| Basic Information | |
|---|---|
| Family ID | F042471 |
| Family Type | Metagenome |
| Number of Sequences | 158 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.97 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.823 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere (6.962 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.329 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.33% β-sheet: 21.33% Coil/Unstructured: 61.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF08309 | LVIVD | 4.43 |
| PF04392 | ABC_sub_bind | 1.27 |
| PF01738 | DLH | 1.27 |
| PF14319 | Zn_Tnp_IS91 | 1.27 |
| PF13473 | Cupredoxin_1 | 0.63 |
| PF03793 | PASTA | 0.63 |
| PF13505 | OMP_b-brl | 0.63 |
| PF07883 | Cupin_2 | 0.63 |
| PF09996 | DUF2237 | 0.63 |
| PF17210 | SdrD_B | 0.63 |
| PF00589 | Phage_integrase | 0.63 |
| PF13089 | PP_kinase_N | 0.63 |
| PF02371 | Transposase_20 | 0.63 |
| PF00665 | rve | 0.63 |
| PF00078 | RVT_1 | 0.63 |
| PF00034 | Cytochrom_C | 0.63 |
| PF10634 | Iron_transport | 0.63 |
| PF02627 | CMD | 0.63 |
| PF02211 | NHase_beta | 0.63 |
| PF00072 | Response_reg | 0.63 |
| PF03401 | TctC | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 4.43 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.27 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.63 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.63 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.63 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.63 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.63 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.63 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.82 % |
| Unclassified | root | N/A | 34.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_112349009 | Not Available | 575 | Open in IMG/M |
| 3300002908|JGI25382J43887_10129933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1301 | Open in IMG/M |
| 3300004463|Ga0063356_102417754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300004463|Ga0063356_104544318 | Not Available | 597 | Open in IMG/M |
| 3300004633|Ga0066395_10072957 | Not Available | 1586 | Open in IMG/M |
| 3300005176|Ga0066679_11015773 | Not Available | 515 | Open in IMG/M |
| 3300005330|Ga0070690_100796172 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005334|Ga0068869_101139103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300005336|Ga0070680_100868828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300005338|Ga0068868_101091577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300005338|Ga0068868_101406961 | Not Available | 651 | Open in IMG/M |
| 3300005344|Ga0070661_100394782 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300005356|Ga0070674_100812048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300005364|Ga0070673_100280903 | Not Available | 1460 | Open in IMG/M |
| 3300005366|Ga0070659_100106534 | Not Available | 2260 | Open in IMG/M |
| 3300005439|Ga0070711_100733417 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005439|Ga0070711_101888263 | Not Available | 525 | Open in IMG/M |
| 3300005445|Ga0070708_100333445 | Not Available | 1429 | Open in IMG/M |
| 3300005445|Ga0070708_101594871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300005447|Ga0066689_10067965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1966 | Open in IMG/M |
| 3300005447|Ga0066689_10229746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300005450|Ga0066682_10197864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1287 | Open in IMG/M |
| 3300005456|Ga0070678_101227445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300005457|Ga0070662_101067083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300005458|Ga0070681_10127622 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300005458|Ga0070681_10849347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300005458|Ga0070681_11336918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300005530|Ga0070679_100395128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1329 | Open in IMG/M |
| 3300005530|Ga0070679_100484079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300005530|Ga0070679_101043993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300005540|Ga0066697_10552938 | Not Available | 645 | Open in IMG/M |
| 3300005543|Ga0070672_100076911 | All Organisms → cellular organisms → Bacteria | 2667 | Open in IMG/M |
| 3300005563|Ga0068855_101505498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300005563|Ga0068855_102508958 | Not Available | 513 | Open in IMG/M |
| 3300005577|Ga0068857_101636881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300005614|Ga0068856_100279653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1685 | Open in IMG/M |
| 3300005614|Ga0068856_101920577 | Not Available | 603 | Open in IMG/M |
| 3300005616|Ga0068852_100405472 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300005616|Ga0068852_102386016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300005764|Ga0066903_100552514 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300005764|Ga0066903_101447995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. TSO35-2 | 1293 | Open in IMG/M |
| 3300005764|Ga0066903_103892714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300005764|Ga0066903_107050609 | Not Available | 582 | Open in IMG/M |
| 3300005764|Ga0066903_107625615 | Not Available | 557 | Open in IMG/M |
| 3300005841|Ga0068863_102348474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300006031|Ga0066651_10778716 | Not Available | 518 | Open in IMG/M |
| 3300006032|Ga0066696_10227200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1200 | Open in IMG/M |
| 3300006175|Ga0070712_100347598 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300006755|Ga0079222_12134897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300006755|Ga0079222_12634329 | Not Available | 506 | Open in IMG/M |
| 3300006806|Ga0079220_10183593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1190 | Open in IMG/M |
| 3300006806|Ga0079220_10435382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300006854|Ga0075425_101211538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300006881|Ga0068865_100129244 | Not Available | 1890 | Open in IMG/M |
| 3300006954|Ga0079219_10917411 | Not Available | 711 | Open in IMG/M |
| 3300009093|Ga0105240_12431859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
| 3300009174|Ga0105241_11447779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300010048|Ga0126373_12805517 | Not Available | 544 | Open in IMG/M |
| 3300010303|Ga0134082_10275885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300010325|Ga0134064_10190407 | Not Available | 731 | Open in IMG/M |
| 3300010333|Ga0134080_10242323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300010358|Ga0126370_11146931 | Not Available | 719 | Open in IMG/M |
| 3300010359|Ga0126376_12305789 | Not Available | 584 | Open in IMG/M |
| 3300010361|Ga0126378_10011580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7248 | Open in IMG/M |
| 3300010366|Ga0126379_13085340 | Not Available | 558 | Open in IMG/M |
| 3300010371|Ga0134125_11703841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300010371|Ga0134125_12023270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300010371|Ga0134125_12506222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300010373|Ga0134128_10205865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2214 | Open in IMG/M |
| 3300010373|Ga0134128_10363379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1617 | Open in IMG/M |
| 3300010376|Ga0126381_100005921 | All Organisms → cellular organisms → Bacteria | 13498 | Open in IMG/M |
| 3300010396|Ga0134126_10353097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1715 | Open in IMG/M |
| 3300010396|Ga0134126_10765933 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300010396|Ga0134126_11094608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300010398|Ga0126383_11267452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300010398|Ga0126383_13076126 | Not Available | 545 | Open in IMG/M |
| 3300010403|Ga0134123_11500853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300012203|Ga0137399_10118489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2076 | Open in IMG/M |
| 3300012203|Ga0137399_11362468 | Not Available | 595 | Open in IMG/M |
| 3300012209|Ga0137379_11022096 | Not Available | 732 | Open in IMG/M |
| 3300012209|Ga0137379_11737708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300012513|Ga0157326_1076116 | Not Available | 541 | Open in IMG/M |
| 3300012918|Ga0137396_10218121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1404 | Open in IMG/M |
| 3300012927|Ga0137416_11175610 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012930|Ga0137407_10869041 | Not Available | 852 | Open in IMG/M |
| 3300012955|Ga0164298_10569587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300012955|Ga0164298_11279841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300012971|Ga0126369_10147550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2207 | Open in IMG/M |
| 3300012971|Ga0126369_10380792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. TSO35-2 | 1443 | Open in IMG/M |
| 3300012971|Ga0126369_11846195 | Not Available | 693 | Open in IMG/M |
| 3300013104|Ga0157370_10109956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2576 | Open in IMG/M |
| 3300013105|Ga0157369_12167494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300013296|Ga0157374_11630200 | Not Available | 669 | Open in IMG/M |
| 3300013296|Ga0157374_11951134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300013306|Ga0163162_10101363 | Not Available | 2971 | Open in IMG/M |
| 3300013306|Ga0163162_11701212 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300013307|Ga0157372_10153679 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300013307|Ga0157372_10187171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2397 | Open in IMG/M |
| 3300013307|Ga0157372_11101454 | Not Available | 919 | Open in IMG/M |
| 3300013307|Ga0157372_11619276 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300013307|Ga0157372_12365577 | Not Available | 610 | Open in IMG/M |
| 3300013307|Ga0157372_13356218 | Not Available | 510 | Open in IMG/M |
| 3300014497|Ga0182008_10623491 | Not Available | 608 | Open in IMG/M |
| 3300014968|Ga0157379_11159579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300014969|Ga0157376_10426128 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300015373|Ga0132257_101392563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300015374|Ga0132255_103845514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300016357|Ga0182032_11614777 | Not Available | 564 | Open in IMG/M |
| 3300016422|Ga0182039_11598869 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300018028|Ga0184608_10069661 | Not Available | 1423 | Open in IMG/M |
| 3300018066|Ga0184617_1250211 | Not Available | 531 | Open in IMG/M |
| 3300018071|Ga0184618_10000992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6863 | Open in IMG/M |
| 3300018431|Ga0066655_10511049 | Not Available | 797 | Open in IMG/M |
| 3300018433|Ga0066667_10256442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1329 | Open in IMG/M |
| 3300019881|Ga0193707_1021679 | Not Available | 2125 | Open in IMG/M |
| 3300020580|Ga0210403_10700937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300020581|Ga0210399_10762785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300021170|Ga0210400_10509835 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300021171|Ga0210405_10825182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300021181|Ga0210388_11208067 | Not Available | 641 | Open in IMG/M |
| 3300021432|Ga0210384_10389774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 1255 | Open in IMG/M |
| 3300025898|Ga0207692_10805601 | Not Available | 614 | Open in IMG/M |
| 3300025903|Ga0207680_10026208 | All Organisms → cellular organisms → Bacteria | 3228 | Open in IMG/M |
| 3300025906|Ga0207699_10714130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300025906|Ga0207699_10754861 | Not Available | 714 | Open in IMG/M |
| 3300025912|Ga0207707_10391646 | Not Available | 1193 | Open in IMG/M |
| 3300025916|Ga0207663_10949539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300025918|Ga0207662_10743591 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300025920|Ga0207649_11170367 | Not Available | 607 | Open in IMG/M |
| 3300025921|Ga0207652_11218644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300025921|Ga0207652_11698872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300025928|Ga0207700_10868442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300025929|Ga0207664_10858827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300025932|Ga0207690_11019771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300025933|Ga0207706_10676324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300025933|Ga0207706_11321561 | Not Available | 595 | Open in IMG/M |
| 3300025940|Ga0207691_10007370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10600 | Open in IMG/M |
| 3300025944|Ga0207661_11413998 | Not Available | 638 | Open in IMG/M |
| 3300025945|Ga0207679_10701620 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300025949|Ga0207667_10067835 | All Organisms → cellular organisms → Bacteria | 3715 | Open in IMG/M |
| 3300025972|Ga0207668_10956328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300025981|Ga0207640_11325939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300025986|Ga0207658_11313210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300025986|Ga0207658_11607190 | Not Available | 594 | Open in IMG/M |
| 3300026023|Ga0207677_10337192 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300026023|Ga0207677_10785525 | Not Available | 851 | Open in IMG/M |
| 3300026035|Ga0207703_12199009 | Not Available | 528 | Open in IMG/M |
| 3300026067|Ga0207678_11039167 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300026313|Ga0209761_1008018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6907 | Open in IMG/M |
| 3300026333|Ga0209158_1007672 | All Organisms → cellular organisms → Bacteria | 5559 | Open in IMG/M |
| 3300027775|Ga0209177_10274839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300031716|Ga0310813_10715752 | Not Available | 895 | Open in IMG/M |
| 3300031720|Ga0307469_11380751 | Not Available | 671 | Open in IMG/M |
| 3300031736|Ga0318501_10861670 | Not Available | 503 | Open in IMG/M |
| 3300031754|Ga0307475_11396443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300031890|Ga0306925_12225605 | Not Available | 509 | Open in IMG/M |
| 3300031939|Ga0308174_11100442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300033412|Ga0310810_11050511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.06% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1123490092 | 3300000956 | Soil | NGNGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR* |
| JGI25382J43887_101299332 | 3300002908 | Grasslands Soil | DGHGNGNGHGNGNSTEVQLWTVSDGHGFQVLRFSNRFKAQHKDLFENTVTSEQSR* |
| Ga0063356_1024177542 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GNSADIELWTVTDGHGFQVLRFSKSFIAQHKDLFKNVVTTDQSR* |
| Ga0063356_1045443181 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0066395_100729572 | 3300004633 | Tropical Forest Soil | VAKGKGDGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTEQSR* |
| Ga0066679_110157731 | 3300005176 | Soil | GNGNGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR* |
| Ga0070690_1007961721 | 3300005330 | Switchgrass Rhizosphere | GNGVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL* |
| Ga0068869_1011391032 | 3300005334 | Miscanthus Rhizosphere | IQLWTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL* |
| Ga0070680_1008688281 | 3300005336 | Corn Rhizosphere | GGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENVVTTEQSL* |
| Ga0068868_1010915771 | 3300005338 | Miscanthus Rhizosphere | GGGPGNSADIQLWTVSDAHGLQVLQFSKSFTAQHKDLFENTVTTEQDR* |
| Ga0068868_1014069611 | 3300005338 | Miscanthus Rhizosphere | GNGVGGGPGNSADIQLWAVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0070661_1003947821 | 3300005344 | Corn Rhizosphere | VGGGPGNSADIQLWTVSDAHGFQVLQFSKSFTAQHKDLFESTVTTRSR* |
| Ga0070674_1008120481 | 3300005356 | Miscanthus Rhizosphere | NDKAKHDNNGNGNGVGGGPGNSADIQLWTVSDGHGFQVLRFTKSFTAQHKDLFENTVTTEQSL* |
| Ga0070673_1002809032 | 3300005364 | Switchgrass Rhizosphere | KGNGVGGGPGNSADIQLWAVSDGHGFQVLRFSKTFTAQHKDLFENTVTTEQSQ* |
| Ga0070659_1001065341 | 3300005366 | Corn Rhizosphere | GGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0070711_1007334171 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ* |
| Ga0070711_1018882631 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NGNGNGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFKNTVTTEQDR* |
| Ga0070708_1003334452 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFANTVTSE* |
| Ga0070708_1015948711 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFADTVTTEQSR* |
| Ga0066689_100679654 | 3300005447 | Soil | NSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSE* |
| Ga0066689_102297462 | 3300005447 | Soil | NSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR* |
| Ga0066682_101978641 | 3300005450 | Soil | GNGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR* |
| Ga0070678_1012274452 | 3300005456 | Miscanthus Rhizosphere | NGVGGGPGNSADIQLWTVSDAHGFQVLQFPKSFTAKHKDLFENTVTTEHTR* |
| Ga0070662_1010670832 | 3300005457 | Corn Rhizosphere | GGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSE* |
| Ga0070681_101276221 | 3300005458 | Corn Rhizosphere | IQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSE* |
| Ga0070681_108493471 | 3300005458 | Corn Rhizosphere | GVGGGPGNSADIQLWTVSDGHGFQVLRFAKSFTAQHQDLFANVVTTEQSQ* |
| Ga0070681_113369181 | 3300005458 | Corn Rhizosphere | NGNGNGVGGHPGNSADIQLWTVSDAHGFQVLQFSKSFTAQHKDLFQNTVTTQ* |
| Ga0070679_1003951282 | 3300005530 | Corn Rhizosphere | GPGNSADIQLWTVSDGHGFQVLRFAKNFTAQHKDLFKDTVTTEQSR* |
| Ga0070679_1004840792 | 3300005530 | Corn Rhizosphere | ADIQLWTVSDGHGFQVLQFSKNFTAQHKDLFANTVTTEQSE* |
| Ga0070679_1010439932 | 3300005530 | Corn Rhizosphere | GGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0066697_105529382 | 3300005540 | Soil | LWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSE* |
| Ga0070672_1000769111 | 3300005543 | Miscanthus Rhizosphere | GVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL* |
| Ga0068855_1015054981 | 3300005563 | Corn Rhizosphere | DIQLWTVSDGHGFQVLRFTKSFTAQHKDLFENTVTTEQSQ* |
| Ga0068855_1025089581 | 3300005563 | Corn Rhizosphere | DIQLWTVSDGHGFQVLQFSKSFTAQHKDLFKNTVTTEQDR* |
| Ga0068857_1016368812 | 3300005577 | Corn Rhizosphere | DIQLWTVSDGHGFQVLQFSKNFTAQHKDLFANTVTTEQSE* |
| Ga0068856_1002796532 | 3300005614 | Corn Rhizosphere | IQLWTVSDGHGFQVLRFSKSFTAQHKDLFANVVTTEQDR* |
| Ga0068856_1019205772 | 3300005614 | Corn Rhizosphere | NGDDNANGHGNRGNGVAGGPGNSADVQLWVVSDAHGFQALQFPKSFTAQHKDLFSNVVTTDQTR* |
| Ga0068852_1004054722 | 3300005616 | Corn Rhizosphere | LWTVSDGHGFQVLRFAKSFTAQHQDLFANVVTTEQSQ* |
| Ga0068852_1023860162 | 3300005616 | Corn Rhizosphere | NGNGNGNAVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENVVTTQQDR* |
| Ga0066903_1005525141 | 3300005764 | Tropical Forest Soil | LWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTESSR* |
| Ga0066903_1014479951 | 3300005764 | Tropical Forest Soil | GKGDGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANTVTTEQSQ* |
| Ga0066903_1038927142 | 3300005764 | Tropical Forest Soil | VSDGHGFQVLQFSKSFTAQHKDLFANTVTTQQSQ* |
| Ga0066903_1070506092 | 3300005764 | Tropical Forest Soil | GVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANTVTTEQSQ* |
| Ga0066903_1076256152 | 3300005764 | Tropical Forest Soil | GNGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANTVTSQQSR* |
| Ga0068863_1023484741 | 3300005841 | Switchgrass Rhizosphere | LWTVSDGHGFQVLRFPKSFTAQHKDLFANTVTTEQDR* |
| Ga0066651_107787161 | 3300006031 | Soil | GNSADIQLWTVSDGHGFQVLKFSKSFTAQHKDLFENVVTTQQDR* |
| Ga0066696_102272001 | 3300006032 | Soil | GGPGNSADIQLWTVSDGHGFQVLQFPKSFTAQHKDLFANTVTSE* |
| Ga0070712_1003475981 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GPGNSADIQLWTVSDGHGFQVLRFTKSFTAQHKDLFKDTVTTEQSR* |
| Ga0079222_121348972 | 3300006755 | Agricultural Soil | ADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFANVVTTEQSQ* |
| Ga0079222_126343291 | 3300006755 | Agricultural Soil | GNGNAVGGGPGNSADIQLWVVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ* |
| Ga0079220_101835932 | 3300006806 | Agricultural Soil | GVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTARHKDLFSNVVTTEQDR* |
| Ga0079220_104353822 | 3300006806 | Agricultural Soil | GGGPGNSADIQLWTVSDGHGFQVLRFSKRFTAQHKELFENTITSEQSR* |
| Ga0075425_1012115381 | 3300006854 | Populus Rhizosphere | GNSADIQLWTVSDGHGFQVLRFSKRFTAQHKDLFENTVTSEQSR* |
| Ga0068865_1001292441 | 3300006881 | Miscanthus Rhizosphere | NGVGGGPGNSADIQLWAVSDGHGFQVLRFSKTFTAQHKDLLENTVTTEQSQ* |
| Ga0079219_109174112 | 3300006954 | Agricultural Soil | VGGGPGNSADIQLWTVSDGHGFQVLRFSKTFTAQHKDLFENTVTTEQTP* |
| Ga0105240_124318593 | 3300009093 | Corn Rhizosphere | ADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFKNTVTTEQDR* |
| Ga0105241_114477792 | 3300009174 | Corn Rhizosphere | PGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ* |
| Ga0126373_128055171 | 3300010048 | Tropical Forest Soil | NGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTENSL* |
| Ga0134082_102758851 | 3300010303 | Grasslands Soil | NSTEVQLWTVSDGHGFQVLRFSNRFKAQHKDLFENTVTSEQSR* |
| Ga0134064_101904071 | 3300010325 | Grasslands Soil | NATDVQLWTVTDGHGFQVLHFSSNFLAQHQDLFANTVTSNTVTSE* |
| Ga0134080_102423231 | 3300010333 | Grasslands Soil | IQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR* |
| Ga0126370_111469312 | 3300010358 | Tropical Forest Soil | GPGNSADIQLWTVSDGHGFQVLRFPKSFTAQHKDLFENTVTTEGSL* |
| Ga0126376_123057891 | 3300010359 | Tropical Forest Soil | GGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANTVTTEQSQ* |
| Ga0126378_100115805 | 3300010361 | Tropical Forest Soil | QLWTVSDGHGFQVLQFSKSFTAQHKDLFANTVTTEQDR* |
| Ga0126379_130853401 | 3300010366 | Tropical Forest Soil | GNSADIQLWTVSDGHGFQVLQFAKSFTAQHKDLFENTVTTEQSR* |
| Ga0134125_117038412 | 3300010371 | Terrestrial Soil | GNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFKNTVTTEQDR* |
| Ga0134125_120232702 | 3300010371 | Terrestrial Soil | GPGREVQLWTVSDGHGFQVLQFSRSFTAQHKDLFENTVTTEQSQ* |
| Ga0134125_125062221 | 3300010371 | Terrestrial Soil | WTVSDGHGFQVLQFPKNFTAQHKDLFANVVTTEQSQ* |
| Ga0134128_102058651 | 3300010373 | Terrestrial Soil | GNGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0134128_103633791 | 3300010373 | Terrestrial Soil | HSVGGRPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ* |
| Ga0126381_10000592117 | 3300010376 | Tropical Forest Soil | GVGGGPGNSADIQLWVVSDSHGFQVLQFSKSFTAQHKDLFANTVTTEGTR* |
| Ga0134126_103530973 | 3300010396 | Terrestrial Soil | GPEVQLWTVSDGHGFQVLRFSNGFEAEHRDLFAHTVTTEGPN* |
| Ga0134126_107659332 | 3300010396 | Terrestrial Soil | GPGNSADIQLWTVSDAHGFQVLQFSKSFTAQHKDLFESTVTTRSR* |
| Ga0134126_110946082 | 3300010396 | Terrestrial Soil | GNGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFKNTVTTEQDR* |
| Ga0126383_112674521 | 3300010398 | Tropical Forest Soil | DIQLWTVSDGHGFQVLRFPKSFTAQHKDLFENTVTTEGSL* |
| Ga0126383_130761262 | 3300010398 | Tropical Forest Soil | GDGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFANTVTTEQGR* |
| Ga0134123_115008531 | 3300010403 | Terrestrial Soil | LWTVSDGHGFQVLRFSNRFKAQHKDLFENTVTSEQSR* |
| Ga0137399_101184891 | 3300012203 | Vadose Zone Soil | EVQLWTVSDGHGFQVLRFSNRFKAQHKDLFENTVTSEQSR* |
| Ga0137399_113624681 | 3300012203 | Vadose Zone Soil | GNGVGGGPGNSADIQLWTVSDGHGFQVLQFPKSFTAQHKDLFADTVTTEQSR* |
| Ga0137379_110220961 | 3300012209 | Vadose Zone Soil | SADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFADTVTTEQTR* |
| Ga0137379_117377081 | 3300012209 | Vadose Zone Soil | RGNNGVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFANVVTTEQSR* |
| Ga0157326_10761162 | 3300012513 | Arabidopsis Rhizosphere | GNGVGGGPGNSADIQLWAVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSL* |
| Ga0137396_102181211 | 3300012918 | Vadose Zone Soil | TVSDGHGFQVLRFSNRFKAQHKDLFENAVTSEQSR* |
| Ga0137416_111756102 | 3300012927 | Vadose Zone Soil | NDHGNGHGNGHDHGEGNSTEVQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR* |
| Ga0137407_108690411 | 3300012930 | Vadose Zone Soil | NGNGVGGGPGNSADIQLWTVSDGHGFQVLQFPKSFTAQHKDLFANTVTSE* |
| Ga0164298_105695871 | 3300012955 | Soil | NGVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHTDLFENTVTTEQSL* |
| Ga0164298_112798411 | 3300012955 | Soil | PAGQHGFQVLQFSKSFTAQHKDLFANVVTTEQSE* |
| Ga0126369_101475501 | 3300012971 | Tropical Forest Soil | QLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTESSR* |
| Ga0126369_103807921 | 3300012971 | Tropical Forest Soil | ADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANTVTTEQSQ* |
| Ga0126369_118461951 | 3300012971 | Tropical Forest Soil | NGNGNGVGGGPGNSADIQIWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTEGSI* |
| Ga0157370_101099561 | 3300013104 | Corn Rhizosphere | NGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ* |
| Ga0157369_121674941 | 3300013105 | Corn Rhizosphere | NGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTQQDR* |
| Ga0157374_116302001 | 3300013296 | Miscanthus Rhizosphere | NPTDVQLWVVSDGHGFQALHFSSTFLAQHQALFANTVTTESSR* |
| Ga0157374_119511342 | 3300013296 | Miscanthus Rhizosphere | GNGNGVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL* |
| Ga0163162_101013631 | 3300013306 | Switchgrass Rhizosphere | KGNGHDKAKRNGNGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0163162_117012123 | 3300013306 | Switchgrass Rhizosphere | VSDSHGFQVVQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0157372_101536791 | 3300013307 | Corn Rhizosphere | GNGNGVGGGPGNSADIQLWTVSDAHGFQVLQFPKSFTAQHKDLFENVVTTEQTR* |
| Ga0157372_101871713 | 3300013307 | Corn Rhizosphere | GNGNGVGGGNGNSVDIQIWTVSDGHGFQVLHFPKRFTAQHKDLFENTVTTEGSI* |
| Ga0157372_111014541 | 3300013307 | Corn Rhizosphere | NGNGVGGGPGNSADIQLWAVSDGHGFQVLRFSKTFTAQHKDLFENTVTTEQSQ* |
| Ga0157372_116192761 | 3300013307 | Corn Rhizosphere | GGPGNSADVQLWVVSDAHGFQALQFPKSFTAQHKDLFSNVVTTDQTR* |
| Ga0157372_123655771 | 3300013307 | Corn Rhizosphere | TVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL* |
| Ga0157372_133562181 | 3300013307 | Corn Rhizosphere | NGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTEGSL* |
| Ga0182008_106234911 | 3300014497 | Rhizosphere | GGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENVVTTQQDR* |
| Ga0157379_111595791 | 3300014968 | Switchgrass Rhizosphere | AKGNNGVGGGPGNSADIQLWTVSDGHGLQVLHFAKSFTAQHKDLFENVVTTQQDR* |
| Ga0157376_104261282 | 3300014969 | Miscanthus Rhizosphere | QLWTVSDAHGFQVLQFPKSFTAKHKDLFENTVTTEHTR* |
| Ga0132257_1013925632 | 3300015373 | Arabidopsis Rhizosphere | GVGGGPGNSADIQLWTVSDGHGFQVLRFSKTFTAQHKDLFENTVTTEQTP* |
| Ga0132255_1038455141 | 3300015374 | Arabidopsis Rhizosphere | KRNGNGVGGGPGNSADIQLWTVSDSHGFQVVQFSKSFTAQHKDLFENTVTTEQSQ* |
| Ga0182032_116147771 | 3300016357 | Soil | GVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANTVTTKQSQ |
| Ga0182039_115988691 | 3300016422 | Soil | NGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTENSL |
| Ga0184608_100696611 | 3300018028 | Groundwater Sediment | NGNGNGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSE |
| Ga0184617_12502111 | 3300018066 | Groundwater Sediment | GGGPGNSADIQLWTVSDGHGFQVLQFPKSFTAQHKDLFANTVTSE |
| Ga0184618_100009921 | 3300018071 | Groundwater Sediment | GNGHGNGNSTEVQLWTVSDGHGFQVLRFSNRFKAQHKDLFENTVTSEQSR |
| Ga0066655_105110491 | 3300018431 | Grasslands Soil | LWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR |
| Ga0066667_102564421 | 3300018433 | Grasslands Soil | GNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR |
| Ga0193707_10216794 | 3300019881 | Soil | PGNSADIQLWTVTDGHGFQVLQFPKSFTAQHKDLFANTVTTEQSR |
| Ga0210403_107009372 | 3300020580 | Soil | HGNGKGDDHGNGKGDDHGNSTEVQLWIVSDGHGFQVLRFSNRFVAQHKDLFEHTNSSYQ |
| Ga0210399_107627852 | 3300020581 | Soil | TEVQLWTVSDGHGFQVLRFSKAFKAQHEELFENTVTTEQSR |
| Ga0210400_105098351 | 3300021170 | Soil | NDDGKDNGNGVGGGHGNSADIQLWTVSDGHGFQVLRFTKSFTARHKDLFADTVTTEQSR |
| Ga0210405_108251822 | 3300021171 | Soil | GNSADIQLWTVSDGHGFQVLQFTKSFTARHKDLFADTVTTEQSR |
| Ga0210388_112080672 | 3300021181 | Soil | GNGNGNGHGDDHGNSSEVQLWIVSDGHGLQVLRFSNRFVAQHKELFEHTNSSYQ |
| Ga0210384_103897743 | 3300021432 | Soil | GGEGNGNAADIQLWTVSDGHGFQVLQFTKRFTAQHKDLFENTVTTEQSQ |
| Ga0207692_108056011 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | NGNGVGGGPGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFANTVTTE |
| Ga0207680_100262081 | 3300025903 | Switchgrass Rhizosphere | VGGEPGNSADIQLWTVSDSHGFQVVQFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0207699_107141301 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GKGNGVGGGPGNSADIQLWTVSDGHGFQVLQFPKNFTAQHKDLFANVVTTEQSQ |
| Ga0207699_107548611 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GNGNGVGGGNGNSVDIQIWTVSDGHGFQVLHFPKRFTAQHKDLFENTVTTEGSI |
| Ga0207707_103916464 | 3300025912 | Corn Rhizosphere | NGNAVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENVVTTQQDR |
| Ga0207663_109495392 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ |
| Ga0207662_107435911 | 3300025918 | Switchgrass Rhizosphere | VGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL |
| Ga0207649_111703671 | 3300025920 | Corn Rhizosphere | ADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENVVTTQQDR |
| Ga0207652_112186441 | 3300025921 | Corn Rhizosphere | NSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFKNTVTTEQDR |
| Ga0207652_116988722 | 3300025921 | Corn Rhizosphere | PGNSADIQLWTVSDGHGFQVLRFAKNFTAQHKDLFKDTVTTEQSR |
| Ga0207700_108684422 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NSADIQLWTVSDAHGFQVLQFPKSFTAQHKDLFENVVTTEQTR |
| Ga0207664_108588271 | 3300025929 | Agricultural Soil | IQIWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTEGSI |
| Ga0207690_110197712 | 3300025932 | Corn Rhizosphere | VGGGPGNSADIQLWTVSDGHGFQVLQFSKNFTAQHKDLFANTVTTEQSE |
| Ga0207706_106763241 | 3300025933 | Corn Rhizosphere | GNGVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSE |
| Ga0207706_113215611 | 3300025933 | Corn Rhizosphere | SADIQLWTVSDSHGFQVVQFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0207691_1000737015 | 3300025940 | Miscanthus Rhizosphere | GVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL |
| Ga0207661_114139982 | 3300025944 | Corn Rhizosphere | SVDIQIWTVSDGHGFQVLHFPKRFTAQHKDLFENTVSTEGSI |
| Ga0207679_107016202 | 3300025945 | Corn Rhizosphere | WTVSDGHGFQVLRFSKSFTAQHKDLFENVVTTQQDR |
| Ga0207667_100678351 | 3300025949 | Corn Rhizosphere | KANGDAKGNHSVGGGPGNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ |
| Ga0207668_109563281 | 3300025972 | Switchgrass Rhizosphere | GNGNGVGGGPGNSADIQLWTVSDSHGFQVVQFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0207640_113259391 | 3300025981 | Corn Rhizosphere | WTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0207658_113132101 | 3300025986 | Switchgrass Rhizosphere | VGNGVGGGPGNSADIQLWTVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQSL |
| Ga0207658_116071901 | 3300025986 | Switchgrass Rhizosphere | LWAVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0207677_103371921 | 3300026023 | Miscanthus Rhizosphere | LWTVSDSHGFQVVQFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0207677_107855251 | 3300026023 | Miscanthus Rhizosphere | RNGNGVGGGPGNSADIQLWAVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0207703_121990091 | 3300026035 | Switchgrass Rhizosphere | GPGNSADIQLWAVSDGHGFQVLQFPKSFTAQHKDLFANVVTTEQSE |
| Ga0207678_110391672 | 3300026067 | Corn Rhizosphere | QLWVVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSQ |
| Ga0209761_10080188 | 3300026313 | Grasslands Soil | VQLWTVSDGHGFQVLRFSNRFKAQHKDLFENTVTSEQSR |
| Ga0209158_10076721 | 3300026333 | Soil | PGNSADIQLWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTSEQSR |
| Ga0209177_102748391 | 3300027775 | Agricultural Soil | NSADIQLWVVSDGHGFQVLRFSKSFTAQHKDLFENTVTTEQTP |
| Ga0310813_107157522 | 3300031716 | Soil | GQGKAKHNGNDGVGGGPGNSADIQLWTVTDGHGFQALRFSKRFTAQHQDLFSNVVTTDQS |
| Ga0307469_113807511 | 3300031720 | Hardwood Forest Soil | NSADIQLWTVSDGHGFQVLQFTKRFTAQHKDLFENTVTSE |
| Ga0318501_108616702 | 3300031736 | Soil | IQLWTVSDGHGFQVLQFTKRFTAQHKDLFENTVTTEQSR |
| Ga0307475_113964431 | 3300031754 | Hardwood Forest Soil | NSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSQ |
| Ga0306925_122256052 | 3300031890 | Soil | LWTVSDGHGFQVLQFTKSFTAQHKDLFENTVTTENSL |
| Ga0308174_111004421 | 3300031939 | Soil | DIQLWTVSDGHGFQVLQFSKSFTAQHKDLFENTVTTEQSE |
| Ga0310810_110505111 | 3300033412 | Soil | GNSADIQLWTVSDGHGFQVLQFSKSFTAQHKDLFANVVTTEQSE |
| ⦗Top⦘ |