NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042467

Metagenome / Metatranscriptome Family F042467

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042467
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 46 residues
Representative Sequence MLVALPVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ
Number of Associated Samples 137
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.95 %
% of genes near scaffold ends (potentially truncated) 90.51 %
% of genes from short scaffolds (< 2000 bps) 87.34 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.684 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.253 % of family members)
Environment Ontology (ENVO) Unclassified
(25.949 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.835 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.65%    β-sheet: 0.00%    Coil/Unstructured: 51.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF00293NUDIX 13.29
PF00296Bac_luciferase 5.06
PF00232Glyco_hydro_1 3.16
PF13410GST_C_2 3.16
PF00440TetR_N 2.53
PF08281Sigma70_r4_2 1.90
PF02190LON_substr_bdg 1.27
PF030614HBT 1.27
PF08241Methyltransf_11 1.27
PF01553Acyltransferase 1.27
PF00144Beta-lactamase 1.27
PF04140ICMT 1.27
PF04978DUF664 1.27
PF03176MMPL 1.27
PF01243Putative_PNPOx 1.27
PF13459Fer4_15 1.27
PF10589NADH_4Fe-4S 1.27
PF00496SBP_bac_5 1.27
PF00582Usp 1.27
PF06831H2TH 0.63
PF07722Peptidase_C26 0.63
PF00392GntR 0.63
PF08450SGL 0.63
PF03241HpaB 0.63
PF05988DUF899 0.63
PF00570HRDC 0.63
PF01764Lipase_3 0.63
PF09350DJC28_CD 0.63
PF13649Methyltransf_25 0.63
PF11716MDMPI_N 0.63
PF01872RibD_C 0.63
PF08044DUF1707 0.63
PF04073tRNA_edit 0.63
PF07690MFS_1 0.63
PF03988DUF347 0.63
PF03773ArsP_1 0.63
PF02894GFO_IDH_MocA_C 0.63
PF13419HAD_2 0.63
PF08546ApbA_C 0.63
PF04149DUF397 0.63
PF13191AAA_16 0.63
PF00958GMP_synt_C 0.63
PF02627CMD 0.63
PF00196GerE 0.63
PF13561adh_short_C2 0.63
PF04122CW_binding_2 0.63
PF04209HgmA_C 0.63
PF12680SnoaL_2 0.63
PF07992Pyr_redox_2 0.63
PF07859Abhydrolase_3 0.63
PF00155Aminotran_1_2 0.63
PF16124RecQ_Zn_bind 0.63
PF04542Sigma70_r2 0.63
PF00578AhpC-TSA 0.63
PF05977MFS_3 0.63
PF01522Polysacc_deac_1 0.63
PF13263PHP_C 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 5.06
COG2723Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidaseCarbohydrate transport and metabolism [G] 3.16
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 1.27
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 1.27
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.27
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.27
COG2367Beta-lactamase class ADefense mechanisms [V] 1.27
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.63
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.63
COG4705Uncharacterized membrane-anchored proteinFunction unknown [S] 0.63
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.63
COG3508Homogentisate 1,2-dioxygenaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.63
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.63
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.63
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.63
COG2368Aromatic ring hydroxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.63
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.63
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.63
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.63
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.63
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.63
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.63
COG0701Uncharacterized membrane protein YraQ, UPF0718 familyFunction unknown [S] 0.63
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.63
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.63
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.63
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.63
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.63
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.68 %
UnclassifiedrootN/A25.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003219|JGI26341J46601_10144918All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300003368|JGI26340J50214_10058966Not Available1043Open in IMG/M
3300005168|Ga0066809_10111153All Organisms → cellular organisms → Bacteria → Terrabacteria group680Open in IMG/M
3300005434|Ga0070709_10233352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1317Open in IMG/M
3300005467|Ga0070706_100111199All Organisms → cellular organisms → Bacteria2549Open in IMG/M
3300005467|Ga0070706_101955052All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300005547|Ga0070693_100758864All Organisms → cellular organisms → Bacteria → Terrabacteria group715Open in IMG/M
3300005610|Ga0070763_10499276Not Available696Open in IMG/M
3300005712|Ga0070764_10025079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2982Open in IMG/M
3300005921|Ga0070766_10087079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae1828Open in IMG/M
3300005921|Ga0070766_10253415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1117Open in IMG/M
3300005921|Ga0070766_10281732Not Available1063Open in IMG/M
3300005983|Ga0081540_1000132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia79179Open in IMG/M
3300006175|Ga0070712_100557043All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300006176|Ga0070765_100582246Not Available1055Open in IMG/M
3300006176|Ga0070765_102276528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura505Open in IMG/M
3300006796|Ga0066665_11132837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300006954|Ga0079219_10651662All Organisms → cellular organisms → Bacteria → Terrabacteria group786Open in IMG/M
3300009012|Ga0066710_102053684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300009038|Ga0099829_10811635Not Available777Open in IMG/M
3300009098|Ga0105245_12408187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia580Open in IMG/M
3300009148|Ga0105243_10234922All Organisms → cellular organisms → Bacteria → Terrabacteria group1628Open in IMG/M
3300009551|Ga0105238_12230513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300009665|Ga0116135_1069488All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300009683|Ga0116224_10561334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300009698|Ga0116216_10197354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300009824|Ga0116219_10271506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria960Open in IMG/M
3300010159|Ga0099796_10273040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300010339|Ga0074046_10000568All Organisms → cellular organisms → Bacteria33932Open in IMG/M
3300010343|Ga0074044_10912606All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010343|Ga0074044_11177230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300010379|Ga0136449_100664679All Organisms → cellular organisms → Bacteria1757Open in IMG/M
3300010379|Ga0136449_101398224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300010401|Ga0134121_10828010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia892Open in IMG/M
3300011120|Ga0150983_11001201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300012198|Ga0137364_10544651Not Available873Open in IMG/M
3300012200|Ga0137382_11321556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae508Open in IMG/M
3300012203|Ga0137399_11642047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300012205|Ga0137362_10830357Not Available791Open in IMG/M
3300012361|Ga0137360_10824604All Organisms → cellular organisms → Bacteria → Terrabacteria group799Open in IMG/M
3300012507|Ga0157342_1015518All Organisms → cellular organisms → Bacteria → Terrabacteria group835Open in IMG/M
3300012683|Ga0137398_10504683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia832Open in IMG/M
3300012975|Ga0134110_10617972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300015053|Ga0137405_1225401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1759Open in IMG/M
3300016341|Ga0182035_10678884Not Available896Open in IMG/M
3300016422|Ga0182039_10143085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1840Open in IMG/M
3300017924|Ga0187820_1304174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300017937|Ga0187809_10240874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300017942|Ga0187808_10012547Not Available3338Open in IMG/M
3300017942|Ga0187808_10562333Not Available530Open in IMG/M
3300017975|Ga0187782_10146726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1754Open in IMG/M
3300017995|Ga0187816_10077333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1415Open in IMG/M
3300018001|Ga0187815_10045953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1840Open in IMG/M
3300018060|Ga0187765_10554161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora735Open in IMG/M
3300018482|Ga0066669_10866991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300020581|Ga0210399_10595151All Organisms → cellular organisms → Bacteria → Terrabacteria group915Open in IMG/M
3300021180|Ga0210396_11428135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300021180|Ga0210396_11506179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura553Open in IMG/M
3300021388|Ga0213875_10395011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300021401|Ga0210393_10781408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia777Open in IMG/M
3300021403|Ga0210397_11347068Not Available554Open in IMG/M
3300021405|Ga0210387_10715529Not Available887Open in IMG/M
3300021445|Ga0182009_10244661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia888Open in IMG/M
3300021474|Ga0210390_11426976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300021477|Ga0210398_11503986Not Available524Open in IMG/M
3300021559|Ga0210409_11481263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300022531|Ga0242660_1109840All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300022557|Ga0212123_10837472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300022717|Ga0242661_1112177All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300024222|Ga0247691_1004499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2456Open in IMG/M
3300025917|Ga0207660_10168854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1692Open in IMG/M
3300025937|Ga0207669_11672455Not Available544Open in IMG/M
3300026214|Ga0209838_1052447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300027050|Ga0209325_1020473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia772Open in IMG/M
3300027058|Ga0209111_1018700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia812Open in IMG/M
3300027096|Ga0208099_1051593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium587Open in IMG/M
3300027504|Ga0209114_1036353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300027575|Ga0209525_1162170Not Available507Open in IMG/M
3300027662|Ga0208565_1140674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300027676|Ga0209333_1191663Not Available541Open in IMG/M
3300027783|Ga0209448_10028041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1873Open in IMG/M
3300027812|Ga0209656_10010666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5791Open in IMG/M
3300027846|Ga0209180_10400981Not Available777Open in IMG/M
3300027853|Ga0209274_10189301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1045Open in IMG/M
3300027855|Ga0209693_10173904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1062Open in IMG/M
3300027867|Ga0209167_10677788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300027884|Ga0209275_10134369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1298Open in IMG/M
3300027884|Ga0209275_10346002Not Available832Open in IMG/M
3300027889|Ga0209380_10375339All Organisms → cellular organisms → Bacteria → Terrabacteria group835Open in IMG/M
3300027895|Ga0209624_11139105Not Available501Open in IMG/M
3300027903|Ga0209488_10089635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2296Open in IMG/M
3300028781|Ga0302223_10205223Not Available650Open in IMG/M
3300028789|Ga0302232_10060090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1996Open in IMG/M
3300028806|Ga0302221_10480181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii542Open in IMG/M
3300028808|Ga0302228_10076659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1582Open in IMG/M
3300028879|Ga0302229_10213316Not Available880Open in IMG/M
3300028879|Ga0302229_10383136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300028906|Ga0308309_10096162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2279Open in IMG/M
3300028906|Ga0308309_10105005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2193Open in IMG/M
3300030399|Ga0311353_11232836Not Available616Open in IMG/M
3300030494|Ga0310037_10274657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300030503|Ga0311370_11092952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300030577|Ga0210260_10293344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii573Open in IMG/M
3300030580|Ga0311355_11273521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300030598|Ga0210287_1153641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300030659|Ga0316363_10370231Not Available561Open in IMG/M
3300030730|Ga0307482_1145393All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300030738|Ga0265462_11346920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii651Open in IMG/M
3300031234|Ga0302325_11387879All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300031236|Ga0302324_100296775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2481Open in IMG/M
3300031474|Ga0170818_108002681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300031474|Ga0170818_109111489Not Available548Open in IMG/M
3300031549|Ga0318571_10110489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia911Open in IMG/M
3300031680|Ga0318574_10254756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1015Open in IMG/M
3300031708|Ga0310686_108797090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2827Open in IMG/M
3300031708|Ga0310686_111144564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300031718|Ga0307474_10530338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes toevensis925Open in IMG/M
3300031718|Ga0307474_11026026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300031719|Ga0306917_11417168Not Available536Open in IMG/M
3300031754|Ga0307475_11244644Not Available578Open in IMG/M
3300031779|Ga0318566_10613797Not Available529Open in IMG/M
3300031780|Ga0318508_1084473Not Available871Open in IMG/M
3300031780|Ga0318508_1145391Not Available672Open in IMG/M
3300031805|Ga0318497_10112497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1468Open in IMG/M
3300031823|Ga0307478_10627394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium branderi899Open in IMG/M
3300031823|Ga0307478_11026823All Organisms → cellular organisms → Bacteria → Terrabacteria group689Open in IMG/M
3300031823|Ga0307478_11227525All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300031832|Ga0318499_10341217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300031945|Ga0310913_11172201Not Available535Open in IMG/M
3300031996|Ga0308176_12925486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300032009|Ga0318563_10293536Not Available879Open in IMG/M
3300032043|Ga0318556_10503401Not Available633Open in IMG/M
3300032054|Ga0318570_10560516Not Available521Open in IMG/M
3300032065|Ga0318513_10608671Not Available535Open in IMG/M
3300032066|Ga0318514_10560685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300032075|Ga0310890_11866013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300032090|Ga0318518_10457506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia654Open in IMG/M
3300032090|Ga0318518_10638286Not Available542Open in IMG/M
3300032421|Ga0310812_10275848All Organisms → cellular organisms → Bacteria → Terrabacteria group744Open in IMG/M
3300032770|Ga0335085_10147351All Organisms → cellular organisms → Bacteria2959Open in IMG/M
3300032805|Ga0335078_10863912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1092Open in IMG/M
3300032828|Ga0335080_11151119All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300032828|Ga0335080_12101888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300032829|Ga0335070_11843555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300032892|Ga0335081_10090750All Organisms → cellular organisms → Bacteria4584Open in IMG/M
3300032895|Ga0335074_10135307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3157Open in IMG/M
3300032896|Ga0335075_10353218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1598Open in IMG/M
3300032898|Ga0335072_11351250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300032898|Ga0335072_11386457Not Available609Open in IMG/M
3300032954|Ga0335083_10012423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10191Open in IMG/M
3300033004|Ga0335084_10540131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1196Open in IMG/M
3300033134|Ga0335073_11799082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia572Open in IMG/M
3300033289|Ga0310914_11328996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300033290|Ga0318519_10076107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Polymorphobacter1754Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.25%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil8.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.23%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.06%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.06%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.43%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.16%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.90%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.27%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.27%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.63%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.63%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.63%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.63%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26341J46601_1014491823300003219Bog Forest SoilVLALGSMLVALPVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ*
JGI26340J50214_1005896633300003368Bog Forest SoilMLVALPVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKH
Ga0066809_1011115313300005168SoilVTAIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0070709_1023335213300005434Corn, Switchgrass And Miscanthus RhizosphereALALGSMLVTLPITAIVLKGSPGVAAIMLMALIWIIIGIINVAYALRKHPQQ*
Ga0070706_10011119913300005467Corn, Switchgrass And Miscanthus RhizosphereALGSMLVALLVTAIVLKGSPGGAAIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0070706_10195505223300005467Corn, Switchgrass And Miscanthus RhizosphereGSMLVALLVTAIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0070693_10075886413300005547Corn, Switchgrass And Miscanthus RhizosphereVALLVTAIVLKGSPGVASIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0070763_1049927623300005610SoilLALGSMLVALPVTAIVLRGSPGFAAIMLMALIWVIVGVINVAYAVRKSPKQ*
Ga0070764_1002507913300005712SoilIGSMLVALPVTAIVLKGSPGVAALMLMALIWVIVGVINVVYATRKPPQATRE*
Ga0070766_1008707913300005921SoilGSMLVALPVTAIVLRGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ*
Ga0070766_1025341513300005921SoilLKGSPGFAAIMLMALIWVIVGVINVAYAVRKNPQP*
Ga0070766_1028173243300005921SoilSPGLAAIMLMALIWVVVGSINVVYAVRKHPQQQQQQ*
Ga0081540_1000132603300005983Tabebuia Heterophylla RhizosphereVLKGSPGLAAVMLMALVWIIVGIINVAHATRKHPRQ*
Ga0070712_10055704313300006175Corn, Switchgrass And Miscanthus RhizosphereIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0070765_10058224623300006176SoilLGSMLVALSVTAIVLRGSPGLAAITLMALIWIIVGIINVAYAMRKHPQR*
Ga0070765_10227652813300006176SoilVTLPVTAIVLKGSPGIAAIMLMALIWVIIGIINVAYAVRKHPQQ*
Ga0066665_1113283723300006796SoilQSIMLGLGSMLVALSVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQE*
Ga0079219_1065166223300006954Agricultural SoilGSMLVALPVTAIVLKGSPGVAAIMLLALVWVIVGIINVAYATRKHPEK*
Ga0066710_10205368413300009012Grasslands SoilMLVALSVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQE
Ga0099829_1081163513300009038Vadose Zone SoilMLVTLPVTAIVLRGSPGVGAIMLMALIWVIVGIINVAYAMRK*
Ga0105245_1240818723300009098Miscanthus RhizosphereLAVGSMLVALLVTAIVLKGSPGVASIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0105243_1023492213300009148Miscanthus RhizosphereMLVALLVTAIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0105238_1223051313300009551Corn RhizosphereQSIMLAVGSMLVALLVTAIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0116135_106948823300009665PeatlandSMLVALAMTAIVLKGSPGFAAILLMALIWLIIGVINVAHAMRKHPPQ*
Ga0116224_1056133413300009683Peatlands SoilTAIVLSGSPGVAAIMLMALVWVIVGIINVACAMRKYPPQ*
Ga0116216_1019735433300009698Peatlands SoilLALGSMLVALSVTAIVLKGSPGIAAIMLMAMIWVIIGVINVAYALRKHPQQQQ*
Ga0116219_1027150613300009824Peatlands SoilSLMLALGSMLVALSVTAIVLKGSPGGAAIMLMALIWVIIGIINVAYAVRKHPQQQ*
Ga0099796_1027304013300010159Vadose Zone SoilAVVLGGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ*
Ga0074046_10000568243300010339Bog Forest SoilMLVALPVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ*
Ga0074044_1091260623300010343Bog Forest SoilIVLRGSPGVAAIMLMALIWVIVGIINVAYAMRKHPPQ*
Ga0074044_1117723013300010343Bog Forest SoilVVLALGSMLVALPVTAIVLRGSPGFAAILLMALIWVIVGAINVVYVMRKHSPQQPPN*
Ga0136449_10066467913300010379Peatlands SoilMLALGSMLVALPVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ*
Ga0136449_10139822413300010379Peatlands SoilMLIALPVTAIVLKGSPGVAAILLMTLIWVIVGIINVAYAMRKHPQQ*
Ga0134121_1082801033300010401Terrestrial SoilKGSPGVAAIMLMALIWVIIGIINVAYAVRKHPQQ*
Ga0150983_1100120123300011120Forest SoilSMLVALVVTAIVLRGSPGFAAITLTALIWTIVGTINVAYALRKHPRQQQQQ*
Ga0137364_1054465113300012198Vadose Zone SoilLPVTAIVLKGSPGGATIMLMALIWIIIGIINVAYAIRKHPQQ*
Ga0137382_1132155613300012200Vadose Zone SoilMLALGSMLVALPVTAIVLNGSPGVAAIMLMALVWIIVGIINVAYATRKHQQQ*
Ga0137399_1164204713300012203Vadose Zone SoilSFALALGSMLVTLPITAIVLKGSPGVAAIMLMSLIWVIIGIINVAYALRKHPQQ*
Ga0137362_1083035733300012205Vadose Zone SoilALGSMLVALSVTAIVLKGSPGVAAIMLMALIWVIVGVINVAYALRK*
Ga0137360_1082460413300012361Vadose Zone SoilKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ*
Ga0157342_101551813300012507Arabidopsis RhizosphereLGSMLVALPVTAIVLSGSPGVAAIMLMALVWIIVGTINVAYATRKHPQQ*
Ga0137398_1050468313300012683Vadose Zone SoilGSMLVALSVTAIVLKGSPGVAAIMLMALICVIVGIINVVYAMRKHPQQ*
Ga0134110_1061797223300012975Grasslands SoilSVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQE*
Ga0137405_122540113300015053Vadose Zone SoilLQSIMPAVGSMLVALSVTAIVLKGSPGVAAIMLMALIWIIVGIINVAYVMRKHPQ*
Ga0182035_1067888423300016341SoilALGSMLVALSVTAIVLKGSPGVAALMLMALIWVIVGIINVAYATRKQPEQ
Ga0182039_1014308513300016422SoilGRQSLVLALGCVLVGMPVTAIVLKGSPGVTAIMLMALIWIIVGIINVAHAMRKHPHQ
Ga0187820_130417413300017924Freshwater SedimentMLVALAVTGIVLRGSPGIADLMLMAMIWVIIGIINVAYALRRHPQRQQE
Ga0187809_1024087413300017937Freshwater SedimentIMLAVGSMLVALLVTAIVLKGSPGVAAIMLMALIWIIVGIINVAYATRKHPQQ
Ga0187808_1001254723300017942Freshwater SedimentALALGSMLVALSVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKYPQQ
Ga0187808_1056233313300017942Freshwater SedimentALGSMLVALAVTAIVLKGSPGLAAIMLMAFIWVIVGVINVAYAMHKHPQQ
Ga0187879_1028809313300017946PeatlandFALAAGSVLVALPMTVIVLAHSPGFAAIMLMALIWVIIGVMNVTHVMHKNPPR
Ga0187782_1014672613300017975Tropical PeatlandLSVTAIVLKGSPGIAAIMLMALIWVIIGVINVAYAMRKHLQP
Ga0187816_1007733313300017995Freshwater SedimentIVLKGSPGVANIMLMALIWVIIGAVNVVYALRKHIQQQQQP
Ga0187815_1004595323300018001Freshwater SedimentSMLVALSVTVIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKYPQQ
Ga0187765_1055416123300018060Tropical PeatlandLPVTAIVLKGSPGMAAITLMALIWVIIGIINVAYTVRKPPQQ
Ga0066669_1086699123300018482Grasslands SoilVTLPVTAIVLKGSPGVAAIMLMALIWVIIGIINVAYAVRKHPQQ
Ga0210399_1059515113300020581SoilMLVALLVTAIVLKGSPGGAAVMLMALVWIIVGIINVAYATRKHPQQ
Ga0210396_1142813523300021180SoilLGSMLVTLPITAIVLKGSPGVAAIMLMALIWIIIGIINVAYAIRKHPQQ
Ga0210396_1150617923300021180SoilRQSLALALGSMLVALPVTAIVLGGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ
Ga0213875_1039501123300021388Plant RootsQSTLLALGSMVVALLVTLVVLKNQPGGAAMMLTALIWGIIGVINLAYATRKPPRE
Ga0210393_1078140823300021401SoilLGSMLVTLPVTAIVLKGSPGFAAIMLMALIWVIVGVINVAYAVRKNPQP
Ga0210397_1134706813300021403SoilGSMLVALSVTAIVLKGSPGGASITLMALIWVIIGVINVAYAMRKQQ
Ga0210387_1071552923300021405SoilGSMLVALSVTAIVLKGSPGGAAIMLMGLIWVIIGVVNVAYAIRKQQQ
Ga0182009_1024466113300021445SoilVTAIVLNGSPGVAAIMLLALVWIIVGIINVAYATRKHPQQ
Ga0210390_1142697613300021474SoilALTLGSMLVALAVTAIVLKGSPGFAAITLMALIWVIVGAVNVAYAMRKHPAAVEPSRPGR
Ga0210398_1150398623300021477SoilGWQSIMLALGSMLVALSVTAIVLGGSPGLAAITLMALIWIIVGIINVAYAMRKHPQR
Ga0210409_1148126313300021559SoilSMLVTLPVTTIVLKGSPGFAAIMLMALIWVIVGIINVAYAVRKSPQQ
Ga0242660_110984023300022531SoilALALGSMLVALPVTAIVLGGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ
Ga0212123_1083747233300022557Iron-Sulfur Acid SpringLGSMVVALPVTAIVLRGSPGVAAVMLMALIWVIVGIINVAYALRKHPQQQ
Ga0242661_111217723300022717SoilPVTAILLRGSPGFAAVMLTALIWVIVGVINVAYAVRGHPQR
Ga0247691_100449953300024222SoilVALLVTAIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ
Ga0207660_1016885413300025917Corn RhizosphereITLAVGSMLVALLVTAIVLKGSPGVASIMLMALVWIIVGIINVAYATRKHPQQ
Ga0207644_1167747913300025931Switchgrass RhizosphereAVGHSGGASIMLMALVWVIIGIINVVYIGRKPPPQ
Ga0207669_1167245523300025937Miscanthus RhizosphereAVGSMLVALLVTAIVLKGSPGVASIMLMALVWIIVGIINVAYATRKHPQQ
Ga0209838_105244723300026214SoilMVAIGSMLIALVVTAIVLNGSPGVAAFMLTAMIWVIIGIINVVYAVRKHPQQEPRALP
Ga0209325_102047313300027050Forest SoilVTLPVTAIVLKGSPGVAAIMLMGLIWVIVGIINVAYATRKHPQQ
Ga0209111_101870013300027058Forest SoilTAIVLNSAPGVAAVMLMALVWVIVGVINVAHALRRRPQE
Ga0208099_105159313300027096Forest SoilIVLKGSPGVAAIMLMALIWVIVGIINVAYAVRKQPQQ
Ga0209114_103635323300027504Forest SoilLVTIVTLHGSPGAAAIMLTALIWVIVGIINVAYTLRRPPRP
Ga0209525_116217013300027575Forest SoilTAVVLKGSPGFAALLLMALIWVIVGVINVAYALRKQPQP
Ga0208565_114067433300027662Peatlands SoilVTVIVLKGFPGVAAILLMTLIWVIVGIINVAYAMRKHPQQ
Ga0209333_119166313300027676Forest SoilAIGSMLVALPITAIVLKGSPGVAALMLMALIWVIVGVINVVHATRKQPQPQPPH
Ga0209448_1002804113300027783Bog Forest SoilVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYARRKHPQQ
Ga0209656_1001066673300027812Bog Forest SoilLVLALGSMLVALPVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ
Ga0209180_1040098133300027846Vadose Zone SoilMLVTLPVTAIVLRGSPGVGAIMLMALIWVIVGIINVAYAMRK
Ga0209274_1018930113300027853SoilLAVTAIVLKGSPGFAAITLMALVWVIVGAVNVAYAMRKHPQP
Ga0209693_1017390413300027855SoilMLVALPVTAIVLRGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ
Ga0209167_1067778823300027867Surface SoilGIVLRGSPGIADLMLMAMIWVIIGIINVAYALRRHPQRQQE
Ga0209275_1013436943300027884SoilVTAIVLKGSPGLAAIMLMALIWVVVGSINVVYAVRKHPQQQQQQ
Ga0209275_1034600213300027884SoilIGSMLVALLVTAIVLKGSPGVAAIMLMALIWVIVGVINVVYAQRKHPQQQ
Ga0209380_1037533923300027889SoilLKGSPGFAAIMLMALIWVIVGIINVAYAVRKNPQP
Ga0209624_1113910523300027895Forest SoilLVALSVTAVVLKGSPGFAALLLMALIWVIVGAINVAHALQKHPPQ
Ga0209488_1008963533300027903Vadose Zone SoilQSFALALGSMLVTLPITAIVLKGSPGVAAIMLMSLIWVIIGIINVAYALRKHPQQ
Ga0302223_1020522323300028781PalsaGSMLVALPVTAIVLKGSPGGAAIMLMAVIWVVVGIINVAYIMRKQATRE
Ga0302232_1006009013300028789PalsaSGSPGVAAFMLTAMIWVIIGIVNVVYAVRKHPQPRSLP
Ga0302221_1048018113300028806PalsaMLVALPVTAIVLRGSPGVAAIMLMALIWVIVGVINVAYAMRKVPHQ
Ga0302228_1007665923300028808PalsaTFALALGSMLVALAVTAIVFKGSPGVAAVMLMALIWVIVGVINVAYAMRKVPHQ
Ga0302229_1021331623300028879PalsaPITAIVLKGSPGIAALMLMALIWVIVGVINVVCATRKQVPPQ
Ga0302229_1029501523300028879PalsaPGVAALVLMALIWVIVGVINVVYATRKQQQPQPPQ
Ga0302229_1038313613300028879PalsaVLNGSPGVAAFMLIAMIWVIIGIINVVYAVRKHPQQEPRSLP
Ga0308309_1009616223300028906SoilLVALPVTAIVLKGSPGVAALMLMALIWVIVGVINVVYATRKPPQATRE
Ga0308309_1010500543300028906SoilLGSMLVALPVTAIVLRGSPGFAALLLMALIWVIVGAINVAYALRKHPHATETSRPGR
Ga0311340_1034242423300029943PalsaGSPGVAALVLMALIWVIVGVINVVYATRKQQQPQPPQ
Ga0311353_1123283613300030399PalsaVALPITAIVLKGSPGIAALMLMALIWVIVGVINVVCATRKQVPPQ
Ga0310037_1027465723300030494Peatlands SoilLGSMLVALPVTAIVLSGSPGVAAIMLMALVWVIVGIINVACAMRKYPPQ
Ga0311370_1109295233300030503PalsaIALLVTAIVLSGSPGVAAFMLTAMIWVIIGIVNVVYAVRKHPQPRSLP
Ga0210260_1029334413300030577SoilYFKFFFLSMTAIVFKGSPGFAAIMLMALIWVIVGVINVAYAMRKVPQQ
Ga0311355_1127352133300030580PalsaLVVTAIVLNGSPGVAAFMLIAMIWVIIGIINVVYAVRKHPQQEPRSLP
Ga0210287_115364123300030598SoilMLVALPITAIVLRGSPGVAAIMLMALIWVIVGIINVAYAVRKDPQQ
Ga0316363_1037023113300030659Peatlands SoilALSVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKSPQQ
Ga0307482_114539313300030730Hardwood Forest SoilVALPVTAIVLRGSPGFAAILLMAMIWIIVGVINVAHAMRKSPPQKTP
Ga0265462_1134692013300030738SoilQTFALGLGSMLVALAVTAIVFKGSPGFAAIMLMALIWVIVGIINVAYAVRKDPQQ
Ga0302325_1138787913300031234PalsaPGIAAIMLIAVIWVIVGIINVANIMRKHPQQYPPQAKL
Ga0302324_10029677533300031236PalsaMLVALTVTAIVFKGSPGIAAIMLMALIWVIVGIVNVAHALRKYPRQ
Ga0170818_10800268113300031474Forest SoilLVLALGSMLVALPVTAIVLGGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQQ
Ga0170818_10911148923300031474Forest SoilVLKGSPGGAAVMLMAVIWVIVGIINVAYAVRKHPQQQQE
Ga0318571_1011048933300031549SoilMLALGSMLVALPVTAIVLKGSPGVTAIMLMALIWIIVGIINVAHAMRKHPHQ
Ga0318574_1025475633300031680SoilSMLVALSVTAIVLKGSPGVAALMLMALIWVIVGIINVAYATRKPPEQ
Ga0310686_10879709043300031708SoilVVTAIVLRGAPGVAAIMLMALIWVIVGGINVAYAMRKYPPQ
Ga0310686_11114456413300031708SoilVTAIVLKGSPGIAAIMLMAMIWVIIGVINVAYALRKHPQQ
Ga0307474_1053033813300031718Hardwood Forest SoilVLKGSPGVASLMLMALIWVIVGVINVTHAVRKHPQQ
Ga0307474_1102602613300031718Hardwood Forest SoilIVLKGSPGFAAIMLMALIWVIVGVINVAYAVRKNPQP
Ga0306917_1141716813300031719SoilVTAIVLRGAPGVAAIMLMALIWVIVGIINVAYAMRKHPDQ
Ga0307475_1124464413300031754Hardwood Forest SoilHSLVLGLGSMLVALPVTAVVLRGSPGFAAITLMALIWVIVGIVNVAYAVRKSPER
Ga0318566_1061379723300031779SoilSPGVAAIMLMALIWVVVGIINVAYAVLKHPNAGSG
Ga0318508_108447313300031780SoilVMLALGSMLVALSVTAIVLKGSPGGAAIMLMALIWVIVGTINVAYAMRKHPDQ
Ga0318508_114539113300031780SoilAFGSMLVALSVTAIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQ
Ga0318497_1011249713300031805SoilGSMLVALSVTAIVLKGSPGVAALMLMALVWVIVGIINVAYATRKPSEQ
Ga0307478_1062739413300031823Hardwood Forest SoilMLVALLVTAIVLKGSPGFAAIMLMALIWIIVGGINVAYATRKHSQP
Ga0307478_1102682313300031823Hardwood Forest SoilGSMLVALLVTAIVLKGSPGVAAIMLMALIWIIVGIINVAYATRKHPQQ
Ga0307478_1122752523300031823Hardwood Forest SoilVLRGSPGFAAILLMALIWVIVGVINVAYAMRKSPPQKTP
Ga0318499_1034121723300031832SoilIVLKGSPGVAAIMLMGLIWVIVGIINVAYAMRRHPRDAASPR
Ga0310913_1117220113300031945SoilVALSVTAIVLKGSPGVAALMLMALVWVIVGIINVAYATRKQPEQ
Ga0308176_1292548613300031996SoilLALGSMLVALPVTAIALSGSPGVAAIMLLALVWIIVGIINVAYATRKHPQQ
Ga0318563_1029353623300032009SoilLALGSMLVALSVTAIVLKGSPGVAAIMLMALIWVVVGIINVAYAVLKHPNAGSG
Ga0318556_1050340113300032043SoilLKGSPGVAALMLMALIWVIVGIINVAYATRKPPEQ
Ga0318570_1056051613300032054SoilIVLKGSPGVAAIMLMALIWVIVGIINVAYAMRKHPQ
Ga0318513_1060867113300032065SoilSVTAIVLKGSPGVAAIMLMALIWVVVGIINVAYAVLKHPNAGSG
Ga0318514_1056068513300032066SoilILAVGSMLVVLPVTAIVLKGSPGVAAIMLMGLIWVIVGIINVAYAMRRHPRDAASPR
Ga0310890_1186601313300032075SoilMLVALLVTAIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ
Ga0318518_1045750623300032090SoilSVMLALGSMLVALPVTAIVLRGAPGVAAIMLMALIWVIVGIINVAYAMRKHPDQ
Ga0318518_1063828623300032090SoilSMLVALSVTAIVLKGSPGVAAIMLMALIWVVVGIINVAYAVLKHPNAGSG
Ga0310812_1027584823300032421SoilALGSMLVALPVTAIVLKGSPGVAAIMLMALVWIIVGIINVAYATRKHPQQ
Ga0335085_1014735143300032770SoilMLALGSMLVALPVTAIVLTGSPGVAAIMLMGLIWAIVGIINVAYAMRNGRR
Ga0335078_1086391223300032805SoilVTAIVLKGSPGGSSIVLMALVWVIVGIINVAYAVRNHPQQKPPQ
Ga0335080_1115111913300032828SoilVTAIVLNGSPSVAAIMLMALIWVIVGIINVTYAMRKPPHQ
Ga0335080_1210188823300032828SoilMLVALPVTAVVLNGSPGLAAITLTALIWVIIGIINVAYAMRKHPQP
Ga0335070_1184355513300032829SoilMLVALSVTAIVLRGSPGVAAIMLMALIWVIVGIINVAYAMRKHPDQ
Ga0335081_1009075063300032892SoilLKGSPSVAAIILMALIWVIVGIINAAYAMRKHPQQ
Ga0335074_1013530713300032895SoilALLVTAIVLKGSPGVAAIMLMAMIWVIVGIINVVYAQRKHPQQ
Ga0335075_1035321833300032896SoilIVLKGSPGFAAIMLMALIWIIIGGINVAYAMRKHSQP
Ga0335072_1135125023300032898SoilTIMLALGSMLVALLVTAIVLKGSPGFAAIMLMALIWIIIGGINVAYAMRKHSQP
Ga0335072_1138645713300032898SoilALLVTAIVLKGSPGGAAIMLMALIWVIVGIINVAYATRKGPPPPAA
Ga0335083_1001242313300032954SoilSFLVTAIVLKGSPGGASIVLMALVWVIVGIINVAYAVRKHPSQ
Ga0335084_1054013133300033004SoilMLALGSMLVALPVTAIVLTGSPGVAAIMLMGLIWVIVGIINVAYAIRNGRH
Ga0335073_1179908223300033134SoilAIVLKGSPGVASIMLMALIWIIVGIINVAYATRKHPQQ
Ga0310914_1132899613300033289SoilLPVTAIVLKGSPGVTAIMLMALIWIIVGIINVAHAMRKHPHQ
Ga0318519_1007610713300033290SoilLVALSVTAIVLKGSPGVAAIMLMALIWVVVGIINVAYAVLKHPNAGSG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.