409_11710132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300021560|Ga0126371_12557287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300022557|Ga0212123_10293232 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300022722|Ga0242657_1033636 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300024186|Ga0247688_1009074 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300024186|Ga0247688_1014387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300025905|Ga0207685_10128006 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300025906|Ga0207699_10256225 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300025914|Ga0207671_10376138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300025916|Ga0207663_10109157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1875 | Open in IMG/M |
| 3300025916|Ga0207663_11172200 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300025934|Ga0207686_11584398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300025939|Ga0207665_10158257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1627 | Open in IMG/M |
| 3300026333|Ga0209158_1229688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga | 638 | Open in IMG/M |
| 3300026889|Ga0207745_1021431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300027000|Ga0207803_1016751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300027045|Ga0207726_1034278 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027439|Ga0209332_1098190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300027546|Ga0208984_1049453 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300027651|Ga0209217_1040615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1431 | Open in IMG/M |
| 3300027671|Ga0209588_1118512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300027674|Ga0209118_1009871 | All Organisms → cellular organisms → Bacteria | 3291 | Open in IMG/M |
| 3300027826|Ga0209060_10259304 | Not Available | 796 | Open in IMG/M |
| 3300027842|Ga0209580_10585361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300027846|Ga0209180_10075892 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300027846|Ga0209180_10349272 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300027862|Ga0209701_10021572 | All Organisms → cellular organisms → Bacteria | 4200 | Open in IMG/M |
| 3300027875|Ga0209283_10080262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2113 | Open in IMG/M |
| 3300027882|Ga0209590_10246430 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300027884|Ga0209275_10115567 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300027895|Ga0209624_11095634 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027903|Ga0209488_10385961 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300027908|Ga0209006_10170163 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300028016|Ga0265354_1006409 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300028536|Ga0137415_10023334 | All Organisms → cellular organisms → Bacteria | 6116 | Open in IMG/M |
| 3300028775|Ga0302231_10432262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300028776|Ga0302303_10026735 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300030707|Ga0310038_10232930 | Not Available | 861 | Open in IMG/M |
| 3300030759|Ga0265745_1007027 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300030813|Ga0265750_1009595 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300030879|Ga0265765_1023159 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300030945|Ga0075373_10207184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300030991|Ga0073994_10052854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2413 | Open in IMG/M |
| 3300030991|Ga0073994_11654302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300031057|Ga0170834_101657560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300031090|Ga0265760_10064790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300031474|Ga0170818_101731143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300031561|Ga0318528_10314254 | Not Available | 841 | Open in IMG/M |
| 3300031681|Ga0318572_10476119 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031718|Ga0307474_10460490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300031753|Ga0307477_11083313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300031754|Ga0307475_10156489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1811 | Open in IMG/M |
| 3300031820|Ga0307473_10833613 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031820|Ga0307473_10896376 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031823|Ga0307478_11126387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300031890|Ga0306925_10375915 | Not Available | 1524 | Open in IMG/M |
| 3300031941|Ga0310912_10343499 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300031942|Ga0310916_10976890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300031962|Ga0307479_10606122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1077 | Open in IMG/M |
| 3300031962|Ga0307479_10787309 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300031962|Ga0307479_11841822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300031981|Ga0318531_10558185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300032035|Ga0310911_10463255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300032052|Ga0318506_10303647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300032174|Ga0307470_11547783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300032180|Ga0307471_101559205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300032205|Ga0307472_101302225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300032783|Ga0335079_10268090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1872 | Open in IMG/M |
| 3300032805|Ga0335078_11089059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.16% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.63% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_10360660 | 2189573000 | Grass Soil | FVPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEPADAAWR |
| JGI12635J15846_100797361 | 3300001593 | Forest Soil | FQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP* |
| JGIcombinedJ26739_1014366291 | 3300002245 | Forest Soil | FAPSEWGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT* |
| JGIcombinedJ26739_1014478971 | 3300002245 | Forest Soil | LFVPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEQSGD* |
| JGI25613J43889_100207866 | 3300002907 | Grasslands Soil | SGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP* |
| JGI25617J43924_102486661 | 3300002914 | Grasslands Soil | SGDAFQKKYFDAIQRDPAVVIEHAELARLFNNEPPDSSTP* |
| Ga0062384_1009313781 | 3300004082 | Bog Forest Soil | ESGDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP* |
| Ga0062387_1001496013 | 3300004091 | Bog Forest Soil | SESGDAFQKKYYDAIQMDPAVVIDHAQLARLFNDEPPDVSSQ* |
| Ga0066673_100741681 | 3300005175 | Soil | TESGDHFQKKYFDAIQNDPAVVIEHAELAKLFNNEPPDSSAA* |
| Ga0070733_109680772 | 3300005541 | Surface Soil | AEEGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSTT* |
| Ga0070761_100677401 | 3300005591 | Soil | ESGDAFQKKYYDAIQLDPAVVIDHAELARLFNNEPPDVSST* |
| Ga0066903_1054935712 | 3300005764 | Tropical Forest Soil | ETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDRE* |
| Ga0066903_1077001981 | 3300005764 | Tropical Forest Soil | NFQKKYFAAIQNDPAVVIEHAELAKLFNNEPPDSSAA* |
| Ga0070716_1001011661 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TESGDSFQKRYYDAIQRDPTVVMEHAELARLFGSEPREAENQ* |
| Ga0070765_1000624871 | 3300006176 | Soil | KKYFDAIQRDPAVVIDHAELARLFNNEPPDSPNP* |
| Ga0079222_105948311 | 3300006755 | Agricultural Soil | KRYFDAIQRDPAVVMEHAELARLFANEPSDTSAT* |
| Ga0075425_1007477803 | 3300006854 | Populus Rhizosphere | SGDNFQKKYFAAIQNDPAVVIEHAELAKLFNNEPPDSSAA* |
| Ga0066710_1014301182 | 3300009012 | Grasslands Soil | SDNGDGFQKLYYDAIQRDPLVVMEHAELARLFAQEPPDPPTPAR |
| Ga0099828_109136242 | 3300009089 | Vadose Zone Soil | FQKKYFDAIQNDPAVVMEHAELARLFLNEPAERESE* |
| Ga0099827_100733381 | 3300009090 | Vadose Zone Soil | ESGDAFQKKYFDAIQRDPTVVIEHAELARLFNNEPPDSSTP* |
| Ga0099827_119147461 | 3300009090 | Vadose Zone Soil | TESGDSFQKKYFEAIQRDPVVVIDHAELVRLFNNEPPDSANP* |
| Ga0066709_1000258597 | 3300009137 | Grasslands Soil | FQKLYYDAIQRDPLVVMEHAELARLFAQEPPDPPTPAR* |
| Ga0105237_104833481 | 3300009545 | Corn Rhizosphere | ESGDSFQKRYFDAIQRDPAVVMVHADLAKVFANEPRQQAAS* |
| Ga0116216_108699612 | 3300009698 | Peatlands Soil | GFQKKYFDAIQKDPAVVMEHAELVRLFHNAPPDAENE* |
| Ga0126380_114234732 | 3300010043 | Tropical Forest Soil | QKRHFDAIQRDPAVVMEHAELAKIFANEPGETPAS* |
| Ga0126373_102132325 | 3300010048 | Tropical Forest Soil | VPTESGDGFQKKYFDAIQSDPAVVIEHAELARLFNNEPPDSSGA* |
| Ga0126373_111841503 | 3300010048 | Tropical Forest Soil | VPTESGDGFQKKYFDAIQSDPAVVIEHAELARLFNNEPPDFSGA* |
| Ga0134109_101175521 | 3300010320 | Grasslands Soil | KKYFDAIQNDPAVVIEHAELAKLFNNEPPDSSAA* |
| Ga0074044_104545891 | 3300010343 | Bog Forest Soil | KKYFDAIQKDPAVVIEHAELARLFHNEPLDREGE* |
| Ga0126370_119190192 | 3300010358 | Tropical Forest Soil | APSESGDAFQKRYFAAIQRDPSVVMEHAELARLFSNEPSDPGS* |
| Ga0126378_104674254 | 3300010361 | Tropical Forest Soil | DGFQKQYFDAIQRDPAVVMEHAELARLFNNEPPDREGE* |
| Ga0126378_105846303 | 3300010361 | Tropical Forest Soil | APTEAGDGFQKQYFDAIQRDPTVVMEHAELVRLFNNEPPDRESD* |
| Ga0126378_133914751 | 3300010361 | Tropical Forest Soil | GDGFQKKYFDAIQSDPAVVIEHAELARLFNNEPPDFSGA* |
| Ga0150983_144731371 | 3300011120 | Forest Soil | GDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP* |
| Ga0137391_102095051 | 3300011270 | Vadose Zone Soil | VPTESGDAFQKKYFDAIQNDPAVVIDHAELARLFNNEPPDSSTP* |
| Ga0137393_109615772 | 3300011271 | Vadose Zone Soil | EFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM* |
| Ga0137393_114929461 | 3300011271 | Vadose Zone Soil | KRYFDAIQRDPAVVMEHAELARLFANEPSDASPTY* |
| Ga0137389_109526732 | 3300012096 | Vadose Zone Soil | ESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSTP* |
| Ga0137389_113702022 | 3300012096 | Vadose Zone Soil | FAPSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM* |
| Ga0137363_100046771 | 3300012202 | Vadose Zone Soil | KKYFDAIQNDPAVVIDHAELARLFNNEPPDSSTP* |
| Ga0137363_109653383 | 3300012202 | Vadose Zone Soil | FQKKYFDAIQRDPTVVMEHAELARLFNNEPPDTGSL* |
| Ga0137363_110762122 | 3300012202 | Vadose Zone Soil | APSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT* |
| Ga0137399_112112343 | 3300012203 | Vadose Zone Soil | SGDSFQKKYFDAIQRDPAVVIEHAELARLFNNEPPDSASS* |
| Ga0137376_108068952 | 3300012208 | Vadose Zone Soil | FQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAM* |
| Ga0137378_105023523 | 3300012210 | Vadose Zone Soil | DAFQKKYFDAIQRDPAVVIDHAELARLFNTEPPDSPTV* |
| Ga0137370_101683283 | 3300012285 | Vadose Zone Soil | ESGVAFQKQYFDAIQRDPAVVIDHAELARLFNNEPCDSPTP* |
| Ga0137360_115941641 | 3300012361 | Vadose Zone Soil | TGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEV* |
| Ga0137394_115122741 | 3300012922 | Vadose Zone Soil | MFAPSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM* |
| Ga0137359_101942973 | 3300012923 | Vadose Zone Soil | DAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAT* |
| Ga0137413_113148111 | 3300012924 | Vadose Zone Soil | PSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAM* |
| Ga0137404_103087541 | 3300012929 | Vadose Zone Soil | PTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP* |
| Ga0137410_120906362 | 3300012944 | Vadose Zone Soil | ESGDAFQKKYFDAIQLDPAVVIDHAELARLFNNEPPDVSPP* |
| Ga0164301_105217002 | 3300012960 | Soil | SESGDAFQKKYFDAIQSDPAVVIDHAELARLFNNAPPDASSL* |
| Ga0126369_103755934 | 3300012971 | Tropical Forest Soil | GDGFQKKYFDAIQKDPAVVMEHAQLARLFNTEPADREPG* |
| Ga0120132_10155431 | 3300013832 | Permafrost | ESGDAFQKRYFDAIQRDPAVVMEHAELARLFNNEPADSGAA* |
| Ga0134075_103961451 | 3300014154 | Grasslands Soil | GDGFQKLYYDAIQRDPLVVMEHAELARLFAQEPPDPPTPAR* |
| Ga0181526_102227601 | 3300014200 | Bog | GDGFQKKYFDAIHKDPAVVMEHAELARLFHNEPLDRETE* |
| Ga0163163_108951611 | 3300014325 | Switchgrass Rhizosphere | MFAPSDVGDAFQKRYYDAIQRDPTVVMEHAELARLFLNEPLDSPP* |
| Ga0137409_104502063 | 3300015245 | Vadose Zone Soil | TETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDVEA* |
| Ga0182033_103235923 | 3300016319 | Soil | FQKKYFDAIQSDPTVVMEHAELVRLFNNEPTEREVE |
| Ga0182033_114359851 | 3300016319 | Soil | SERGDGFQKKYFDAIQRDPAVVMEHAELARLFQSEPQEREGE |
| Ga0182035_101497201 | 3300016341 | Soil | IFAPSESGDGFQKKYFDAIQRDPSVVMEHAVLVRLFSNEPADSEGS |
| Ga0182035_116407341 | 3300016341 | Soil | FAPTEAGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDRESE |
| Ga0182037_115181052 | 3300016404 | Soil | SESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNVPGDSDGT |
| Ga0187803_104316402 | 3300017934 | Freshwater Sediment | FQKKYFDAIQKDPAVVMEHADLARLFHNEPVDPENE |
| Ga0187778_104687231 | 3300017961 | Tropical Peatland | GDGFQKQYFDAIQRDPAVVMEHAELARLFNNEPPDQ |
| Ga0187776_106441632 | 3300017966 | Tropical Peatland | ETGDGFQKKYFDAIQKDPAVVMEHAELARLFHNEPVDHEGE |
| Ga0187782_114817121 | 3300017975 | Tropical Peatland | DAFQKRYFAAIQRDPAVVMEHAELARLFSNEPPETSGT |
| Ga0066662_114373961 | 3300018468 | Grasslands Soil | TESGDTFQKKYFVAIQRDPAVVIEHAELARLFNNEPPDSATP |
| Ga0182028_14081591 | 3300019788 | Fen | TGDGFQKKYFDAIQKDPAVVMEHAELVRLFHIEPPGAENQ |
| Ga0179592_100801381 | 3300020199 | Vadose Zone Soil | AFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAM |
| Ga0210407_105378092 | 3300020579 | Soil | AFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT |
| Ga0210403_101331723 | 3300020580 | Soil | VPTRSGEAFQKKYFDAIQNDPAVVIDHAELARLFNNEPPDSSNP |
| Ga0210403_102149871 | 3300020580 | Soil | GFQKQYFDAIQRDPAVVMEHAELVRLFNNEPSDPEG |
| Ga0210403_103144101 | 3300020580 | Soil | FQKQYFDAIQRDPAVVMEHAELVRLFNTEPPDAEG |
| Ga0210403_111150881 | 3300020580 | Soil | PTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSATP |
| Ga0210395_100362674 | 3300020582 | Soil | FTPNESGDSFQKKYYGAIHGDPTVVMDHAELARLFNSEPSDAGAAQ |
| Ga0210405_102956262 | 3300021171 | Soil | DAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDVNPT |
| Ga0210388_117697842 | 3300021181 | Soil | APSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDVNPT |
| Ga0210385_104371462 | 3300021402 | Soil | EAGDAFQKRYFDAIQRDPAVVMVHAELARIFANEPGEAAGT |
| Ga0210397_101902872 | 3300021403 | Soil | PSESGDAFQKRYFDAIQREPAVVMVHADLAKIFANEPGEQTAG |
| Ga0210397_110118582 | 3300021403 | Soil | GDGFQKRYFDAIQRDPAVVMEHAELARLFANEPADPAPS |
| Ga0210389_104333381 | 3300021404 | Soil | DGFQKKYFEAIHKDPAVVMEHAELARMFLTEPVDGEG |
| Ga0210387_100965801 | 3300021405 | Soil | DGFQKRYFDAIQRDPAVVMEHAELARLFANEPADPAPS |
| Ga0210394_113114932 | 3300021420 | Soil | ESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT |
| Ga0210410_103402003 | 3300021479 | Soil | FAPTETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPSDPEG |
| Ga0210409_102401371 | 3300021559 | Soil | TESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTSAP |
| Ga0210409_106440501 | 3300021559 | Soil | TDSGDGFQKKYFAAIQRDPAVVIDHAELARLFNIEPPDSPTP |
| Ga0210409_110722353 | 3300021559 | Soil | SGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSAP |
| Ga0210409_117101321 | 3300021559 | Soil | PTETGDGFQKKYFEAIHKDPAVVMEHAELARMFLTEPVDGEG |
| Ga0126371_125572871 | 3300021560 | Tropical Forest Soil | DGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDFDGT |
| Ga0212123_102932321 | 3300022557 | Iron-Sulfur Acid Spring | VPSKSGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEPDVRG |
| Ga0242657_10336363 | 3300022722 | Soil | MFAPSESGDAFQKKYYDAIQLDPAVVIDHAELARLFNNEPPDVSST |
| Ga0247688_10090741 | 3300024186 | Soil | SEMGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEA |
| Ga0247688_10143872 | 3300024186 | Soil | SEEGDAFQKRYFTAIQRDPSVVMEHAELARLFANEPADSTP |
| Ga0207685_101280061 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | FQKRYFDAIQRDPTVVMEHAELAKLFANEPSDTGTM |
| Ga0207699_102562253 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEA |
| Ga0207671_103761382 | 3300025914 | Corn Rhizosphere | FQKRYFDAIQRDPAVVMVHADLAKVFANEPGEQAAS |
| Ga0207663_101091571 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GDSFQKRYYDAIQRDPTVVMEHAELARLFGSEPREAENQ |
| Ga0207663_111722001 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AIQKRYFDAIQRDPAVVMEHAELARLFNSEPEVRG |
| Ga0207686_115843982 | 3300025934 | Miscanthus Rhizosphere | KMFAPSDVGDAFQKRYYDAIQRDPTVVMEHAELARLFLNEPLDSPP |
| Ga0207665_101582573 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SGDSFQKRYYDAIQRDPTVVMEHAELARLFGSEPREAENQ |
| Ga0209158_12296883 | 3300026333 | Soil | AFQKKYFDAIQRDPAVVIDHAELARLFNNEPLDSSTP |
| Ga0207745_10214312 | 3300026889 | Tropical Forest Soil | APSESGDGFQKKYFDAIQRDPSVVMEHAELVRLFSNEPADSEGT |
| Ga0207803_10167512 | 3300027000 | Tropical Forest Soil | QKKYFDAIQNDPAVVMEHAELVRLFNNEPGDREAE |
| Ga0207726_10342783 | 3300027045 | Tropical Forest Soil | GDGFQKKYFDAIQRDPSVVMEHAELVRLFSNEPADSEGT |
| Ga0209332_10981902 | 3300027439 | Forest Soil | SESGDAFQKRYFHAIQRDPTVVMEHAELAKLFANEPPDAGTM |
| Ga0208984_10494531 | 3300027546 | Forest Soil | DAFQKRYFDAIQRDPAVVMEHAELARLFNSEPVEPSAT |
| Ga0209217_10406153 | 3300027651 | Forest Soil | SGDGFQKKYYHAIQKDPAVVMEHAELARLFQQEPSEAEKD |
| Ga0209588_11185121 | 3300027671 | Vadose Zone Soil | FVPTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSTP |
| Ga0209118_10098715 | 3300027674 | Forest Soil | FQKKYFDAIQRDPAVVIEHAELARLFNNEPLDSSIP |
| Ga0209060_102593042 | 3300027826 | Surface Soil | TGDGFQKKYYDAIQADPTVVMQHAELAKMFLNERADT |
| Ga0209580_105853612 | 3300027842 | Surface Soil | DAFQKRYFDAIQRDPTVVMEHAELAKLFANEPPDTGTM |
| Ga0209180_100758925 | 3300027846 | Vadose Zone Soil | FQKKYFDAIQRDPAVVIDHAELARLFNNEPPDSSTP |
| Ga0209180_103492722 | 3300027846 | Vadose Zone Soil | SGDSFQKKYFDAIQLDPAVVMEHAELARLFANEPSEKDNR |
| Ga0209701_100215721 | 3300027862 | Vadose Zone Soil | FQKKYFEAIQLDPAVVIEHAELARLFNNEPPDSASP |
| Ga0209283_100802621 | 3300027875 | Vadose Zone Soil | FAPSESGDAFQKRYFDAIQRDPTVVMEHAELAKLFANEPSDAGTM |
| Ga0209590_102464301 | 3300027882 | Vadose Zone Soil | SGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPLDSSTP |
| Ga0209275_101155673 | 3300027884 | Soil | PSESGDAFQKKYYDAIQLDPAVVIDHAELARLFNNEPPDVSSQ |
| Ga0209624_110956342 | 3300027895 | Forest Soil | SGDAFQKRYFDAIQRDPAVVMEHAELARLFNSEPAEPSAT |
| Ga0209488_103859614 | 3300027903 | Vadose Zone Soil | VPTESGDAFQKKYFDAIQRDPAVVIDHAELARLFNNEPPDTAAP |
| Ga0209006_101701631 | 3300027908 | Forest Soil | APAETGDGFQKQYFYAIQRDPAVVMEHAELVRLFNNEPPDAEG |
| Ga0265354_10064091 | 3300028016 | Rhizosphere | PSESGDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP |
| Ga0137415_100233341 | 3300028536 | Vadose Zone Soil | MFAPSEFGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAM |
| Ga0302231_104322623 | 3300028775 | Palsa | AFQKKYFDAIQRDPAVVMDHAEMARLFNSEPGDSTTA |
| Ga0302303_100267355 | 3300028776 | Palsa | TESGDAFQKKYFDAIQRDPAVVMDHAEMARLFNSEPGDSTTA |
| Ga0310038_102329302 | 3300030707 | Peatlands Soil | TETGDGFQKKYFDAIQKDPAVVMEHAELVRLFHNEPLDAENQ |
| Ga0265745_10070272 | 3300030759 | Soil | FQKKYFDAIQLDPAVVIDHAELARLFNNEPPDVSSP |
| Ga0265750_10095953 | 3300030813 | Soil | GDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP |
| Ga0265765_10231591 | 3300030879 | Soil | SESGDAFQKKYFDAIQMDPAVVIDHAELARLFNNEPPDVSSP |
| Ga0075373_102071842 | 3300030945 | Soil | TGDGFQKQYFHAIQRDPAVVMEHAELVRLFNNEPPDAEG |
| Ga0073994_100528541 | 3300030991 | Soil | FAPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASPT |
| Ga0073994_116543021 | 3300030991 | Soil | QKRYFDAIQRDPTVVMEHAELAKLFANEPSDTGTM |
| Ga0170834_1016575602 | 3300031057 | Forest Soil | FAPTETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEV |
| Ga0265760_100647901 | 3300031090 | Soil | PTESGDSFQKRYYDAIQRDPAVVMEHAELARLFGNEPKDAENQ |
| Ga0170818_1017311431 | 3300031474 | Forest Soil | SGDSFQKRYYDAIQKDPTVVMEHAELARLFGSEPREAENQ |
| Ga0318528_103142541 | 3300031561 | Soil | SESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT |
| Ga0318572_104761191 | 3300031681 | Soil | QKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT |
| Ga0307474_104604901 | 3300031718 | Hardwood Forest Soil | FQKRYFDAIQRDPAVVIEHAELAKIFANEPGEQAAS |
| Ga0307477_110833132 | 3300031753 | Hardwood Forest Soil | QKKYFDAIQRDPAVVIDHAELARLFNNEPPDSPVP |
| Ga0307475_101564893 | 3300031754 | Hardwood Forest Soil | FQKRYFDAIQRDPAVVMEHAELARLFANEPSDVSPT |
| Ga0307473_108336133 | 3300031820 | Hardwood Forest Soil | SGDNFQKKYFDAIQNDPAVVIEHVELAKLFNNEPPDSSAA |
| Ga0307473_108963761 | 3300031820 | Hardwood Forest Soil | MFVPAESGDSFQKQYFDAIQKEPAVVMEHAELARLFNAEPPEPAAP |
| Ga0307478_111263872 | 3300031823 | Hardwood Forest Soil | QKRYFDAIQRDPTVVMEHAELARLFANEPSDPGPA |
| Ga0306925_103759151 | 3300031890 | Soil | ESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT |
| Ga0310912_103434991 | 3300031941 | Soil | PSESGDGFQKKYFDAIQRDPSVVMEHAALVRLFSNAPGDSDGT |
| Ga0310916_109768901 | 3300031942 | Soil | DGFQKKYFDAIQKDPAVVMEHAQLARLFNTEPADREPG |
| Ga0307479_106061222 | 3300031962 | Hardwood Forest Soil | APSETGDGFQKQYFDAIQRDPAVVMEHAELVRLFNNEPPDAEG |
| Ga0307479_107873094 | 3300031962 | Hardwood Forest Soil | FQKNYFAAIQRDPAVVIDHAELVRLFNNEPPDSSIP |
| Ga0307479_118418222 | 3300031962 | Hardwood Forest Soil | FAPSESGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDTSAT |
| Ga0318531_105581852 | 3300031981 | Soil | GFQKKYFDAIQKDPAVVMEHAQLARLFNTEPADREPG |
| Ga0310911_104632551 | 3300032035 | Soil | GFQKKYFDAIQRDPTVVMEHAGLVRLFLTEPGDGEK |
| Ga0318506_103036472 | 3300032052 | Soil | PSERGDGFQKKYFDAIQRDPAVVMEHAELARLFQSEPQEREGE |
| Ga0307470_115477832 | 3300032174 | Hardwood Forest Soil | SGDAFQKRYFDAIQRDPAVVMEHAELARLFANEPSDASAT |
| Ga0307471_1015592052 | 3300032180 | Hardwood Forest Soil | TETGDGFQKQYFHAIQRDPAVVMEHAELVRLFNNEPPDAEG |
| Ga0307472_1013022252 | 3300032205 | Hardwood Forest Soil | ESGDGFQKKYYDAIQTDPSVVMEHAELVRIFNTEAGEPEDA |
| Ga0335079_102680901 | 3300032783 | Soil | IFAPTESGDGFQKKYFDAIQRDPAVVMEHAELARIFNNEPVDCESD |
| Ga0335078_110890591 | 3300032805 | Soil | FQKKYFDAIQKDPAVVMEHAQLARMFNNEPPDRENS |
| ⦗Top⦘ |