NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042366

Metagenome / Metatranscriptome Family F042366

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042366
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 133 residues
Representative Sequence KMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Number of Associated Samples 129
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 80.38 %
% of genes from short scaffolds (< 2000 bps) 99.37 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.367 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(33.544 % of family members)
Environment Ontology (ENVO) Unclassified
(58.861 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.215 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 33.54%    β-sheet: 0.00%    Coil/Unstructured: 66.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.37 %
UnclassifiedrootN/A0.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004097|Ga0055584_101046367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300005043|Ga0071100_1104833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300006356|Ga0075487_1468540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300006374|Ga0075512_1186011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300006379|Ga0075513_1268197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300006403|Ga0075514_1921386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300008998|Ga0103502_10308979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300009025|Ga0103707_10181657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300009159|Ga0114978_10811171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300009263|Ga0103872_1036621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300009265|Ga0103873_1086742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300009279|Ga0103880_10038092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300009432|Ga0115005_10494791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum974Open in IMG/M
3300009436|Ga0115008_10290525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1161Open in IMG/M
3300009436|Ga0115008_11361235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300009599|Ga0115103_1576845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300009606|Ga0115102_10278611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300009606|Ga0115102_10823040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum966Open in IMG/M
3300009677|Ga0115104_11175029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300009677|Ga0115104_11187018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300009679|Ga0115105_10271525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300010368|Ga0129324_10370107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300010981|Ga0138316_10478938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300010981|Ga0138316_11420418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300010987|Ga0138324_10533015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300012952|Ga0163180_10262262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1211Open in IMG/M
3300017719|Ga0181390_1049875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1232Open in IMG/M
3300018413|Ga0181560_10575929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018622|Ga0188862_1022699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300018692|Ga0192944_1037941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300018725|Ga0193517_1042239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300018730|Ga0192967_1066465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018765|Ga0193031_1050795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300018779|Ga0193149_1044917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300018871|Ga0192978_1080657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018934|Ga0193552_10206279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300018967|Ga0193178_10040639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300018968|Ga0192894_10151981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300018968|Ga0192894_10174047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300018974|Ga0192873_10296857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300018974|Ga0192873_10381513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300018977|Ga0193353_10157130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300018980|Ga0192961_10147910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300018982|Ga0192947_10189013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300018989|Ga0193030_10147577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300018989|Ga0193030_10163210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
3300018989|Ga0193030_10176326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300018989|Ga0193030_10233112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300019001|Ga0193034_10104759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300019010|Ga0193044_10185618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300019022|Ga0192951_10297551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300019031|Ga0193516_10192647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300019032|Ga0192869_10330761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300019033|Ga0193037_10182988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300019045|Ga0193336_10268264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300019045|Ga0193336_10308954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300019095|Ga0188866_1033227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300019097|Ga0193153_1020795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300019103|Ga0192946_1038306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300019103|Ga0192946_1046784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300019118|Ga0193157_1015614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300019118|Ga0193157_1018257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300019149|Ga0188870_10112244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300019149|Ga0188870_10128722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300019281|Ga0182077_1262109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300019282|Ga0182075_1096383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum790Open in IMG/M
3300021342|Ga0206691_1149812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300021345|Ga0206688_10058505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum713Open in IMG/M
3300021345|Ga0206688_10700316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300021348|Ga0206695_1453795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300021353|Ga0206693_1817948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300021872|Ga0063132_104621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300021887|Ga0063105_1057106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300021889|Ga0063089_1029454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300021902|Ga0063086_1001201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300021902|Ga0063086_1007461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300021902|Ga0063086_1007637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300021910|Ga0063100_1043590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300021912|Ga0063133_1008434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300021921|Ga0063870_1044228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300021922|Ga0063869_1051276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300021924|Ga0063085_1001628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300021925|Ga0063096_1002540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300021927|Ga0063103_1015216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300021928|Ga0063134_1042068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300021940|Ga0063108_1086078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300021941|Ga0063102_1016583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300021943|Ga0063094_1012671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300021950|Ga0063101_1020413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300023565|Ga0228688_115929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300023679|Ga0232113_1031817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300023685|Ga0228686_1061121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300023693|Ga0232112_1034944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300023694|Ga0228683_1027866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300023695|Ga0228680_1039511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300023696|Ga0228687_1034729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300023698|Ga0228682_1045736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300023701|Ga0228685_1046721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300023704|Ga0228684_1050722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300024343|Ga0244777_10918019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300024346|Ga0244775_11512302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300025620|Ga0209405_1165937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300026136|Ga0208763_1019969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1034Open in IMG/M
3300026403|Ga0247557_1035546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300026449|Ga0247593_1084515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300026458|Ga0247578_1076563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300026466|Ga0247598_1157155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300026468|Ga0247603_1100794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300026495|Ga0247571_1107156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300026500|Ga0247592_1149762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300026504|Ga0247587_1114304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300026513|Ga0247590_1156735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300028134|Ga0256411_1190667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300028134|Ga0256411_1239646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300028137|Ga0256412_1274313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300028282|Ga0256413_1275630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300028282|Ga0256413_1294354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300028290|Ga0247572_1126020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300028333|Ga0247595_1073663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300028335|Ga0247566_1060284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300028575|Ga0304731_10711852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300028575|Ga0304731_10756081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300028595|Ga0272440_1175048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300030670|Ga0307401_10358297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300030671|Ga0307403_10558971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300030699|Ga0307398_10502377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300030726|Ga0308126_1063837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300030780|Ga0073988_10004497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300030780|Ga0073988_10010774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300031038|Ga0073986_11948699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300031062|Ga0073989_13491165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300031062|Ga0073989_13544861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300031062|Ga0073989_13575322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300031557|Ga0308148_1036211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300031676|Ga0302136_1211352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300031688|Ga0308011_10104398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300031709|Ga0307385_10258763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300031709|Ga0307385_10364208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300031710|Ga0307386_10465279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300031710|Ga0307386_10648201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300031717|Ga0307396_10574464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300031725|Ga0307381_10254601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300031725|Ga0307381_10370570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300031737|Ga0307387_10295506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum962Open in IMG/M
3300031738|Ga0307384_10434474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300031738|Ga0307384_10507550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300031738|Ga0307384_10509566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300031739|Ga0307383_10418662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300031739|Ga0307383_10533987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300031743|Ga0307382_10385336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300032518|Ga0314689_10464628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300032540|Ga0314682_10507161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300032616|Ga0314671_10499677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300032707|Ga0314687_10631915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300032734|Ga0314706_10536175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300032745|Ga0314704_10624801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300032752|Ga0314700_10322101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum816Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine33.54%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.32%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater17.09%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.43%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.53%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.53%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.90%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.90%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.63%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.63%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.63%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.63%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.63%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.63%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.63%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.63%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030726Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1292_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055584_10104636723300004097Pelagic MarineINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN*
Ga0071100_110483313300005043Marine Subseafloor AquiferMKYLAIVALLGLTSAIRLRDDSDSLGRNVGKTVHQDMHLSGYNGADEDDIMDNVYGRFSSEGQTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPAEVPGYLSANFESSWN
Ga0075487_146854013300006356AqueousKMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN*
Ga0075512_118601113300006374AqueousKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN*
Ga0075513_126819713300006379AqueousLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN*
Ga0075514_192138613300006403AqueousNTKMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN*
Ga0103502_1030897913300008998MarineKFAIVALLGLTGAIKLADYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWSHFDQNHEGWIRYEETHTF*
Ga0103707_1018165723300009025Ocean WaterVASIAALTNAVRLTDSSDPLGRNVDNTTHWDMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDDAKLAAGTILEAAHKLEPSRVPAYLEANFESSWNHFDQNHEGWIRYEETHTFQRHLMG*
Ga0114978_1081117113300009159Freshwater LakeMFKSVATAAILGMVSCHRLAVSDVSDALGRNVDHYTHKDTHISGYNGADEDEIYDNVFSRFSKEGLTPSGHKTGQKLLMKDDAKLASGQSLEAAHWLSPAEVPSYLDANFENAWNHYDQNGEGWIRYEETHVFMRFL
Ga0103872_103662113300009263Surface Ocean WaterKNIVINYYNYNMNKYLAIAALLGATSAVRIQDNSDPNGKNVDGVETWKDQQLSGHNGADEDEIMDNIFSRFSKEGRTTSGHKTGQKLLMKDDAKIASGTILEAAHKLKPAEVPAYMDANFEKAWNHFDQNKEGWIRYEESHTMQRYL*
Ga0103873_108674213300009265Surface Ocean WaterKYLAIAALLGATSAVRIQDNSDPNGKNVDGVETWKDQQLSGHNGADEDEIMDNIFSRFSKEGRTTSGHKTGQKLLMKDDAKIASGTILEAAHKLKPAEVPAYMDANFEKAWNHFDQNKEGWIRYEESHTMQRYL*
Ga0103880_1003809213300009279Surface Ocean WaterIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF*
Ga0115005_1049479113300009432MarineMRFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF*
Ga0115008_1029052523300009436MarineMRFTVIALLGLAGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF*
Ga0115008_1136123513300009436MarineMRFTVIALLGLVGAIKIQKGYDASDPLGKNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF*
Ga0115103_157684513300009599MarineKMKFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGEMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN*
Ga0115102_1027861123300009606MarinePKMKFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGEMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN*
Ga0115102_1082304013300009606MarineLNTKMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRFLMGSLN*
Ga0115104_1117502913300009677MarineDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF*
Ga0115104_1118701813300009677MarineQKMKFAVIALLGLVGAVKINKGYDASDPLGKNEAKDQHGEMQLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPQEVPGWLDTNFEGAWAHFDQNHEGWIRYEESHTFQRYLMGKLN*
Ga0115105_1027152513300009679MarineITIRKNYDNSDPLGRNVAKDQHGEMHLSGFNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPSEVPGWLDSHFEESWNHFDQNHEGWIRYEETHTF*
Ga0129324_1037010713300010368Freshwater To Marine Saline GradientMQFSKIIALAALFGMVDVNAVKISTMDNSDPEGRNVDKTTWKDMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLLPPAVPAYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQG
Ga0138316_1047893813300010981MarineFTVIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF*
Ga0138316_1142041813300010981MarineKMRFVVIAAILGLASAVTIRRNYDNSDPLGRNVAKDQHGEMHLSGFNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDSHFEESWNHFDQNHEGWIRYEETHTF*
Ga0138324_1053301513300010987MarineKMRFTVIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF*
Ga0163180_1026226213300012952SeawaterMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIVDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF*
Ga0181390_104987523300017719SeawaterMRFTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0181560_1057592913300018413Salt MarshMKFSVIAALFAVTSAVRLADNSDSKGRNVDQTTWEDMKISGYNGADEDEIMDSVFSHYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILESAHKLKPEEVPAYLSANFESSWDHFDQNHEGWIRYEETHTFQRHIQGSLNK
Ga0188862_102269913300018622Freshwater LakeKMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0192944_103794113300018692MarineMKFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0193517_104223923300018725MarineMRFAIVALLGLTGAIRLGDYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWAHFDQNHEGWIRYEETHTF
Ga0192967_106646513300018730MarineSDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0193031_105079513300018765MarineHGEILNTKEMRFTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF
Ga0193149_104491713300018779MarineSKMRFIAVAALLGLVSAIRIRDNSDPLGRNVDKSTWEDMKISGYHGADEDEIMDNIFSRYAKEGRTPSGHKTGQKLLMKDDAKLACGTILEAAHKLKPADVPGYLDKNFEATWNHFDQNHEGWVRYEETHTL
Ga0192978_108065713300018871MarineINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEASHKLKPSEVPGWLDAHFEGSWDHYDQNHEGWIRYEETHTF
Ga0193552_1020627913300018934MarineTGAIKLADYGKDLSDPLGRNFAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWAHFDQNHEGWIRYEETHTF
Ga0193178_1004063913300018967MarineRFTVIALLGLVGAVKINKNYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILESAHKLKPAEVPGWLDSNFEKAWDHFDQNHEGWIRYEETHTF
Ga0192894_1015198113300018968MarineMRFVAIAALLGLSEALRLNRQYDQSDPLGRNVAPDQHGEMHLSGFNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKSWNHFDQNHEGWIRYEETHTF
Ga0192894_1017404713300018968MarineTWGFSIIKINKNMNLTKLVALGALLGFTEGIRLRDDSDPLGRNVDPTIWQDMHISGYHGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLHPADVPGYLDKNFESTWNHYDQNHEGWIRYEETHTFQRHLMG
Ga0192873_1029685713300018974MarineMRFTVIALLGLAGAVKINKNYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDSNFEKAWDHFDQNHEGWIRYEETHTF
Ga0192873_1038151313300018974MarineDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFARYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPQEVPGWLDSNFEKAWSHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0193353_1015713023300018977MarineMRFAIVALLGLTGAIKLADYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWAHFDQNHEGWIRYEETHTF
Ga0192961_1014791013300018980MarineMKFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGEMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0192947_1018901313300018982MarineMRFTVIALLGLVGAVKINKGYDASDPLGKNVAKDQHGEMKLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHMLKPAEVPGWLDSNFEKAWDHFDQNHEGWIRYEETHTF
Ga0193030_1014757713300018989MarineMRFIAVAALFGLVSAIRIRDNSDPLGRNVDKTTWEDMKISGYHGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPADVPTYLDKNFEGSWNHFDQNHEGWIRYEETHTFQRHL
Ga0193030_1016321013300018989MarineMRFTVIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0193030_1017632613300018989MarineTWGILSILNTKEMRFTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF
Ga0193030_1023311213300018989MarineKITHRDYGKDLSDPLGKNVATDQHGDMHLSGYNGADEDEIMDNVFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWAHFDQNHEGWIRYEETHTF
Ga0193034_1010475913300019001MarineMKFAIVALLGLTGAIKLADYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWTHFDQNHEGWIRYEETHTF
Ga0193044_1018561813300019010MarineAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFARYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF
Ga0192951_1029755113300019022MarineKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0193516_1019264713300019031MarineMRFAIVALLGLAGAIKLRDYGKDLSDPLGRNVAKDQHGDMHLSGFNGADEDEIMDNVFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDKNFEGSWAHFDQNHEGWIRYEETHTF
Ga0193516_1019826223300019031MarinePLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWAHFDQNHEGWIRYEETHTF
Ga0192869_1033076113300019032MarineMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0193037_1018298813300019033MarineHGELKFYIFKKNAICSYCSYLGLAGAINLQRNYDQSDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF
Ga0193336_1026826423300019045MarineMKFAIVALLGLTGAIKLADYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWAHFDQNHEGWIRYEETHTF
Ga0193336_1030895413300019045MarineMNTKFMVLAALLGSISAIKITNKDSSDPLGRNVDQTTWEDMHISGYNGADEDEIMDNVYGHYSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVQPYLDANFEASWDHFDQNHEGWIRYEETHTF
Ga0188866_103322713300019095Freshwater LakeLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0193153_102079513300019097MarineMKFAIVALLGLTGAIKLADYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWSHFDQNHEGWIRYEETHTF
Ga0192946_103830613300019103MarineMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0192946_104678413300019103MarineINKGYDASDPLGKNVAKDQHGEMKLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHMLKPAEVPGWLDSNFEKAWDHFDQNHEGWIRYEETHTF
Ga0193157_101561413300019118MarineMRFIAVAALLGLVSAIRIRDNSDPLGRNVDKSTWEDMKISGYHGADEDEIMDNIFSRYAKEGRTPSGHKTGQKLLMKDDAKLACGTILEAAHKLKPADVPGYLDKNFEATWNHFDQNHEGWVRYEETHTL
Ga0193157_101825723300019118MarineMGNIYYKSNRKMKFAIVALLGLTGAIKLADYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWTHFDQNHEGWIRYEETHTF
Ga0188870_1011224413300019149Freshwater LakeLNTKMKIAVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0188870_1012872213300019149Freshwater LakeFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGDMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0182077_126210913300019281Salt MarshALKINSYDNSDPLGRNVDKTTWQDMKISGYNGADEDEIMDNIFGRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPADVPAYLNKNFESSWNHFDQNHEGWIRYEETHTFQRFL
Ga0182075_109638313300019282Salt MarshNMTYSKLFVIAALVGSMGALKINSYDNSDPLGRNVDKTTWQDMKISGYNGADEDEIMDNIFGRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPADVPAYLNKNFESSWNHFDQNHEGWIRYEETHTFQRFL
Ga0206691_114981233300021342SeawaterITLIALLGGASAVKLGWVGQDASNPHGQNIPTADTWKNMKISGFNGADEDEIMDSVFSHYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLSANEVPDYLGYMFEDSWNHFDENHEGWIRYEETHTFQRYL
Ga0206688_1005850523300021345SeawaterMRFVAIAALLGLTEAINLTRQYDTSDPLGRNVAPDQHGEMHLSGFNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPNEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTF
Ga0206688_1070031613300021345SeawaterINMYKIVCLLVATNAINIKRGYDASDPLGRNVAPNQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKMLMKDEAKIAAGTILEAAHKLKPAEVPGWLDANFEKSWNHFDQNHEGWIRYEETHTF
Ga0206695_145379513300021348SeawaterPKMKFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGEMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0206693_181794813300021353SeawaterIMFKVAFVALIANASAIRIMDSSDPLGRNEAKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKTWNHFDQNHEGWIRYEETHTF
Ga0063132_10462113300021872MarineKEMRFTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF
Ga0063105_105710613300021887MarineKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063089_102945413300021889MarineQKMRFTVIALLGLAGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063086_100120113300021902MarineMRFTVIALLGLAGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063086_100746113300021902MarineLHKKMRFTVIALLGLVGAIKIQKGYDASDPLGKNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063086_100763713300021902MarinePKMKFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGDMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKVAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0063100_104359013300021910MarineKQKMRFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063133_100843413300021912MarineKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0063870_104422813300021921MarineKKMRFTVIALLGLVGAIKIQKGYDASDPLGKNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063869_105127613300021922MarineKMRFTVIALLGLVGAIKIQKGYDASDPLGKNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063085_100162813300021924MarineKMKFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGDMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKVAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0063096_100254013300021925MarineNLKQKMRFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063103_101521613300021927MarineNNLKQKMRFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063134_104206813300021928MarineQKMRFTVIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0063108_108607813300021940MarineFTVIALLGLVGAIKIQKGYDASDPLGKNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063102_101658313300021941MarineMRFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063094_101267113300021943MarineQKMRFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0063101_102041313300021950MarineLKQKMRFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0228688_11592913300023565SeawaterFTVIALLGLVGAVKINKGYDASDPLGKNVATDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0232113_103181713300023679SeawaterKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0228686_106112113300023685SeawaterVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0232112_103494413300023693SeawaterVGAVKINKGYDASDPLGKNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHT
Ga0228683_102786613300023694SeawaterVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0228680_103951113300023695SeawaterTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0228687_103472913300023696SeawaterNTKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0228682_104573613300023698SeawaterRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0228685_104672113300023701SeawaterTKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0228684_105072213300023704SeawaterKMRFTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0244777_1091801913300024343EstuarineMQIKLLAMAALLGSISAIKIQDSSDPNGKNVEGTETWKDQVLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLAPAAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLD
Ga0244775_1151230213300024346EstuarineMQYSKIIVLAALFGMAEVQSVKIAVHDNSDKLGRNVDKTTWEDMKLSGFNGADEDEIMDSVYARYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPADVPAFLSKNFESAWNHFDQNHEGWIRYEETHTF
Ga0209405_116593713300025620Pelagic MarineMQLSKIIAITALLGFTSAVRLHDDSDPNGVNTPGAQTYADMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLTPAEVPTYLDSNFENAWNHFDQNHEGWIRFEETHTFQRYLNG
Ga0208763_101996913300026136MarineMKFAIVALLGLTGAIKLADYGKDLSDPLGRNVAKDQHGDMHLSGYNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247557_103554613300026403SeawaterKFAVIALLGLVGAVKINKGYDASDPLGKNVAKDQHGEMHLSGYNGADEDEIMDNIYSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247593_108451523300026449SeawaterQKMKFAVIALLGLVGAVKINKGYDASDPLGKNEAKDQHGEMQLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPQEVPGWLDTNFEGAWAHFDQNHEGWIRYEESHTFQRYLMGKLN
Ga0247578_107656313300026458SeawaterKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247598_115715513300026466SeawaterGAVKINKGYDASDPLGKNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247603_110079413300026468SeawaterYKIMKFTVIALLGLVGAVKINKGYDASDPLGKNEAKDQHGEMQLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPQEVPGWLDTNFEGAWAHFDQNHEGWIRYEESHTFQRYLMGKLN
Ga0247571_110715613300026495SeawaterRFTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247592_114976213300026500SeawaterMKFAVIALLGLVGAVKINKGYDASDPLGKNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPQEVPGWLDANFEKAWDHFDQNHEGRIRYEETHTF
Ga0247587_111430413300026504SeawaterLNTKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247590_115673513300026513SeawaterKMKFAVIALLGLVGAVKINKGYDASDPLGKNEAKDQHGEMQLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPQEVPGWLDTNFEGAWAHFDQNHEGWIRYEESHTFQRFLMGKLN
Ga0256411_119066713300028134SeawaterMKFAVIALLGLVGAVKFNNGYDASDPLRKNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0256411_123964613300028134SeawaterTVIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF
Ga0256412_127431323300028137SeawaterLAVVALVGAIRVRDDSDPMGQNFEGAETHSDMHISGYNGADEDEIMDNIFSRFAKEGLTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0256413_127563013300028282SeawaterVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0256413_129435413300028282SeawaterTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247572_112602013300028290SeawaterTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247595_107366313300028333SeawaterAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0247566_106028413300028335SeawaterTKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0304731_1071185213300028575MarineKMRFVVIAAILGLASAVTIRRNYDNSDPLGRNVAKDQHGEMHLSGFNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDSHFEESWNHFDQNHEGWIRYEETHTF
Ga0304731_1075608113300028575MarineFTVIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLRPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0272440_117504813300028595Marine SedimentMRVSTFLALIGVAAAVRLTDNSDPEGRNVDQNTWKDMHVSGYNGADEDEIMDNFFSKYAREGRTPSGHKTGQKLLLKDDAKIASGTLLEALHKLDPANVPSFLSQNFETSWNHFDQNHEGWIRYEETHTFQRHLMGRLN
Ga0307401_1035829713300030670MarineMRFAIIALLQVVGAIKLADYGKDLSDPLGKNVATDQHGDMHLSGYNGADEDEIMDNVFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEASHKLKPSEVPGWLDGAFEKSWSHFDQNHEGWIRYEETHTF
Ga0307403_1055897113300030671MarineAGAIKLNKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDGNFEKSWDHFDQNHEGWIRYEETHT
Ga0307398_1050237713300030699MarineKMRFAIIALLQVVGAIKLADYGKDLSDPLGKNVATDQHGDMHLSGYNGADEDEIMDNVFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEASHKLKPSEVPGWLDGAFEKSWSHFDQNHEGWIRYEETHTF
Ga0308126_106383723300030726MarineTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0073988_1000449713300030780MarineKMRFTVIALLGLVGAVKINKNYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDSNFEKAWDHFDQNHEGWIRYEETHTF
Ga0073988_1001077413300030780MarineKMRFTVIALLGLAGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTFQRYLMGTLN
Ga0073986_1194869913300031038MarineMKFTVAIAALLGAAVAIRIGDDSEPEGRNMDTARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPHEVPAYLDANFENSWTHFDQNHEGWIRYEETHTFQRHLMG
Ga0073989_1349116513300031062MarineIALLGLVGAVKINKNYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0073989_1354486113300031062MarineKMRFTVIALLGLVGAVKINKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDSNFEKAWDHFDQNHEGWIRYEETHTF
Ga0073989_1357532213300031062MarineRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTF
Ga0308148_103621113300031557MarineFTVIALLGLVGAIKIQKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTF
Ga0302136_121135213300031676MarineMKFAIVALLGVSLAGAIRLTDVSDPLGKNEAKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPG
Ga0308011_1010439813300031688MarineMKFAIVALLGVSLAGAIRLTDVSDPLGKNEAKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTF
Ga0307385_1025876313300031709MarineFTVIALLGLAGAIKIQKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDGNFEKAWDHFDQNHEGWIRYEETHTFQRFLMGTLN
Ga0307385_1036420813300031709MarineIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0307386_1046527913300031710MarineNTKEMRFTVIALLGLAGAIKIQKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDGNFEKAWDHFDQNHEGWIRYEETHTFQRFLMGTLN
Ga0307386_1064820113300031710MarineQKMRFTVIALLGLVGAVKINKGYDASDSLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTF
Ga0307396_1057446413300031717MarineLLQVVGAIKLADYGKDLSDPLGKNVATDQHGDMHLSGYNGADEDEIMDNVFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTILEASHKLKPSEVPGWLDGAFEKSWSHFDQNHEGWIRYEETHTF
Ga0307381_1025460113300031725MarineTKEMRFTVIALLGLAGAIKIQKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDGNFEKAWDHFDQNHEGWIRYEETHTFQRFLMGTLN
Ga0307381_1037057013300031725MarineKIVCLLGLAGAIKLNKGYDASDPLGRNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLN
Ga0307387_1029550633300031737MarineMKFAVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0307384_1043447413300031738MarineMRFTVIALLGLAGAIKIQKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDGNFEKAWDHFDQNHEGWIRYEETHTFQRFLMGTLN
Ga0307384_1050755013300031738MarineKMKFAVIALLGLVGAVKINKGYDASDPLGKNEATSQHGEMHLSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKVAAGTVLEAAHKLKPSEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTFQRYLMGSLN
Ga0307384_1050956613300031738MarineVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0307383_1041866213300031739MarineQKMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDTNFEKAWDHFDQNHEGWIRYEETHTF
Ga0307383_1053398713300031739MarineKEMRFTVIALLGLAGAIKIQKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDGNFEKAWDHFDQNHEGWIRYEETHTFQRFLMGTLN
Ga0307382_1038533613300031743MarineMRFTVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHMLKPAEVPGWLDGNFEKAWDHFDQNHEGWIRYEETHTF
Ga0314689_1046462813300032518SeawaterLNTKMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0314682_1050716113300032540SeawaterMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0314671_1049967713300032616SeawaterGIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0314687_1063191513300032707SeawaterKIAVIALLGLVGAVKINKGYDASDPLGRNVAKDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0314706_1053617513300032734SeawaterLLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0314704_1062480113300032745SeawaterKMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNLEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN
Ga0314700_1032210113300032752SeawaterGILSNLNTKMKIAVIALLGLVGAVKINKGYDASDPLGRNVARDQHGEMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.