| Basic Information | |
|---|---|
| Family ID | F042508 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 38 residues |
| Representative Sequence | SAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 89.24 % |
| % of genes from short scaffolds (< 2000 bps) | 86.71 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.861 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.646 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.582 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.633 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF13560 | HTH_31 | 51.90 |
| PF01381 | HTH_3 | 6.96 |
| PF00156 | Pribosyltran | 6.33 |
| PF01152 | Bac_globin | 0.63 |
| PF02811 | PHP | 0.63 |
| PF01979 | Amidohydro_1 | 0.63 |
| PF01797 | Y1_Tnp | 0.63 |
| PF12890 | DHOase | 0.63 |
| PF00528 | BPD_transp_1 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.63 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.86 % |
| All Organisms | root | All Organisms | 41.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459022|GZEQPF101D2LJD | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 502 | Open in IMG/M |
| 3300000156|NODE_c0641161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 2106 | Open in IMG/M |
| 3300001867|JGI12627J18819_10084081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1320 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100539159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1044 | Open in IMG/M |
| 3300004156|Ga0062589_101533343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300004607|Ga0068948_1291063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300005332|Ga0066388_108452347 | Not Available | 513 | Open in IMG/M |
| 3300005347|Ga0070668_101612033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300005457|Ga0070662_100850155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 777 | Open in IMG/M |
| 3300005556|Ga0066707_10642346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 672 | Open in IMG/M |
| 3300005614|Ga0068856_100662408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1064 | Open in IMG/M |
| 3300005713|Ga0066905_100169675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1596 | Open in IMG/M |
| 3300005764|Ga0066903_102492244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1001 | Open in IMG/M |
| 3300005764|Ga0066903_106715772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 598 | Open in IMG/M |
| 3300006028|Ga0070717_11665303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300006059|Ga0075017_100515162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 908 | Open in IMG/M |
| 3300006175|Ga0070712_100054037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2806 | Open in IMG/M |
| 3300006573|Ga0074055_10011906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 946 | Open in IMG/M |
| 3300006576|Ga0074047_10001069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
| 3300006579|Ga0074054_12118186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 920 | Open in IMG/M |
| 3300006581|Ga0074048_13279903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300006605|Ga0074057_12322068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1297 | Open in IMG/M |
| 3300006804|Ga0079221_11806280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300006806|Ga0079220_11427103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300006852|Ga0075433_10435666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1156 | Open in IMG/M |
| 3300006953|Ga0074063_10030113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1363 | Open in IMG/M |
| 3300009162|Ga0075423_12549845 | Not Available | 558 | Open in IMG/M |
| 3300009162|Ga0075423_13060359 | Not Available | 512 | Open in IMG/M |
| 3300009524|Ga0116225_1128909 | Not Available | 1161 | Open in IMG/M |
| 3300009665|Ga0116135_1106865 | Not Available | 1017 | Open in IMG/M |
| 3300009672|Ga0116215_1082370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1446 | Open in IMG/M |
| 3300009792|Ga0126374_11097904 | Not Available | 631 | Open in IMG/M |
| 3300010110|Ga0126316_1042685 | Not Available | 663 | Open in IMG/M |
| 3300010125|Ga0127443_1121329 | Not Available | 648 | Open in IMG/M |
| 3300010140|Ga0127456_1182938 | Not Available | 621 | Open in IMG/M |
| 3300010154|Ga0127503_10386412 | Not Available | 791 | Open in IMG/M |
| 3300010360|Ga0126372_11580089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300010361|Ga0126378_11812231 | Not Available | 694 | Open in IMG/M |
| 3300010361|Ga0126378_13192366 | Not Available | 521 | Open in IMG/M |
| 3300010366|Ga0126379_10348881 | Not Available | 1509 | Open in IMG/M |
| 3300010371|Ga0134125_12064549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 620 | Open in IMG/M |
| 3300010376|Ga0126381_101512007 | Not Available | 970 | Open in IMG/M |
| 3300010396|Ga0134126_10661204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1190 | Open in IMG/M |
| 3300010876|Ga0126361_10311583 | Not Available | 1044 | Open in IMG/M |
| 3300011332|Ga0126317_11086467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300012207|Ga0137381_11237463 | Not Available | 640 | Open in IMG/M |
| 3300012211|Ga0137377_10917866 | Not Available | 807 | Open in IMG/M |
| 3300012361|Ga0137360_11823808 | Not Available | 514 | Open in IMG/M |
| 3300012948|Ga0126375_11319880 | Not Available | 607 | Open in IMG/M |
| 3300014325|Ga0163163_12391779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300014495|Ga0182015_10143958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1624 | Open in IMG/M |
| 3300014501|Ga0182024_11871994 | Not Available | 668 | Open in IMG/M |
| 3300015371|Ga0132258_11969122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1470 | Open in IMG/M |
| 3300016387|Ga0182040_11255039 | Not Available | 624 | Open in IMG/M |
| 3300016387|Ga0182040_11729956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 534 | Open in IMG/M |
| 3300016445|Ga0182038_12035712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 520 | Open in IMG/M |
| 3300017928|Ga0187806_1229525 | Not Available | 637 | Open in IMG/M |
| 3300017959|Ga0187779_10186731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1292 | Open in IMG/M |
| 3300017970|Ga0187783_10177517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1567 | Open in IMG/M |
| 3300017974|Ga0187777_10296182 | Not Available | 1105 | Open in IMG/M |
| 3300017974|Ga0187777_10852595 | Not Available | 653 | Open in IMG/M |
| 3300017975|Ga0187782_10051300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 3004 | Open in IMG/M |
| 3300018060|Ga0187765_10443732 | Not Available | 810 | Open in IMG/M |
| 3300019887|Ga0193729_1283279 | Not Available | 502 | Open in IMG/M |
| 3300019890|Ga0193728_1277897 | Not Available | 652 | Open in IMG/M |
| 3300020076|Ga0206355_1460818 | Not Available | 760 | Open in IMG/M |
| 3300020082|Ga0206353_11373965 | Not Available | 862 | Open in IMG/M |
| 3300020581|Ga0210399_10403315 | Not Available | 1140 | Open in IMG/M |
| 3300021307|Ga0179585_1053410 | Not Available | 505 | Open in IMG/M |
| 3300021405|Ga0210387_11279635 | Not Available | 634 | Open in IMG/M |
| 3300021407|Ga0210383_10347359 | Not Available | 1278 | Open in IMG/M |
| 3300021407|Ga0210383_11550779 | Not Available | 546 | Open in IMG/M |
| 3300021476|Ga0187846_10270321 | Not Available | 705 | Open in IMG/M |
| 3300021560|Ga0126371_12821154 | Not Available | 589 | Open in IMG/M |
| 3300021560|Ga0126371_13055467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 566 | Open in IMG/M |
| 3300021860|Ga0213851_1096447 | Not Available | 609 | Open in IMG/M |
| 3300022467|Ga0224712_10486767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 595 | Open in IMG/M |
| 3300022504|Ga0242642_1066854 | Not Available | 585 | Open in IMG/M |
| 3300022523|Ga0242663_1026536 | Not Available | 909 | Open in IMG/M |
| 3300022530|Ga0242658_1104138 | Not Available | 684 | Open in IMG/M |
| 3300022531|Ga0242660_1083007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 758 | Open in IMG/M |
| 3300022718|Ga0242675_1054126 | Not Available | 680 | Open in IMG/M |
| 3300022718|Ga0242675_1054760 | Not Available | 677 | Open in IMG/M |
| 3300022722|Ga0242657_1052594 | Not Available | 898 | Open in IMG/M |
| 3300026035|Ga0207703_12135700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300026864|Ga0209621_1010336 | Not Available | 643 | Open in IMG/M |
| 3300026911|Ga0209620_1001458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1662 | Open in IMG/M |
| 3300027037|Ga0209005_1010480 | Not Available | 1071 | Open in IMG/M |
| 3300027073|Ga0208366_1026983 | Not Available | 638 | Open in IMG/M |
| 3300027504|Ga0209114_1045677 | Not Available | 763 | Open in IMG/M |
| 3300027528|Ga0208985_1002279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3302 | Open in IMG/M |
| 3300027609|Ga0209221_1028432 | Not Available | 1489 | Open in IMG/M |
| 3300027725|Ga0209178_1009383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3063 | Open in IMG/M |
| 3300027895|Ga0209624_10215059 | Not Available | 1277 | Open in IMG/M |
| 3300027903|Ga0209488_10333484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1129 | Open in IMG/M |
| 3300028742|Ga0302220_10127714 | Not Available | 981 | Open in IMG/M |
| 3300029920|Ga0302142_1010440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3064 | Open in IMG/M |
| 3300030007|Ga0311338_10093485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus albus | 3767 | Open in IMG/M |
| 3300030531|Ga0210274_1387910 | Not Available | 534 | Open in IMG/M |
| 3300030602|Ga0210254_10582249 | Not Available | 653 | Open in IMG/M |
| 3300030624|Ga0210251_10874130 | Not Available | 502 | Open in IMG/M |
| 3300030626|Ga0210291_11042158 | Not Available | 806 | Open in IMG/M |
| 3300030718|Ga0307919_1029989 | Not Available | 745 | Open in IMG/M |
| 3300030738|Ga0265462_12363506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 527 | Open in IMG/M |
| 3300030934|Ga0075391_11193768 | Not Available | 624 | Open in IMG/M |
| 3300030963|Ga0265768_107431 | Not Available | 667 | Open in IMG/M |
| 3300030967|Ga0075399_11230622 | Not Available | 542 | Open in IMG/M |
| 3300030982|Ga0265748_104378 | Not Available | 652 | Open in IMG/M |
| 3300031057|Ga0170834_108887297 | Not Available | 534 | Open in IMG/M |
| 3300031058|Ga0308189_10117601 | Not Available | 868 | Open in IMG/M |
| 3300031089|Ga0102748_11671890 | Not Available | 538 | Open in IMG/M |
| 3300031546|Ga0318538_10148043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1239 | Open in IMG/M |
| 3300031572|Ga0318515_10458523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 681 | Open in IMG/M |
| 3300031640|Ga0318555_10296699 | Not Available | 874 | Open in IMG/M |
| 3300031668|Ga0318542_10760547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300031719|Ga0306917_11021148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 645 | Open in IMG/M |
| 3300031723|Ga0318493_10073697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 1669 | Open in IMG/M |
| 3300031736|Ga0318501_10048669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 1971 | Open in IMG/M |
| 3300031736|Ga0318501_10508864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 657 | Open in IMG/M |
| 3300031748|Ga0318492_10166622 | Not Available | 1117 | Open in IMG/M |
| 3300031765|Ga0318554_10220011 | Not Available | 1081 | Open in IMG/M |
| 3300031771|Ga0318546_10762538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 681 | Open in IMG/M |
| 3300031779|Ga0318566_10060423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1816 | Open in IMG/M |
| 3300031821|Ga0318567_10392049 | Not Available | 786 | Open in IMG/M |
| 3300031823|Ga0307478_11564776 | Not Available | 545 | Open in IMG/M |
| 3300031869|Ga0316030_104876 | Not Available | 718 | Open in IMG/M |
| 3300031896|Ga0318551_10632136 | Not Available | 618 | Open in IMG/M |
| 3300031897|Ga0318520_10844167 | Not Available | 575 | Open in IMG/M |
| 3300031910|Ga0306923_11175809 | Not Available | 821 | Open in IMG/M |
| 3300032008|Ga0318562_10521311 | Not Available | 688 | Open in IMG/M |
| 3300032010|Ga0318569_10338749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 700 | Open in IMG/M |
| 3300032025|Ga0318507_10164854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 951 | Open in IMG/M |
| 3300032043|Ga0318556_10769197 | Not Available | 501 | Open in IMG/M |
| 3300032044|Ga0318558_10122170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1235 | Open in IMG/M |
| 3300032065|Ga0318513_10552162 | Not Available | 564 | Open in IMG/M |
| 3300032067|Ga0318524_10167404 | Not Available | 1116 | Open in IMG/M |
| 3300032068|Ga0318553_10496458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 640 | Open in IMG/M |
| 3300032068|Ga0318553_10528431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 618 | Open in IMG/M |
| 3300032076|Ga0306924_10548482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1312 | Open in IMG/M |
| 3300032515|Ga0348332_11726374 | Not Available | 742 | Open in IMG/M |
| 3300032805|Ga0335078_10141342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3418 | Open in IMG/M |
| 3300033134|Ga0335073_10754764 | Not Available | 1053 | Open in IMG/M |
| 3300033289|Ga0310914_11697359 | Not Available | 535 | Open in IMG/M |
| 3300033290|Ga0318519_10224055 | Not Available | 1080 | Open in IMG/M |
| 3300033475|Ga0310811_10634757 | Not Available | 1059 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.53% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.27% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.63% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.63% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.63% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.63% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.63% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.63% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.63% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004607 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026864 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030531 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030623 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030718 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030934 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030982 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031089 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031869 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA2_00818040 | 2170459022 | Grass Soil | RAASAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| NODE_06411613 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | RAASAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| JGI12627J18819_100840811 | 3300001867 | Forest Soil | RAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| JGIcombinedJ26739_1005391593 | 3300002245 | Forest Soil | READELLRDAETFLSLVESALQVPGQSVLPLRTAG* |
| Ga0062589_1015333432 | 3300004156 | Soil | GLPRAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0068948_12910632 | 3300004607 | Peatlands Soil | AASAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0066388_1084523472 | 3300005332 | Tropical Forest Soil | RAVSGAEADDLLRDAETFLSLVEEALGVAVQPVLPLRSVG* |
| Ga0070668_1016120331 | 3300005347 | Switchgrass Rhizosphere | LPRAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0070662_1008501552 | 3300005457 | Corn Rhizosphere | LPRAVSGREADDLLRDAETFLSLAEEALGVPAQPVLPLRCTG* |
| Ga0066707_106423461 | 3300005556 | Soil | READDLLRDAETFLSLAEEALGVAAQAALPLRSTG* |
| Ga0068856_1006624081 | 3300005614 | Corn Rhizosphere | ADDLLRDAETFVSLAESTLGVPSGQTLLPLRTAG* |
| Ga0066905_1001696751 | 3300005713 | Tropical Forest Soil | SGREADDLLRDAETFLSLAEEALGVAAQAALPLRSTG* |
| Ga0066903_1024922441 | 3300005764 | Tropical Forest Soil | RAVSGAEADDLLRDAETFLSLVEETLGVSVQPVLPLRSAG* |
| Ga0066903_1067157722 | 3300005764 | Tropical Forest Soil | VSGREADDLLRDAETFLSLAEEALGVAAQAALPLRSTG* |
| Ga0070717_116653031 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EADDLLRDAETFLSLAETALGVEVPSPLPLRPAG* |
| Ga0075017_1005151622 | 3300006059 | Watersheds | GLARAVSGTEADDLLRDAETFLSLVEEALGVAIQPVLPLRSAG* |
| Ga0070716_1007531082 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AASAREADDLLRDAATFLSVAEQALGLDSEPMLPLPLRPAS* |
| Ga0070712_1000540375 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SGAEADDLLRDAETFLSLVEDALGVAVQPVLPLRSAG* |
| Ga0070765_1005532582 | 3300006176 | Soil | EAEDLLRDAGTFLSVAERALGVDSQPMLPLRPAS* |
| Ga0074055_100119062 | 3300006573 | Soil | ARAASAREADDLLRDAETFLSLAETALGVEAQSPLPLRPAG* |
| Ga0074047_100010691 | 3300006576 | Soil | AREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0074054_121181862 | 3300006579 | Soil | RAASAREADDLLRDAETFLSLAETALGVEAQSPLPLRPAG* |
| Ga0074048_132799031 | 3300006581 | Soil | WREADDLLRDAETFLSLAEEALGVNAQAPLPLRSTG* |
| Ga0074057_123220683 | 3300006605 | Soil | SAREADDLLRDAETFLSLAETALGVEAQSPLPLRPAG* |
| Ga0079221_118062802 | 3300006804 | Agricultural Soil | SVSASEAEDLLRGAETFLSLAESVLGVQSSPLLPLRTAG* |
| Ga0079220_114271032 | 3300006806 | Agricultural Soil | PRAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0075433_104356662 | 3300006852 | Populus Rhizosphere | GLARAVSAAEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG* |
| Ga0074063_100301131 | 3300006953 | Soil | AREADDLLRDAETFLSLAETALGVEAQSPLPLRPAG* |
| Ga0075423_125498452 | 3300009162 | Populus Rhizosphere | EADDLLRDAGTFVALAETALGVPAQSPLPLPTAI* |
| Ga0075423_130603591 | 3300009162 | Populus Rhizosphere | MALLSPRAVSGREADELLRAAETFLSLAEEALGVAAQAALPLRSTG* |
| Ga0116225_11289092 | 3300009524 | Peatlands Soil | READDLLRDAETFLSLAEEALGLPAQEALPLRPAG* |
| Ga0116135_11068651 | 3300009665 | Peatland | READDLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0116215_10823703 | 3300009672 | Peatlands Soil | PRAVSAREADDLLRDAETFLSLAEEALGLPAQEALPLRPAG* |
| Ga0126374_110979042 | 3300009792 | Tropical Forest Soil | RAVSGREADDLLRDAETFLSLAEEALGVAAQPALPLRSTG* |
| Ga0126316_10426851 | 3300010110 | Soil | HTASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0127443_11213292 | 3300010125 | Grasslands Soil | SAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0127456_11829382 | 3300010140 | Grasslands Soil | ASAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG* |
| Ga0127503_103864121 | 3300010154 | Soil | RAVSGREADDLLRDAETFLSLAEEALGVAAQAALPLRSTG* |
| Ga0126372_115800892 | 3300010360 | Tropical Forest Soil | VSGAEADDLLRDAETFLSLVEEALGVTVQPVLPLRSVG* |
| Ga0126378_118122312 | 3300010361 | Tropical Forest Soil | READELLRDAATFVSLAESALGVPVQAALPLPEAM* |
| Ga0126378_131923662 | 3300010361 | Tropical Forest Soil | GLARAVSGAEADDLLRDAETFLSLVEEALGVTVQPVLPLRSVG* |
| Ga0126379_103488811 | 3300010366 | Tropical Forest Soil | KAVSAHEADDLLRDAETFLSLAEETLGVTAQPLLPLRSVG* |
| Ga0134125_120645491 | 3300010371 | Terrestrial Soil | EADDLLRDAETFVSLAESTLGVPSGQTLLPLRSAG* |
| Ga0126381_1001124995 | 3300010376 | Tropical Forest Soil | AASAREAEDLIRDAETFLRVVEHALGLDGQPQLPLRPAS* |
| Ga0126381_1015120071 | 3300010376 | Tropical Forest Soil | SEAEDLLRDAETFLSLAESVLGVPSSPLLPLRTAG* |
| Ga0134126_106612042 | 3300010396 | Terrestrial Soil | AVSAREADDLLRDAETFLSLAEEALGLPAQSALPLRPAG* |
| Ga0126361_103115832 | 3300010876 | Boreal Forest Soil | AEADDLLRDAETFLSLVEDALGVAVQPVLPLRSAG* |
| Ga0126317_110864671 | 3300011332 | Soil | READDLLRDAETFLNLAEEALGLPGQPALPLRPAG* |
| Ga0137381_112374632 | 3300012207 | Vadose Zone Soil | VSAREADELLRDAATFVSLAESALGVPAQSPLPLPAAI* |
| Ga0137377_109178662 | 3300012211 | Vadose Zone Soil | EADDLLRDAETFLSLVEDALGVAVQPVLPLRSAG* |
| Ga0137360_118238081 | 3300012361 | Vadose Zone Soil | READDLLRDAETFLSLAESTLGVPGQPLLPLRTAG* |
| Ga0126375_113198801 | 3300012948 | Tropical Forest Soil | VSGREADELLRDAATFVSLAESALGVSAQSSLPLPAAI* |
| Ga0163163_123917791 | 3300014325 | Switchgrass Rhizosphere | RAVSAREADDLLRDAETFLSLAEEALGLPAQSALPLRPAG* |
| Ga0182015_101439583 | 3300014495 | Palsa | SKQEADELLRDASTFLTVAERALGVESEPMLPLRSAS* |
| Ga0182024_118719942 | 3300014501 | Permafrost | SAREADDLLRDAETFLNLAEEALGLPGQSALPLRPAS* |
| Ga0132258_119691221 | 3300015371 | Arabidopsis Rhizosphere | READELLRDAETFLSLAEEALGVAAQAALPLRSTG* |
| Ga0182040_112550391 | 3300016387 | Soil | ATAREAEDLLRDAETFLAVAERALGVDGQPMLPLRPAS |
| Ga0182040_117299562 | 3300016387 | Soil | LPKAVTAHEADDLLRDAETFLSLAEEALGVTAQPLLPLRSVG |
| Ga0182038_120357122 | 3300016445 | Soil | AEADDLLRDAETFLSLVEDALGVTVQPVLPLRSVG |
| Ga0187806_12295252 | 3300017928 | Freshwater Sediment | ASAHEADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0187779_101867313 | 3300017959 | Tropical Peatland | AASAREADNLLRDAETFLSLAETVLGVEVQSPLPLRPAG |
| Ga0187783_101775171 | 3300017970 | Tropical Peatland | SLREADDLLRDAEMFVSLAENALGVPAQPLLPMLTAG |
| Ga0187777_102961822 | 3300017974 | Tropical Peatland | VTAREADDLLRDAATFLSLAEEALGLPSQSPLPLRPAG |
| Ga0187777_108525952 | 3300017974 | Tropical Peatland | SMREADDLLRDAETFLSLAEEALGVVAQPVLPLRSTG |
| Ga0187782_100513005 | 3300017975 | Tropical Peatland | READDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0187765_104437321 | 3300018060 | Tropical Peatland | LPRAVSGREADDLLRDAETFLSLAEEALGVAAQAALPLRSTG |
| Ga0193729_12832792 | 3300019887 | Soil | AHEADDLLRDAGTFVGLAESALGIPAQEVLPLASAG |
| Ga0193728_12778972 | 3300019890 | Soil | ASAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0206355_14608182 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | TTREADELLRDAATFVSLAESALGVPAQSLLPLPVAM |
| Ga0206353_113739652 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | GHEADDLLRDAETFVSLAESTLGVPSGQTLLPLRTAG |
| Ga0210399_104033152 | 3300020581 | Soil | RAVTAREADDLLRDAGTFLSLAEEALGLPSQSLLPLRPAG |
| Ga0179585_10534101 | 3300021307 | Vadose Zone Soil | ASAREADDLLRDAETFLSLAETALGVEMQSPLPLRPAG |
| Ga0210387_112796352 | 3300021405 | Soil | QEADDLLRDAATFLTVAERALGVETEPVLPLRSVS |
| Ga0210383_103473591 | 3300021407 | Soil | LARAVSGAEADDLLRDAETFLSLVEEALGVTVQPVLPLRSAG |
| Ga0210383_115507792 | 3300021407 | Soil | AREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0187846_102703211 | 3300021476 | Biofilm | SAREAEDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0210398_106738421 | 3300021477 | Soil | ATAREAEDLLRDAGTFLSVAERALGVDSQPMLPLRPAS |
| Ga0126371_128211542 | 3300021560 | Tropical Forest Soil | AGLSRAVSGAEADDLLRDAETFLSLVEETLGVSVQPVLPLRSAG |
| Ga0126371_130554671 | 3300021560 | Tropical Forest Soil | RAVSGREADDLLRDAETFLSLAEEALGVGAQPPLPLRSTG |
| Ga0213851_10964472 | 3300021860 | Watersheds | RAASAREADDLLRDAETFLSLAETALGVEVQAPLPLRPAG |
| Ga0224712_104867671 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | EADDLLRDAETFVSLAESTLGVPSGQTLLPLRSAG |
| Ga0242642_10668542 | 3300022504 | Soil | AASAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0242663_10265361 | 3300022523 | Soil | PRAASPQEADDLLRDAATFLTVAERALGVETEPVLPLRSVS |
| Ga0242658_10484121 | 3300022530 | Soil | SPQEADDLLRDAATFLTVAERALGVETEPVLLPLRSVS |
| Ga0242658_11041381 | 3300022530 | Soil | PQEADDLLRDAATFLTVAERALGVESEPVLPLRSAS |
| Ga0242660_10830071 | 3300022531 | Soil | GLPRAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0242675_10265762 | 3300022718 | Soil | AATAREAEDLLRDAGTFLSVAERALGVDSQPMLPLRPAS |
| Ga0242675_10541261 | 3300022718 | Soil | AREADDLLRDAETFLTLAETALGVEAQSPLPLRPAG |
| Ga0242675_10547602 | 3300022718 | Soil | MQKPRAASARAADNLVRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0242657_10525942 | 3300022722 | Soil | AASPQEADDLLRDAATFLTVAERALGVETEPVLPLRSVS |
| Ga0207703_121357002 | 3300026035 | Switchgrass Rhizosphere | LSSAVTAREADDLLRDAGTFLALVEATLGVPHQSTFPLVG |
| Ga0209621_10103361 | 3300026864 | Forest Soil | RAASAREADNLVRDAETFLSLAETALGVEMQSPLPLRPAG |
| Ga0209620_10014581 | 3300026911 | Forest Soil | PRAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0209005_10104802 | 3300027037 | Forest Soil | GLSRAATAHEADDLLRDAEIFLSVVETALGVDQTPLPLRPAG |
| Ga0208366_10269831 | 3300027073 | Forest Soil | SAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0209114_10456771 | 3300027504 | Forest Soil | ASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0208985_10022795 | 3300027528 | Forest Soil | LSRAATAHDADDLLRDAEIFLSVVETALGVDQTPLPLRPAG |
| Ga0209221_10284321 | 3300027609 | Forest Soil | AATAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0209178_10093831 | 3300027725 | Agricultural Soil | LPRAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0209624_102150593 | 3300027895 | Forest Soil | SPQEADDLLRDAATFLTVAERALGVETEPVLPLRSVS |
| Ga0209488_103334842 | 3300027903 | Vadose Zone Soil | ARAVSAAEADDLLRDAETFLSLAEEALGVTVQPVLPLRSAG |
| Ga0302220_101277141 | 3300028742 | Palsa | ASPQEADDLLRDASTFLTVAERALGVESEPVLPLRSAS |
| Ga0302142_10104401 | 3300029920 | Bog | READDLLRDAEIFLSVVETALGVPSESPLPLRTAG |
| Ga0311338_100934851 | 3300030007 | Palsa | AWEADDLLRDAEIFLSVVETALGVPSQSPLPLRTAG |
| Ga0210274_13879101 | 3300030531 | Soil | AREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0210254_105822491 | 3300030602 | Soil | SSFCFNLDLADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0265392_10679362 | 3300030623 | Soil | SVREAEDLIRDAETFLRVAERALGVDVQPLLPLRPAS |
| Ga0210251_108741301 | 3300030624 | Soil | LLSDDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0210291_110421581 | 3300030626 | Soil | RAVSGAEADDLLRDAETFLSLVEEALGVTVQPVLPLRSAG |
| Ga0307919_10299892 | 3300030718 | Soil | SAREADDLLRDAETFLSLAEEALGVASQAVLPLRSAG |
| Ga0265462_123635063 | 3300030738 | Soil | VSLREADDLLRDAEIFVSLVESALGVSAQPLLPLAAG |
| Ga0075391_111937682 | 3300030934 | Soil | RAASAREADDLLRDAETFLSLAETALGVHVQSPLPLRPAG |
| Ga0138302_16568512 | 3300030937 | Soil | LPRAASAREAEDLIRDVETFLGITERALGVGEQLELPLRPAS |
| Ga0265768_1074312 | 3300030963 | Soil | IFIFFLSYSREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0075399_112306222 | 3300030967 | Soil | TAREADDLLRDAGTFLSLAEEALGLPSQSPLPLRPAG |
| Ga0265748_1043782 | 3300030982 | Soil | ASAREADDLLRDAETFLSLAETALGVEVQSALPLRPAG |
| Ga0170834_1088872972 | 3300031057 | Forest Soil | AVTGREADELLRDAATFVSLAESALGVPAQSLLPLLAAM |
| Ga0308189_101176012 | 3300031058 | Soil | SAWEADNLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0102748_116718901 | 3300031089 | Soil | READDLLRDAETFLSLAETALGVEVPSPLPLRPAG |
| Ga0170820_112908761 | 3300031446 | Forest Soil | RAASAREAEELIRDAETFLRVAERALGVDGQSLLPLRPAS |
| Ga0318538_101480433 | 3300031546 | Soil | VSGREADDLLRDAETFLSLAEEALGGPAQPALPLRSVG |
| Ga0318515_104585231 | 3300031572 | Soil | GLARAVSAAEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0318555_102966992 | 3300031640 | Soil | PGLARAVSRAEADDLLRDAETFLSLVEDALGVTVQPVLPLRSVG |
| Ga0318542_107605471 | 3300031668 | Soil | PRAVSSREADDLLRDAETFLSLAEEALGMPAQPALPLRSVG |
| Ga0306917_110211482 | 3300031719 | Soil | ARAVSAAEADDLLRDAETFLSLAEEALGVTVQPVLPLRSVG |
| Ga0318493_100736973 | 3300031723 | Soil | AEADDLLRDAETFLSLAEDALGVTVHPVLPLRSVG |
| Ga0318501_100486693 | 3300031736 | Soil | VSAAEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0318501_105088641 | 3300031736 | Soil | ARAVSAAEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0318492_101666222 | 3300031748 | Soil | AVSDREADDLLRDAETFLSLAEEALGRPAQAALPLRSVG |
| Ga0318554_102200111 | 3300031765 | Soil | ASAREADDLLRDAETFLSLAETALGVEVQTPLPLRPAG |
| Ga0318546_107625382 | 3300031771 | Soil | ARAVSGAEADDLLRDAETFLSLVEETLGVTVQPVLPLRSAG |
| Ga0318566_100604234 | 3300031779 | Soil | SGREADDLLRDAETFLSLAEEALGMTAQPVLPLRSVG |
| Ga0318567_103920492 | 3300031821 | Soil | SAAEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0307478_115647762 | 3300031823 | Hardwood Forest Soil | PWEADELLRDAETFLSLAEQALGAPTQPVLPLLTAG |
| Ga0316030_1048761 | 3300031869 | Soil | VATAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0318551_106321361 | 3300031896 | Soil | AVSATEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0318520_108441672 | 3300031897 | Soil | READDLLRDAETFLSLAETALGVEVQTPLPLRPAG |
| Ga0306923_111758092 | 3300031910 | Soil | ATAREAEDLLRDAETFLAVAERALGVDSQPMLPLRPAS |
| Ga0306921_117778712 | 3300031912 | Soil | RAAADLRRDAETFLSVAERALGVDSQPTLPLKSAS |
| Ga0307479_114305551 | 3300031962 | Hardwood Forest Soil | AREAEDLMRDAETFLSVAERALGVDSQPTLPLKSAS |
| Ga0318562_105213111 | 3300032008 | Soil | VSGREADDLLRDAETFLSLAEEALGMTAQPVLPLRSVG |
| Ga0318569_103387491 | 3300032010 | Soil | RAVSAAEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0318507_101648542 | 3300032025 | Soil | ARAVSATEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0318556_107691971 | 3300032043 | Soil | REAEDLLRDAETFLAVAERALGVDSQPMLPLRPAS |
| Ga0318558_101221703 | 3300032044 | Soil | SSAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| Ga0318513_105521622 | 3300032065 | Soil | SGAEADDLLRDAETFLSLVEETLGVTVQPVLPLRSAG |
| Ga0318524_101674042 | 3300032067 | Soil | AVSAAEADDLLRDAETFLSLAEDALGVTVQPVLPLRSVG |
| Ga0318553_104964581 | 3300032068 | Soil | LPKAVTAHEADDLLRDAETFLSLAEEALGVTAQPLLPLRSAG |
| Ga0318553_105284312 | 3300032068 | Soil | AGLARAVSRAEADDLLRDAETFLSLVEDALGVTVHPVLPLRSVG |
| Ga0306924_105484821 | 3300032076 | Soil | AREADDLLRDAEIFLSLAETALGVEVQSPLPLRPAG |
| Ga0348332_117263742 | 3300032515 | Plant Litter | AASAREADDLLRDAETFLSLAETALGVEVQSPLPLRPAS |
| Ga0335078_101413421 | 3300032805 | Soil | TRAVSAREADDLLRDAGTFLSLAEEALGLPAQSALPLRPAG |
| Ga0335074_112580692 | 3300032895 | Soil | RAATAREAEDLLRDAGTFVSVAERALGIDSQPLLPLRSAS |
| Ga0335073_107547641 | 3300033134 | Soil | ASAREADDLLRDAETFLSLAETALGVEVPSPLPLRPAG |
| Ga0310914_116505412 | 3300033289 | Soil | TAREAENLLRDAGTFLSVAERALGVDSQPMLPLRPAS |
| Ga0310914_116973591 | 3300033289 | Soil | SAREADDLLRDAETFLSLAETALGVEVQAPLPLRPAG |
| Ga0318519_102240552 | 3300033290 | Soil | VSRAEADDLLRDAETFLSLVEDALGVTVQPVLPLRSVG |
| Ga0310811_106347572 | 3300033475 | Soil | RAASAREADNLLRDAETFLSLAETALGVEVQSPLPLRPAG |
| ⦗Top⦘ |