Basic Information | |
---|---|
Family ID | F042396 |
Family Type | Metagenome |
Number of Sequences | 158 |
Average Sequence Length | 49 residues |
Representative Sequence | MRNLLIGLVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGNR |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 158 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 49.37 % |
% of genes near scaffold ends (potentially truncated) | 32.28 % |
% of genes from short scaffolds (< 2000 bps) | 87.34 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.810 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.456 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.797 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.722 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 5.19% Coil/Unstructured: 51.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 158 Family Scaffolds |
---|---|---|
PF04366 | Ysc84 | 53.80 |
PF11127 | DUF2892 | 1.90 |
PF06210 | DUF1003 | 1.90 |
PF00326 | Peptidase_S9 | 1.90 |
PF09994 | DUF2235 | 1.90 |
PF13229 | Beta_helix | 1.27 |
PF14592 | Chondroitinas_B | 1.27 |
PF11138 | DUF2911 | 0.63 |
PF02754 | CCG | 0.63 |
PF12697 | Abhydrolase_6 | 0.63 |
PF02637 | GatB_Yqey | 0.63 |
PF13365 | Trypsin_2 | 0.63 |
PF01641 | SelR | 0.63 |
PF13683 | rve_3 | 0.63 |
PF07859 | Abhydrolase_3 | 0.63 |
PF12704 | MacB_PCD | 0.63 |
COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
---|---|---|---|
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 53.80 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 1.90 |
COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.63 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.63 |
COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 0.63 |
COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.63 |
COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.81 % |
Unclassified | root | N/A | 15.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig573118 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300000956|JGI10216J12902_103807780 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300000956|JGI10216J12902_104554364 | Not Available | 502 | Open in IMG/M |
3300000956|JGI10216J12902_106958883 | Not Available | 598 | Open in IMG/M |
3300000956|JGI10216J12902_115261568 | Not Available | 559 | Open in IMG/M |
3300004022|Ga0055432_10062679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300004114|Ga0062593_102219841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300005093|Ga0062594_100703746 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300005205|Ga0068999_10081064 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005328|Ga0070676_10371385 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300005331|Ga0070670_100007349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9350 | Open in IMG/M |
3300005333|Ga0070677_10054455 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300005333|Ga0070677_10104843 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300005334|Ga0068869_100194719 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300005334|Ga0068869_101019947 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005337|Ga0070682_101481245 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005338|Ga0068868_100760991 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300005340|Ga0070689_100151405 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
3300005353|Ga0070669_100053549 | All Organisms → cellular organisms → Bacteria | 2954 | Open in IMG/M |
3300005353|Ga0070669_100107118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2117 | Open in IMG/M |
3300005353|Ga0070669_101402998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300005354|Ga0070675_100450016 | Not Available | 1155 | Open in IMG/M |
3300005364|Ga0070673_100126961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2135 | Open in IMG/M |
3300005364|Ga0070673_100440089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
3300005438|Ga0070701_10938278 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300005455|Ga0070663_100007772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6550 | Open in IMG/M |
3300005459|Ga0068867_100925271 | Not Available | 786 | Open in IMG/M |
3300005466|Ga0070685_11287527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300005471|Ga0070698_102000932 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005543|Ga0070672_101006630 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300005564|Ga0070664_100337679 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300005617|Ga0068859_100333885 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300005617|Ga0068859_100738055 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300005618|Ga0068864_101244329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300005618|Ga0068864_102689624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
3300005719|Ga0068861_100493062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
3300005719|Ga0068861_101417466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300005840|Ga0068870_10035743 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
3300005840|Ga0068870_10224393 | Not Available | 1152 | Open in IMG/M |
3300005841|Ga0068863_102675528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300006046|Ga0066652_101831479 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006237|Ga0097621_100313698 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300006358|Ga0068871_102214569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300006755|Ga0079222_12352720 | Not Available | 533 | Open in IMG/M |
3300006880|Ga0075429_100997631 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300006881|Ga0068865_101041263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
3300006894|Ga0079215_10046852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1653 | Open in IMG/M |
3300006918|Ga0079216_11397142 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300007076|Ga0075435_100860169 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300009094|Ga0111539_11350650 | Not Available | 827 | Open in IMG/M |
3300009094|Ga0111539_12111021 | Not Available | 654 | Open in IMG/M |
3300009098|Ga0105245_11902812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300009100|Ga0075418_10321466 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
3300009100|Ga0075418_12763203 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300009148|Ga0105243_12978779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300009162|Ga0075423_11784523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300009177|Ga0105248_10812170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
3300009610|Ga0105340_1023465 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
3300010376|Ga0126381_102166692 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300010399|Ga0134127_12744538 | Not Available | 572 | Open in IMG/M |
3300010403|Ga0134123_13222094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300011438|Ga0137451_1245431 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300012041|Ga0137430_1122399 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300012212|Ga0150985_117856028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2091 | Open in IMG/M |
3300012891|Ga0157305_10080417 | Not Available | 766 | Open in IMG/M |
3300012892|Ga0157294_10196468 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300013308|Ga0157375_12204558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300013308|Ga0157375_12651804 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300014325|Ga0163163_10842184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300014326|Ga0157380_10001264 | All Organisms → cellular organisms → Bacteria | 16407 | Open in IMG/M |
3300014326|Ga0157380_10333926 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300014969|Ga0157376_11194965 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300015374|Ga0132255_100058375 | All Organisms → cellular organisms → Bacteria | 5068 | Open in IMG/M |
3300017792|Ga0163161_10183930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1604 | Open in IMG/M |
3300017965|Ga0190266_10131844 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300017965|Ga0190266_10181614 | Not Available | 984 | Open in IMG/M |
3300017965|Ga0190266_10368079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300017965|Ga0190266_10670740 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300018083|Ga0184628_10003747 | All Organisms → cellular organisms → Bacteria | 7242 | Open in IMG/M |
3300018083|Ga0184628_10612911 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300018469|Ga0190270_10003819 | All Organisms → cellular organisms → Bacteria | 7605 | Open in IMG/M |
3300018469|Ga0190270_10479960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
3300018469|Ga0190270_10616256 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300018469|Ga0190270_11509281 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300018476|Ga0190274_10749834 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300018476|Ga0190274_11497922 | Not Available | 766 | Open in IMG/M |
3300018476|Ga0190274_12398214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300018476|Ga0190274_12759173 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300018476|Ga0190274_13206073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300018476|Ga0190274_13533589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300018481|Ga0190271_10020838 | All Organisms → cellular organisms → Bacteria | 5048 | Open in IMG/M |
3300018481|Ga0190271_11014107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 954 | Open in IMG/M |
3300018481|Ga0190271_12394056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300018481|Ga0190271_13177910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300019361|Ga0173482_10090667 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300019361|Ga0173482_10405493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300021082|Ga0210380_10349974 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300021445|Ga0182009_10511945 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300022756|Ga0222622_10329482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
3300022908|Ga0247779_1182649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300022915|Ga0247790_10121799 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300023269|Ga0247773_1221159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300025893|Ga0207682_10239209 | Not Available | 843 | Open in IMG/M |
3300025899|Ga0207642_10040550 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
3300025903|Ga0207680_11041293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300025908|Ga0207643_10510241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 769 | Open in IMG/M |
3300025908|Ga0207643_10860657 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300025908|Ga0207643_10907927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 571 | Open in IMG/M |
3300025920|Ga0207649_11187180 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300025924|Ga0207694_11538926 | Not Available | 561 | Open in IMG/M |
3300025925|Ga0207650_10028363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4013 | Open in IMG/M |
3300025926|Ga0207659_10940384 | Not Available | 743 | Open in IMG/M |
3300025926|Ga0207659_11621088 | Not Available | 552 | Open in IMG/M |
3300025926|Ga0207659_11716461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300025927|Ga0207687_11028798 | Not Available | 706 | Open in IMG/M |
3300025936|Ga0207670_10568659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14 | 928 | Open in IMG/M |
3300025936|Ga0207670_11495460 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300025937|Ga0207669_10204231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
3300025937|Ga0207669_10493133 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300025938|Ga0207704_11274606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300025940|Ga0207691_10069204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3189 | Open in IMG/M |
3300025940|Ga0207691_10191868 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
3300025940|Ga0207691_10291893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
3300025941|Ga0207711_10571131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
3300025941|Ga0207711_12022540 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300025942|Ga0207689_10665121 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300025942|Ga0207689_10832423 | Not Available | 779 | Open in IMG/M |
3300025944|Ga0207661_11105282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300025960|Ga0207651_10476364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
3300026023|Ga0207677_11029826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300026067|Ga0207678_10063658 | All Organisms → cellular organisms → Bacteria | 3169 | Open in IMG/M |
3300026075|Ga0207708_11241358 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300026118|Ga0207675_100503534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
3300026118|Ga0207675_100988658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
3300027533|Ga0208185_1055402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
3300027886|Ga0209486_10000760 | All Organisms → cellular organisms → Bacteria | 14150 | Open in IMG/M |
3300027907|Ga0207428_11272407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300028380|Ga0268265_10588759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
3300028381|Ga0268264_10318349 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300028812|Ga0247825_10575309 | Not Available | 806 | Open in IMG/M |
3300030620|Ga0302046_10061815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3041 | Open in IMG/M |
3300031538|Ga0310888_10476360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300031852|Ga0307410_12005813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 516 | Open in IMG/M |
3300031903|Ga0307407_11708440 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031908|Ga0310900_10278964 | Not Available | 1218 | Open in IMG/M |
3300031908|Ga0310900_11813717 | Not Available | 519 | Open in IMG/M |
3300031911|Ga0307412_10413260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1102 | Open in IMG/M |
3300031911|Ga0307412_10831485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300031911|Ga0307412_11720389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300031940|Ga0310901_10138869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
3300032002|Ga0307416_101457989 | Not Available | 790 | Open in IMG/M |
3300032005|Ga0307411_12272101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300032075|Ga0310890_11851571 | Not Available | 502 | Open in IMG/M |
3300032144|Ga0315910_10904602 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300032157|Ga0315912_10057567 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
3300032157|Ga0315912_10253900 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300032205|Ga0307472_100778523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 871 | Open in IMG/M |
3300032205|Ga0307472_101180566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 730 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 9.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 8.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.06% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.80% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.53% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.27% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.27% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.27% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.27% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.27% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023269 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L092-311B-6 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_00127020 | 2124908045 | Soil | MRNALLGLVLAIGLALALSPVTIAGIAAWKIVLAAVGAVLVMTAGRGSTSGPAAP |
JGI10216J12902_1038077802 | 3300000956 | Soil | MRNVVTGLVLAAALALAVSPATVAGIDAWKIVLAVVGAFVFVTAGSRKPT* |
JGI10216J12902_1045543641 | 3300000956 | Soil | MRNALLGLVLAIGLALALSPATIGGIAAWKIVLAAFGAVLVVTAGRGSTSG |
JGI10216J12902_1069588833 | 3300000956 | Soil | ALALSPVTIAGIAAWKVVLAAFGAVLVVTAGRGEKAGPTRPPG* |
JGI10216J12902_1152615682 | 3300000956 | Soil | MRNALLGLALAIGLALALSPLTIAGIDAWKIVLAAAGALLFVTAGNKKSSGKSGG* |
Ga0055432_100626792 | 3300004022 | Natural And Restored Wetlands | MKNLAIGLVVAVALALALSPVTIAGIAAWKIVLAAFGALLVVTASGRSGGESGR* |
Ga0062593_1022198412 | 3300004114 | Soil | MRNLLIGVGLAGALALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRSPS* |
Ga0062594_1007037462 | 3300005093 | Soil | MRNLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGEKVK* |
Ga0068999_100810642 | 3300005205 | Natural And Restored Wetlands | MRNLVIGLVVAATLALAASPATIAGIAVWKIVLAAFGAVLVVTAGRGNTPTRPT* |
Ga0070676_103713852 | 3300005328 | Miscanthus Rhizosphere | MRNLLIGSALAGALALAASPVTIAGIDAWKIVLAAAGLVLFVTAGRGRAPSA* |
Ga0070670_10000734910 | 3300005331 | Switchgrass Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRPT* |
Ga0070677_100544552 | 3300005333 | Miscanthus Rhizosphere | MRNLLIGIVVAAALALAVSPVRIAGIDAWKIVLAVVGAVLVVTAGRGTPTRPT* |
Ga0070677_101048432 | 3300005333 | Miscanthus Rhizosphere | MRNLVMGVVLAAALALAMSPARIAGIDAWKILLAAVGAFLVVTAGRGSADKPT* |
Ga0068869_1001947192 | 3300005334 | Miscanthus Rhizosphere | MRNALIGILLAGAIALAASPARIAGIDAWKIVLAAIGAVLVVTAGRSGKVG* |
Ga0068869_1010199472 | 3300005334 | Miscanthus Rhizosphere | MKNVAMGLAIAVALALSASPLTVAGIAAWKIVLAAVGAVLVVTANRPGRPTGPA* |
Ga0070682_1014812452 | 3300005337 | Corn Rhizosphere | AALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGEKVK* |
Ga0068868_1007609912 | 3300005338 | Miscanthus Rhizosphere | MRNLLMGLVLAAALALAASPVRVAGIDAWKIVLAAIGAVLVVTAGRSGKVG* |
Ga0070689_1001514053 | 3300005340 | Switchgrass Rhizosphere | MGVVLAAALALAMSPARIAGIDAWKIVLAAVGAFLVVTAGRGSADKPT |
Ga0070669_1000535493 | 3300005353 | Switchgrass Rhizosphere | MRNLLIGLALAAALALALSPVRVAGIDAWKIVLAAIGAVLVVTAGRSTSGPSAP* |
Ga0070669_1001071182 | 3300005353 | Switchgrass Rhizosphere | MRNLVMGVVLAAALALAMSPARIAGIDAWKIVLAAVGAFLVVTAGRGSADKPT* |
Ga0070669_1014029982 | 3300005353 | Switchgrass Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGTPTRPT* |
Ga0070675_1004500163 | 3300005354 | Miscanthus Rhizosphere | VIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRPN* |
Ga0070673_1001269612 | 3300005364 | Switchgrass Rhizosphere | MKNVVMGLVIAAALAISASPLTIAGIAAWKIVLAAVGAVLVVTANRGQVNK* |
Ga0070673_1004400892 | 3300005364 | Switchgrass Rhizosphere | VAVALALAASPITVAGIDAWKIVLAGAGFVLFATAGRGRTPSP* |
Ga0070701_109382781 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVVLAAALALAMSPARIAGIDAWKILLAAVGAFLVVTAGRGSADKPT* |
Ga0070663_1000077722 | 3300005455 | Corn Rhizosphere | MRNAVIGFVLAGALALALSPVTIVGIDAWKIVLGIVGAFLVVTAGRENKAG* |
Ga0068867_1009252711 | 3300005459 | Miscanthus Rhizosphere | ALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGTPTRPT* |
Ga0070685_112875271 | 3300005466 | Switchgrass Rhizosphere | MGVVLAAALALAMSPARIAGIDAWKIVLAAVGAFLVVTAGRGSADKPT* |
Ga0070698_1020009321 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNALIGILLAGAIALAASPARIAGIDAWKIVLAAVGAVLVVTAGRGNRVG* |
Ga0070672_1010066302 | 3300005543 | Miscanthus Rhizosphere | MGLVVAAALALAVSPVRIAGIDAWKIVLAVIGAVLVVTAGRGSTPTRPT* |
Ga0070664_1003376792 | 3300005564 | Corn Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRPN* |
Ga0068859_1003338853 | 3300005617 | Switchgrass Rhizosphere | MGLVVAAALALAVSPVRIAGIDAWKIVLAAVGAVLVVTAGRNPARPT* |
Ga0068859_1007380552 | 3300005617 | Switchgrass Rhizosphere | MKNAAIGLVIAGAIALAMSPITIAGIAAWKIVLAAVGAVLVVTAGRNR* |
Ga0068864_1012443292 | 3300005618 | Switchgrass Rhizosphere | MGLVVAAALALAVSPVRIAGIDAWKIVLAALGAVLVVTAGRGSTPTRPT* |
Ga0068864_1026896242 | 3300005618 | Switchgrass Rhizosphere | MKNAVIGLAIAGGLALALSPIVIAGVAAWKIVLAAAGAVLVVTAGRDKVK* |
Ga0068861_1004930622 | 3300005719 | Switchgrass Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGNR* |
Ga0068861_1014174661 | 3300005719 | Switchgrass Rhizosphere | ALALAASPVTVAGIDAWKIVLAAGGFVLFATAGRGRSPSA* |
Ga0068870_100357434 | 3300005840 | Miscanthus Rhizosphere | SMRNLVMGVVLAAALALAMSPARIAGIDAWKILLAAVGAFLVVTAGRGSADKPT* |
Ga0068870_102243931 | 3300005840 | Miscanthus Rhizosphere | AAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRPN* |
Ga0068863_1026755282 | 3300005841 | Switchgrass Rhizosphere | MGLVVAAALALAVSPVRIAGIDAWKIVLAVIGAVLVVTAGRGS |
Ga0066652_1018314792 | 3300006046 | Soil | RSMRNLGIGIVLAAALALAMSPARIAGIDAWKIVLAVIGAVLVVTAGRGTPSRPT* |
Ga0097621_1003136983 | 3300006237 | Miscanthus Rhizosphere | MRNLVIGIVLAAALAFAVSPARIVGIDAWKIVLAAIGAVLVVTAGRGTPTRPT* |
Ga0068871_1022145691 | 3300006358 | Miscanthus Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVT |
Ga0079222_123527202 | 3300006755 | Agricultural Soil | MKNLAIGLVAAAALALALSPLTIAGIDAWKIVLAVFGAVLVVTAGRGNKVR* |
Ga0075429_1009976312 | 3300006880 | Populus Rhizosphere | MRNLLIGVGLAGALALAASPVTVAGIDAWKIVLAAAGFVLFSTAGRGRAPSA* |
Ga0068865_1010412632 | 3300006881 | Miscanthus Rhizosphere | MGVVLAAALALAMSPARIAGIDAWKILLAAVGAFLVVTAGRGGADKPT* |
Ga0079215_100468521 | 3300006894 | Agricultural Soil | MRNVLVGVVLAAGLALALSPLTIAGIDAWKIVLAAGGAFLFVTAGRGSKVR* |
Ga0079216_113971422 | 3300006918 | Agricultural Soil | MRNVVTGLVLAAALALAVSPATIAGIDAWKIVLAVVGALVFVTAGSRKPT* |
Ga0075435_1008601692 | 3300007076 | Populus Rhizosphere | MKNGAMGLLVAAAIAIALSPITIAGIAAWKIVLAAVGAVLVVTAGRPTSFP* |
Ga0111539_113506502 | 3300009094 | Populus Rhizosphere | LAAALALAAAPVTIAGIDAWKIGPGAAGLVLFVTAGRGRAPSA* |
Ga0111539_121110212 | 3300009094 | Populus Rhizosphere | MRNALLGLVLAIGLALALSPVTIAGIAAWKIVLAAFGVVLVVTAGRGEKARPTRPPG* |
Ga0105245_119028121 | 3300009098 | Miscanthus Rhizosphere | MRNLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGDKVK* |
Ga0075418_103214662 | 3300009100 | Populus Rhizosphere | MRNLAIGVVIAAALALALSPLTIAGIDAWKIVLAAVGAVLVMTAGRGSTSGPAVP* |
Ga0075418_127632032 | 3300009100 | Populus Rhizosphere | MRNLLIGIVLAALLALAVSPVRVAGIDAWKIVLAAIGAVLVVTAGRGSTPTRPT* |
Ga0105243_129787792 | 3300009148 | Miscanthus Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAI |
Ga0075423_117845232 | 3300009162 | Populus Rhizosphere | MRNLLIGLALAAALALALSPVRVAGIDAWKIVLAVIGAVLVVTAGRSTSGPSA |
Ga0105248_108121702 | 3300009177 | Switchgrass Rhizosphere | MRNLVRGIVVAVALALAASPITVAGIDAWKIVLAGAGFVLFATAGRGRTPSP* |
Ga0105340_10234652 | 3300009610 | Soil | MRNVLIGLVLAVALALAASPATVAGIDAWKIVLAAVGAFLFVTAGRGRAG* |
Ga0126381_1021666921 | 3300010376 | Tropical Forest Soil | MKNGAIGLVVATAIALALSPITIAGIAAWKVVLAAVGAVLVVTAGREKVK* |
Ga0134127_127445382 | 3300010399 | Terrestrial Soil | MRNLLIGLVLAAALALAVSPVTIAGIDAWKIVLAAVGAVLVVTAGRGSSAPPS* |
Ga0134123_132220942 | 3300010403 | Terrestrial Soil | MRNMLIGVALAGALALAASPLTVAGIDAWKIVLAAGGFVLFATAGRGRSPSA* |
Ga0137451_12454311 | 3300011438 | Soil | LMRNVLIGLVLAVALALAASPATVAGIDAWKIVLAVVGAFLFVTAGRGRAG* |
Ga0137430_11223992 | 3300012041 | Soil | VLLAAGLALALSPLTIAGIDAWKIVLAAAGAFLFVTAGRGRAPSA* |
Ga0150985_1178560283 | 3300012212 | Avena Fatua Rhizosphere | MKNAVIGLVIASALALALSPIRIAGIDAWKIVLAAVGAVLVVTAGRERVK* |
Ga0157305_100804172 | 3300012891 | Soil | MSTISSGPLPLALALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRSPS* |
Ga0157294_101964682 | 3300012892 | Soil | LALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRSPS* |
Ga0157375_122045581 | 3300013308 | Miscanthus Rhizosphere | MWNLVMGVVLAAALALAMSPARIAGIDAWKILLAAVGAVLVV |
Ga0157375_126518042 | 3300013308 | Miscanthus Rhizosphere | MRNLVMGLVVAAALALAVSPVRIAGFDAWKIVLAAIGAVLVVTAGRGTPTRPT* |
Ga0163163_108421842 | 3300014325 | Switchgrass Rhizosphere | MRNLLIGVALAGALALAASPVTVAGIDAWKIVLAAGGFVLFATAGRGRSPSA* |
Ga0157380_1000126413 | 3300014326 | Switchgrass Rhizosphere | MRNLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGQKVK* |
Ga0157380_103339262 | 3300014326 | Switchgrass Rhizosphere | MRNALLGLVLAIGLALALSPVTVAGIAAWKIVLAAFGAVLVVTAGRGSTSGPAGP* |
Ga0157376_111949652 | 3300014969 | Miscanthus Rhizosphere | MRNLVIGVAVAGALALAASPVRIVGIDAWKIVLAGLGLVLFVTAGRGRAPSA* |
Ga0132255_1000583755 | 3300015374 | Arabidopsis Rhizosphere | MRNLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGERAK* |
Ga0163161_101839302 | 3300017792 | Switchgrass Rhizosphere | MRNLVIGVVVAVALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGEKVK |
Ga0190266_101318442 | 3300017965 | Soil | MRNVLIGLVLAVALALAASPATVAGIDAWKIVLAVVGAFLFVTAGRGNKVR |
Ga0190266_101816141 | 3300017965 | Soil | LALALSPLTIAGIDAWKIVLAAAGAFLFVTAGRGRAPSA |
Ga0190266_103680792 | 3300017965 | Soil | MRNLLIGVVLAGALALAASPLTVAGIDAWKIVLAAAGLVLFVTSGRGRAPSSPKP |
Ga0190266_106707402 | 3300017965 | Soil | MRNALLGLVLAIGLALALSPVTVAGIAAWKIVLAAFGAVLVVTAGRGSTSGPAGP |
Ga0184628_100037472 | 3300018083 | Groundwater Sediment | MRNLVRGIVAAVALALAASPITVAGIDAWKIVLAGVGFVLFVTARRGSTPSP |
Ga0184628_106129112 | 3300018083 | Groundwater Sediment | MRNLVIGLVVAAALALAVSPVRIAGIDAWKIVLAVIGAVLVVTAGRGSTPTRPT |
Ga0190270_100038193 | 3300018469 | Soil | MRNLLIGSALAGALALAASPVTIAGIDAWKIVLAAAGLVLFVTAGRGRASST |
Ga0190270_104799603 | 3300018469 | Soil | VVLAVGLALALSPLTIAGIDAWKIVLAAAGAFLFVTAGRGRASSG |
Ga0190270_106162562 | 3300018469 | Soil | MRNLLIGVGLAGALALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRSPS |
Ga0190270_115092812 | 3300018469 | Soil | MRNLLIGVVLAGALALAASPLTVAGIDAWKIVLAAAGLVLFVTSGRGRAPSA |
Ga0190274_107498342 | 3300018476 | Soil | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGTPTRPT |
Ga0190274_114979221 | 3300018476 | Soil | LLIGVGLAGALALAASPVTVAGIDAWKIVLAAAGFVLFATARRGRSPS |
Ga0190274_123982141 | 3300018476 | Soil | VVLAAGLALALSPLTIAGIDAWKIVLAAAGAFLFVTAGRGRASSG |
Ga0190274_127591731 | 3300018476 | Soil | MRNVVMGLVLAAALALAVSPATVAGIAAWKIVLAA |
Ga0190274_132060732 | 3300018476 | Soil | MRNVLIGVVLAGALALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRS |
Ga0190274_135335892 | 3300018476 | Soil | MRNVLIGLVLAVALALAASPATVAGIDAWKIVLAVVGAFLFVTAGRGRAG |
Ga0190271_100208385 | 3300018481 | Soil | MRNLLIGFALAGALALAASPVTIAGIDAWKIVLAAAGLVLFVTAGRGRASST |
Ga0190271_110141072 | 3300018481 | Soil | MRNAVIGVALAAGLALALSPLTIVGIDAWKIVLAATGALLFVTAGRGRAPSA |
Ga0190271_123940562 | 3300018481 | Soil | MRNLLIGVGLAGALALAASPLTVAGIDAWKIVLAAAGFVLFATAGRGRTPS |
Ga0190271_131779102 | 3300018481 | Soil | VLLAAGLALALSPLTIAGIDAWKVVLAAAGAFLFVTAGRGRAPSA |
Ga0173482_100906672 | 3300019361 | Soil | MRNLLIGVALAGALALAASPVTVAGIDAWKIVLAAGGFVLFATAGRGRSPSA |
Ga0173482_104054931 | 3300019361 | Soil | MRNLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAV |
Ga0210380_103499741 | 3300021082 | Groundwater Sediment | MRNLLIGSALAGALALAASPVTIAGIDAWKIVLAAAGLVLFVTAGRGRAPSA |
Ga0182009_105119452 | 3300021445 | Soil | IGLAIAGGLALALSPITIAGVAAWKIVLAAAGAVLVVTAGREKVK |
Ga0222622_103294822 | 3300022756 | Groundwater Sediment | MRNLVIGLVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVT |
Ga0247779_11826491 | 3300022908 | Plant Litter | MRNLLIGVGLAGALALAASPVTVAGIDAWKIVLAA |
Ga0247790_101217991 | 3300022915 | Soil | AGRCIVEAPMRNLLIGVGLAGALALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRSPS |
Ga0247773_12211592 | 3300023269 | Plant Litter | MRNLLIGVGLAGALALAASPVTVAGIDAWKIVLAAAGFVL |
Ga0207682_102392091 | 3300025893 | Miscanthus Rhizosphere | NLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGEKVK |
Ga0207642_100405502 | 3300025899 | Miscanthus Rhizosphere | MRNLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAVLVVTAGRGEKVK |
Ga0207680_110412932 | 3300025903 | Switchgrass Rhizosphere | MGLVVAAALALAVSPVRIAGIDAWKIVLAAVGAVLVVTAGRNP |
Ga0207643_105102412 | 3300025908 | Miscanthus Rhizosphere | MRNLLMGLVLAAALALAASPVRVAGIDAWKIVLAAIGAVLVVTAGRSGKVG |
Ga0207643_108606571 | 3300025908 | Miscanthus Rhizosphere | VKNVALGLAVAVALAISASPLTIAGIAAWKIVLAAVGAVLVVTANRGQVNK |
Ga0207643_109079272 | 3300025908 | Miscanthus Rhizosphere | MRNALIGILLAGAIALAASPARIAGIDAWKIVLAAVGAVLVVTAGRGNKVG |
Ga0207649_111871801 | 3300025920 | Corn Rhizosphere | DRARSMRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRPN |
Ga0207694_115389262 | 3300025924 | Corn Rhizosphere | MKNAAIGLLIAGGLALALSPIMIAGIAAWKIVLAAVGAVLVVTAGREKVK |
Ga0207650_100283635 | 3300025925 | Switchgrass Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRPN |
Ga0207659_109403842 | 3300025926 | Miscanthus Rhizosphere | VVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRPN |
Ga0207659_116210882 | 3300025926 | Miscanthus Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRSRPT |
Ga0207659_117164612 | 3300025926 | Miscanthus Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPTRP |
Ga0207687_110287981 | 3300025927 | Miscanthus Rhizosphere | LVVAAALALAVSPVRIAGIDAWKIVLAAVGAVLVVTAGRNPARPT |
Ga0207670_105686592 | 3300025936 | Switchgrass Rhizosphere | MGVVLAAALALAMSPARIAGIDAWKIVLAAVGAFLVVTAGRGSTPTRPT |
Ga0207670_114954601 | 3300025936 | Switchgrass Rhizosphere | AGALALAASPVTIAGIDAWKIVLAAAGLVLFVTAGRGRAPSA |
Ga0207669_102042312 | 3300025937 | Miscanthus Rhizosphere | MRNLLIGIVVAAALALAVSPVRIAGIDAWKIVLAVVGAVLVVTAGRGTPTRPT |
Ga0207669_104931332 | 3300025937 | Miscanthus Rhizosphere | MRNLLIGVGLAGALALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRAPSA |
Ga0207704_112746061 | 3300025938 | Miscanthus Rhizosphere | MGVVLAAALALAMSPARIAGIDAWKILLAAVGAFLVVTAGRGGADKPT |
Ga0207691_100692044 | 3300025940 | Miscanthus Rhizosphere | MRNLLMGLVLAAALALAASPVRVAGIDAWKIVLAAIGAVLVVTAGRSGKV |
Ga0207691_101918683 | 3300025940 | Miscanthus Rhizosphere | MGLVVAAALALAVSPVRIAGIDAWKIVLAVIGAVLVVTAGRGSTPTRPT |
Ga0207691_102918931 | 3300025940 | Miscanthus Rhizosphere | VAVALALAASPVTVAGIDAWKIVLAGAGFVLFATAGRGRTPSP |
Ga0207711_105711312 | 3300025941 | Switchgrass Rhizosphere | VAVALALAASPITVAGIDAWKIVLAGAGFVLFATAGRGRTPSP |
Ga0207711_120225402 | 3300025941 | Switchgrass Rhizosphere | YRSMRNLVMGVVLAAALALAMSPARIAGIDAWKILLAAVGAFLVVTAGRGSADKPT |
Ga0207689_106651212 | 3300025942 | Miscanthus Rhizosphere | MKNVAMGLAIAVALALSASPLTVAGIAAWKIVLAAVGAVLVVTANRPGRPTGPA |
Ga0207689_108324231 | 3300025942 | Miscanthus Rhizosphere | PRPMRNLLMGLVLAAALALAASPVRVAGIDAWKIVLAAIGAVLVVTAGRSGKVG |
Ga0207661_111052822 | 3300025944 | Corn Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGGTPT |
Ga0207651_104763642 | 3300025960 | Switchgrass Rhizosphere | MRNLLIGSALAGALALAASPVTIAGIDAWKIVLAAAGLVL |
Ga0207677_110298262 | 3300026023 | Miscanthus Rhizosphere | MRNLVIGIVVAAALALAVSPVRIAGIDAWKIVLAA |
Ga0207678_100636584 | 3300026067 | Corn Rhizosphere | MRNAVIGFVLAGALALALSPVTIVGIDAWKIVLGIVGAFLVVTAGRENKAG |
Ga0207708_112413582 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNMLIGVALAGALALAASPLTVAGIDAWKIVLAAAGFVLFATAGRGRTPSP |
Ga0207675_1005035341 | 3300026118 | Switchgrass Rhizosphere | MRNLLIGLVVAAALALAVSPVRIAGIDAWKIVLAAIGAVLVVTAGRGNR |
Ga0207675_1009886582 | 3300026118 | Switchgrass Rhizosphere | MRNALIGIALAGGLALAASPARIAGIDAWKIVLAAV |
Ga0208185_10554022 | 3300027533 | Soil | MRNVLIGLVLAVALALAASPATVAGIDAWKIVLAAVGAFLFVTAGRGRAG |
Ga0209486_100007609 | 3300027886 | Agricultural Soil | MRNVLVGVVLAAGLALALSPLTIAGIDAWKIVLAAGGAFLFVTAGRGSKVR |
Ga0207428_112724071 | 3300027907 | Populus Rhizosphere | MRNLVIGVVVAAALALALSPARIAGIDAWKIVLAAIGAVLVVTAG |
Ga0268265_105887591 | 3300028380 | Switchgrass Rhizosphere | MRNALIGILLAGAIALAASPARIAGIDAWKIVLAAVGAVLVVTAGRGNRVG |
Ga0268264_103183492 | 3300028381 | Switchgrass Rhizosphere | MGLVVAAALALAVSPVRIAGIDAWKIVLAAVGAVLVVTAGRNPARPT |
Ga0247825_105753092 | 3300028812 | Soil | AGRCIVDAPMRNLLIGVVLAGALALAASPVTVAGIDAWKIVLAAAGFVLFATAGRGRSPS |
Ga0302046_100618154 | 3300030620 | Soil | MLGAAAAGGLALAMSDATFFGIDAWKIVLAVAGLVLFVVGGRASGRS |
Ga0310888_104763602 | 3300031538 | Soil | MRNLLIGSALAGALALAASPVTIAGIDAWKIVLAAAGLVLFVTAGRGRA |
Ga0307410_120058132 | 3300031852 | Rhizosphere | MRNVLTGLVIVVALALAASPVTVAGIAVWKLVLAVFGAFLFVTGGSRKA |
Ga0307407_117084402 | 3300031903 | Rhizosphere | MRNVLTGLVIVVALALAASPVTVAGIAVWKLVLAVFGAFLFVTAGSRKA |
Ga0310900_102789642 | 3300031908 | Soil | MRNALLGLVLAMGLALSLSPVTIAGIAAWKIVLAAFGAVLVVTAGRGSTSGPAGP |
Ga0310900_118137172 | 3300031908 | Soil | MRNALLGLVLAIGLALALSPVTIAGIAAWKIVLAAFGVV |
Ga0307412_104132603 | 3300031911 | Rhizosphere | MRNILLGLVAAAGLALALSPVTVAGIAAWKIVLAVFGAFLFVT |
Ga0307412_108314852 | 3300031911 | Rhizosphere | MRNVLVGLVIAVGLALAASPVTVAGIAAWKIVLAVFGAFVFVTAGTRKSDKG |
Ga0307412_117203892 | 3300031911 | Rhizosphere | MRNVLIGLVIAVGLALAASPVTVAGIAAWKIVLAAFGAFLFVTAGT |
Ga0310901_101388691 | 3300031940 | Soil | MRNLLIGSALAGALALAASPVTIAGIDAWKIVLAAAGLVLFVT |
Ga0307416_1014579891 | 3300032002 | Rhizosphere | MRNVLIGLVIAVGLALAASPVTVAGIAAWKIVLAAFGAFLFVTAGTRKAG |
Ga0307411_122721012 | 3300032005 | Rhizosphere | MRNVLIGLVMAVGLALAVSPVAVAGIAAWKIVLAAFGAFLFVTAGTRRA |
Ga0310890_118515712 | 3300032075 | Soil | MRNALLGLVLAIGLALALSPVTIAGIAAWKIVLAAFGVVLVVTAGRGEKARPTRPPG |
Ga0315910_109046022 | 3300032144 | Soil | VVLAAGLALALSPLTIAGIDAWKIVLAAAGAVLFVTAGRGRAPSA |
Ga0315912_100575673 | 3300032157 | Soil | MRNLTIGLVVAAALALALSPVTIAGIAAWKIVLAAFGAVLVVTAGRGNKVR |
Ga0315912_102539002 | 3300032157 | Soil | MKNGALGLVIAGALALALSPATVAGIAVWKILLAAVGAVLVVTAGKSGGSSKS |
Ga0307472_1007785232 | 3300032205 | Hardwood Forest Soil | VRNLLIGVVLAGALALAASPARFFGIDAWKIVLALAGFVLFATAGRGRGDAGRS |
Ga0307472_1011805662 | 3300032205 | Hardwood Forest Soil | MRNMLIGVLAAGALALAASPLTVAGIDVWKIVLAAAGFVLFSTAGRGRSPS |
⦗Top⦘ |