| Basic Information | |
|---|---|
| Family ID | F042360 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 49 residues |
| Representative Sequence | FLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.64 % |
| % of genes near scaffold ends (potentially truncated) | 97.47 % |
| % of genes from short scaffolds (< 2000 bps) | 83.54 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.911 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.089 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.848 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.570 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.38% Coil/Unstructured: 76.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF06750 | DiS_P_DiS | 15.19 |
| PF09859 | Oxygenase-NA | 6.96 |
| PF02861 | Clp_N | 5.70 |
| PF01814 | Hemerythrin | 5.70 |
| PF13633 | Obsolete Pfam Family | 3.80 |
| PF07963 | N_methyl | 3.16 |
| PF00072 | Response_reg | 2.53 |
| PF02538 | Hydantoinase_B | 1.90 |
| PF14235 | DUF4337 | 1.90 |
| PF01464 | SLT | 1.90 |
| PF13511 | DUF4124 | 1.27 |
| PF03466 | LysR_substrate | 1.27 |
| PF13544 | Obsolete Pfam Family | 1.27 |
| PF11604 | CusF_Ec | 1.27 |
| PF00211 | Guanylate_cyc | 1.27 |
| PF08281 | Sigma70_r4_2 | 1.27 |
| PF13561 | adh_short_C2 | 1.27 |
| PF13469 | Sulfotransfer_3 | 1.27 |
| PF01592 | NifU_N | 0.63 |
| PF13414 | TPR_11 | 0.63 |
| PF02321 | OEP | 0.63 |
| PF04250 | DUF429 | 0.63 |
| PF08352 | oligo_HPY | 0.63 |
| PF02518 | HATPase_c | 0.63 |
| PF02574 | S-methyl_trans | 0.63 |
| PF02746 | MR_MLE_N | 0.63 |
| PF08240 | ADH_N | 0.63 |
| PF12019 | GspH | 0.63 |
| PF09285 | Elong-fact-P_C | 0.63 |
| PF02515 | CoA_transf_3 | 0.63 |
| PF06114 | Peptidase_M78 | 0.63 |
| PF00754 | F5_F8_type_C | 0.63 |
| PF00528 | BPD_transp_1 | 0.63 |
| PF03069 | FmdA_AmdA | 0.63 |
| PF03448 | MgtE_N | 0.63 |
| PF12787 | EcsC | 0.63 |
| PF13602 | ADH_zinc_N_2 | 0.63 |
| PF01761 | DHQ_synthase | 0.63 |
| PF05362 | Lon_C | 0.63 |
| PF09382 | RQC | 0.63 |
| PF04055 | Radical_SAM | 0.63 |
| PF12399 | BCA_ABC_TP_C | 0.63 |
| PF11104 | PilM_2 | 0.63 |
| PF01145 | Band_7 | 0.63 |
| PF09678 | Caa3_CtaG | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 45.57 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 5.70 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 3.80 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.27 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.27 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.27 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.63 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.63 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.63 |
| COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 0.63 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.63 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.63 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.63 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.63 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.91 % |
| Unclassified | root | N/A | 17.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004156|Ga0062589_100552482 | Not Available | 986 | Open in IMG/M |
| 3300004156|Ga0062589_100574854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 971 | Open in IMG/M |
| 3300004157|Ga0062590_100152609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1585 | Open in IMG/M |
| 3300004643|Ga0062591_101980321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 600 | Open in IMG/M |
| 3300005167|Ga0066672_10947217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9 | 530 | Open in IMG/M |
| 3300005175|Ga0066673_10238067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1051 | Open in IMG/M |
| 3300005176|Ga0066679_10017258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3747 | Open in IMG/M |
| 3300005181|Ga0066678_10649622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 703 | Open in IMG/M |
| 3300005184|Ga0066671_10210696 | Not Available | 1174 | Open in IMG/M |
| 3300005184|Ga0066671_10960194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300005330|Ga0070690_100326380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1107 | Open in IMG/M |
| 3300005332|Ga0066388_101738222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1106 | Open in IMG/M |
| 3300005332|Ga0066388_103950953 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 756 | Open in IMG/M |
| 3300005340|Ga0070689_100329576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1277 | Open in IMG/M |
| 3300005438|Ga0070701_10796434 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300005440|Ga0070705_100116325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1718 | Open in IMG/M |
| 3300005440|Ga0070705_100940771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
| 3300005446|Ga0066686_10783967 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005454|Ga0066687_10196288 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005457|Ga0070662_100711014 | Not Available | 850 | Open in IMG/M |
| 3300005466|Ga0070685_11034948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
| 3300005545|Ga0070695_100110380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1865 | Open in IMG/M |
| 3300005546|Ga0070696_100293679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1242 | Open in IMG/M |
| 3300005547|Ga0070693_100675209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
| 3300005552|Ga0066701_10370174 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005559|Ga0066700_10436858 | Not Available | 920 | Open in IMG/M |
| 3300005560|Ga0066670_10287429 | Not Available | 1000 | Open in IMG/M |
| 3300005566|Ga0066693_10071838 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300005566|Ga0066693_10338630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300005568|Ga0066703_10065816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2065 | Open in IMG/M |
| 3300005568|Ga0066703_10275336 | Not Available | 1020 | Open in IMG/M |
| 3300005568|Ga0066703_10766038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
| 3300005576|Ga0066708_10870523 | Not Available | 563 | Open in IMG/M |
| 3300005578|Ga0068854_101930946 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005615|Ga0070702_100179353 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1385 | Open in IMG/M |
| 3300005617|Ga0068859_101068068 | Not Available | 887 | Open in IMG/M |
| 3300006358|Ga0068871_101129323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
| 3300006794|Ga0066658_10781645 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300006797|Ga0066659_11218683 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9 | 628 | Open in IMG/M |
| 3300006800|Ga0066660_10222340 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300006844|Ga0075428_100034116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5614 | Open in IMG/M |
| 3300006845|Ga0075421_100480397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1479 | Open in IMG/M |
| 3300006847|Ga0075431_100128596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2614 | Open in IMG/M |
| 3300006852|Ga0075433_10268674 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1511 | Open in IMG/M |
| 3300006852|Ga0075433_11617843 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300006853|Ga0075420_100474480 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300006854|Ga0075425_100221912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2174 | Open in IMG/M |
| 3300006854|Ga0075425_101922603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 663 | Open in IMG/M |
| 3300006854|Ga0075425_101970254 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006871|Ga0075434_100190463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2071 | Open in IMG/M |
| 3300006904|Ga0075424_100581858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1195 | Open in IMG/M |
| 3300006954|Ga0079219_12260209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 525 | Open in IMG/M |
| 3300007076|Ga0075435_100439950 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300007076|Ga0075435_100743051 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300009012|Ga0066710_100133103 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
| 3300009012|Ga0066710_102138914 | Not Available | 820 | Open in IMG/M |
| 3300009012|Ga0066710_102374017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 769 | Open in IMG/M |
| 3300009100|Ga0075418_10002280 | All Organisms → cellular organisms → Bacteria | 21931 | Open in IMG/M |
| 3300009137|Ga0066709_100006433 | All Organisms → cellular organisms → Bacteria | 9920 | Open in IMG/M |
| 3300009137|Ga0066709_104285472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300009147|Ga0114129_12631401 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009147|Ga0114129_12791797 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300009156|Ga0111538_11205532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 957 | Open in IMG/M |
| 3300009162|Ga0075423_10168257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2302 | Open in IMG/M |
| 3300009174|Ga0105241_10387649 | Not Available | 1222 | Open in IMG/M |
| 3300009176|Ga0105242_10776288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 946 | Open in IMG/M |
| 3300010321|Ga0134067_10134947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 870 | Open in IMG/M |
| 3300010360|Ga0126372_12638547 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300010375|Ga0105239_12365002 | Not Available | 619 | Open in IMG/M |
| 3300010399|Ga0134127_10872700 | Not Available | 953 | Open in IMG/M |
| 3300010400|Ga0134122_10316991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1345 | Open in IMG/M |
| 3300010401|Ga0134121_10095844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2483 | Open in IMG/M |
| 3300010401|Ga0134121_13302254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300010403|Ga0134123_12111386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 624 | Open in IMG/M |
| 3300011119|Ga0105246_12288523 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300011434|Ga0137464_1172202 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012203|Ga0137399_10835363 | Not Available | 776 | Open in IMG/M |
| 3300012685|Ga0137397_10146674 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1747 | Open in IMG/M |
| 3300012685|Ga0137397_10489623 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 916 | Open in IMG/M |
| 3300012922|Ga0137394_10001139 | All Organisms → cellular organisms → Bacteria | 19230 | Open in IMG/M |
| 3300012922|Ga0137394_10505255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1027 | Open in IMG/M |
| 3300012925|Ga0137419_10113780 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300012925|Ga0137419_10580421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 898 | Open in IMG/M |
| 3300012927|Ga0137416_10752502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 859 | Open in IMG/M |
| 3300012929|Ga0137404_11208596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
| 3300012929|Ga0137404_11718657 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300012944|Ga0137410_10023674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4249 | Open in IMG/M |
| 3300012944|Ga0137410_10598795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 911 | Open in IMG/M |
| 3300013306|Ga0163162_11759955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 708 | Open in IMG/M |
| 3300014326|Ga0157380_11785070 | Not Available | 674 | Open in IMG/M |
| 3300015241|Ga0137418_11239816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300015245|Ga0137409_10046274 | All Organisms → cellular organisms → Bacteria | 4151 | Open in IMG/M |
| 3300015245|Ga0137409_10662295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 876 | Open in IMG/M |
| 3300015264|Ga0137403_10361205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1337 | Open in IMG/M |
| 3300015373|Ga0132257_102278448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 702 | Open in IMG/M |
| 3300015374|Ga0132255_100243659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2565 | Open in IMG/M |
| 3300017792|Ga0163161_10436797 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1056 | Open in IMG/M |
| 3300017939|Ga0187775_10401305 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
| 3300017959|Ga0187779_10535951 | Not Available | 778 | Open in IMG/M |
| 3300018028|Ga0184608_10301812 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 704 | Open in IMG/M |
| 3300018052|Ga0184638_1013617 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2798 | Open in IMG/M |
| 3300018059|Ga0184615_10198512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 1129 | Open in IMG/M |
| 3300018064|Ga0187773_10089305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1498 | Open in IMG/M |
| 3300018064|Ga0187773_10144710 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300018433|Ga0066667_10192224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1490 | Open in IMG/M |
| 3300021090|Ga0210377_10002187 | All Organisms → cellular organisms → Bacteria | 17357 | Open in IMG/M |
| 3300021090|Ga0210377_10207800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1243 | Open in IMG/M |
| 3300025899|Ga0207642_10291206 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 943 | Open in IMG/M |
| 3300025933|Ga0207706_10241167 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300025935|Ga0207709_10940751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 704 | Open in IMG/M |
| 3300025942|Ga0207689_11094051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 672 | Open in IMG/M |
| 3300025972|Ga0207668_11975138 | Not Available | 526 | Open in IMG/M |
| 3300026035|Ga0207703_11204121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 728 | Open in IMG/M |
| 3300026035|Ga0207703_11871191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300026067|Ga0207678_10578623 | Not Available | 984 | Open in IMG/M |
| 3300026142|Ga0207698_12619596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300026313|Ga0209761_1187044 | Not Available | 931 | Open in IMG/M |
| 3300026325|Ga0209152_10206541 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
| 3300026330|Ga0209473_1028970 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300026332|Ga0209803_1206285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 715 | Open in IMG/M |
| 3300026334|Ga0209377_1182712 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300026335|Ga0209804_1044172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2201 | Open in IMG/M |
| 3300026527|Ga0209059_1326367 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026538|Ga0209056_10659072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300026542|Ga0209805_1433849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300027636|Ga0214469_1184266 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
| 3300027907|Ga0207428_10313433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1159 | Open in IMG/M |
| 3300027909|Ga0209382_10405841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1517 | Open in IMG/M |
| 3300028381|Ga0268264_11726736 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 636 | Open in IMG/M |
| 3300028536|Ga0137415_10433707 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1119 | Open in IMG/M |
| 3300028536|Ga0137415_10675321 | Not Available | 845 | Open in IMG/M |
| 3300028592|Ga0247822_10029445 | All Organisms → cellular organisms → Bacteria | 3772 | Open in IMG/M |
| 3300028592|Ga0247822_10411237 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300028812|Ga0247825_10076759 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300028889|Ga0247827_10524087 | Not Available | 745 | Open in IMG/M |
| 3300030336|Ga0247826_10000719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7859 | Open in IMG/M |
| 3300030336|Ga0247826_11135315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300030336|Ga0247826_11480496 | Not Available | 550 | Open in IMG/M |
| 3300031548|Ga0307408_100664486 | Not Available | 933 | Open in IMG/M |
| 3300031716|Ga0310813_10054502 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300031740|Ga0307468_100134556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1553 | Open in IMG/M |
| 3300031740|Ga0307468_101125899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
| 3300031820|Ga0307473_10581628 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300031820|Ga0307473_10838257 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031854|Ga0310904_10309478 | Not Available | 1004 | Open in IMG/M |
| 3300031943|Ga0310885_10070919 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300032002|Ga0307416_103383791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300032013|Ga0310906_10095656 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300032013|Ga0310906_11374544 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032180|Ga0307471_100632452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1231 | Open in IMG/M |
| 3300032180|Ga0307471_102484992 | Not Available | 655 | Open in IMG/M |
| 3300032211|Ga0310896_10046376 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300032421|Ga0310812_10015658 | All Organisms → cellular organisms → Bacteria | 2598 | Open in IMG/M |
| 3300033550|Ga0247829_10672600 | Not Available | 861 | Open in IMG/M |
| 3300033551|Ga0247830_10575546 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 890 | Open in IMG/M |
| 3300034178|Ga0364934_0016530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2646 | Open in IMG/M |
| 3300034665|Ga0314787_031116 | Not Available | 811 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062589_1005524823 | 3300004156 | Soil | SGWTGSGASYRYDATAAGTFKLCASGDSTAANSNGGSTCP* |
| Ga0062589_1005748541 | 3300004156 | Soil | SGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGSTCP* |
| Ga0062590_1001526093 | 3300004157 | Soil | STPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPVACP* |
| Ga0062591_1019803211 | 3300004643 | Soil | IGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFKLCASGDSTAANSNGGSTCP* |
| Ga0066672_109472171 | 3300005167 | Soil | GGPFLNSMPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP* |
| Ga0066673_102380672 | 3300005175 | Soil | NQPLSGALLVQQNNQQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0066679_100172581 | 3300005176 | Soil | AGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP* |
| Ga0066678_106496222 | 3300005181 | Soil | LPAGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP* |
| Ga0066671_102106962 | 3300005184 | Soil | SMPTLPAGWTGSGTSYKYSSSTTGTFMLCGSGDSTGVNSNGGNTCP* |
| Ga0066671_109601942 | 3300005184 | Soil | SLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0070690_1003263802 | 3300005330 | Switchgrass Rhizosphere | SGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0066388_1017382221 | 3300005332 | Tropical Forest Soil | FLNALPSLPGGWTGSGTSYKYTTTVAGSFLVCASGDGTAVDSSAGTTCP* |
| Ga0066388_1039509531 | 3300005332 | Tropical Forest Soil | SMPSMPQGWTGSGTTYKYVSTAAGSYYVCGSGDSTAADSNGGATCP* |
| Ga0070689_1003295761 | 3300005340 | Switchgrass Rhizosphere | QGQIGGPFLNSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP* |
| Ga0070701_107964342 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LNSLPTLPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0070705_1001163251 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AQTNQPLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0070705_1009407711 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | NSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNSAANSNGGPDLLLTAV* |
| Ga0066686_107839671 | 3300005446 | Soil | PFLNSLPTLPAGWTGNGASYRYDATAAGTFQLCASGDTVSVNSNGGTTCP* |
| Ga0066687_101962881 | 3300005454 | Soil | GPFLNSMPTLPAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP* |
| Ga0070662_1007110142 | 3300005457 | Corn Rhizosphere | RLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP* |
| Ga0070685_110349482 | 3300005466 | Switchgrass Rhizosphere | QQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0070695_1001103804 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | NSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP* |
| Ga0070696_1002936791 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | IGGPFLNSLPTLPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0070693_1006752091 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | PFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP* |
| Ga0066701_103701741 | 3300005552 | Soil | GPFLNSLPTLPAGWTGNGASYRYDATAAGTFQLCASGDTVSVNSNGGTTCP* |
| Ga0066700_104368581 | 3300005559 | Soil | GGPFLNSMPTLPAGWTGSGTSYKYSSSSAGTFMLCGSGDSTGVNSNGGNTCP* |
| Ga0066670_102874291 | 3300005560 | Soil | GPFLNSMPTLPAGWTGSGTSYKYSSSTTGTFMLCGSGDSTGVNSNGGNTCP* |
| Ga0066693_100718384 | 3300005566 | Soil | SGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP* |
| Ga0066693_103386301 | 3300005566 | Soil | ALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0066703_100658164 | 3300005568 | Soil | PFLNSMPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP* |
| Ga0066703_102753362 | 3300005568 | Soil | GGPFLNSMPTLPAGWTGSGTSYKYSSSSAGTFMLCGSGDSAGVNSNGGNTCP* |
| Ga0066703_107660382 | 3300005568 | Soil | PTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGTTCP* |
| Ga0066708_108705231 | 3300005576 | Soil | LNAMPTLPAGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP* |
| Ga0068854_1019309462 | 3300005578 | Corn Rhizosphere | QTNGQNQVGGPFLNGSPRLPSGWTGSGVSYKYSSTAAGTFTVCGAGDSTAADSNGGTTCP |
| Ga0070702_1001793534 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | IGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP* |
| Ga0068859_1010680681 | 3300005617 | Switchgrass Rhizosphere | GGPFMNSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSSGGATCP* |
| Ga0068871_1011293231 | 3300006358 | Miscanthus Rhizosphere | AAQTNQPLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0066658_107816451 | 3300006794 | Soil | PTLPSGWTGNAGSYRYDATAAGTFQLCGSGDSTAVNSNGGATCP* |
| Ga0066659_112186831 | 3300006797 | Soil | FLNSMPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTGANSNGGATCP* |
| Ga0066660_102223404 | 3300006800 | Soil | PAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP* |
| Ga0075428_1000341166 | 3300006844 | Populus Rhizosphere | PFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCASGDGTAVDSGGGSSCP* |
| Ga0075421_1004803974 | 3300006845 | Populus Rhizosphere | TGSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP* |
| Ga0075431_1001285961 | 3300006847 | Populus Rhizosphere | AAWTGSGTSYKYSLAANGTFLVCGSGDGTAADSNGGTTCP* |
| Ga0075433_102686741 | 3300006852 | Populus Rhizosphere | QVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP* |
| Ga0075433_102881373 | 3300006852 | Populus Rhizosphere | LVQQTNAQNQVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCGTGDSTAVNSNGGTTCP* |
| Ga0075433_116178433 | 3300006852 | Populus Rhizosphere | TLPAGWTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP* |
| Ga0075420_1004744803 | 3300006853 | Populus Rhizosphere | APTLPAAWTGSGTSYKYSLVANGTFLVCGSGDNTAADSNGGTTCP* |
| Ga0075425_1002219121 | 3300006854 | Populus Rhizosphere | AMPTLPAGWTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP* |
| Ga0075425_1019226033 | 3300006854 | Populus Rhizosphere | LPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP* |
| Ga0075425_1019702541 | 3300006854 | Populus Rhizosphere | TGNAASYRYDATAAGTFQLCASGDGTAANSNGGATCP* |
| Ga0075434_1001904635 | 3300006871 | Populus Rhizosphere | LVQQTNAQNQVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP* |
| Ga0075424_1005818582 | 3300006904 | Populus Rhizosphere | GTSYRYDAGATGTFQLCASGDSTAANSNGGATCP* |
| Ga0079219_122602092 | 3300006954 | Agricultural Soil | SGTSYKYSSSATGTFMICGSGDSTAADSNGGQTCP* |
| Ga0075435_1004399501 | 3300007076 | Populus Rhizosphere | LPQGWTGSGTSYKYSSSATGTFMVCATGDSTGANSNGGVTCP* |
| Ga0075435_1007430513 | 3300007076 | Populus Rhizosphere | LPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0066710_1001331031 | 3300009012 | Grasslands Soil | TLPAGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Ga0066710_1021389141 | 3300009012 | Grasslands Soil | NAASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Ga0066710_1023740172 | 3300009012 | Grasslands Soil | WTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP |
| Ga0075418_100022801 | 3300009100 | Populus Rhizosphere | SMPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPTACP* |
| Ga0066709_1000064331 | 3300009137 | Grasslands Soil | GNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP* |
| Ga0066709_1042854722 | 3300009137 | Grasslands Soil | AQGQIGGPFLNSLPTLPAGWTGNAASYRYDATARGTVEQCESGDSTGANSNGGATCP* |
| Ga0114129_126314012 | 3300009147 | Populus Rhizosphere | AASYRYDATAAGTFQLCASGDGTAANSNGGATCP* |
| Ga0114129_127917972 | 3300009147 | Populus Rhizosphere | QQTNAQNQVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP* |
| Ga0111538_112055322 | 3300009156 | Populus Rhizosphere | GSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP* |
| Ga0075423_101682574 | 3300009162 | Populus Rhizosphere | FLNALPTLPSGWTGSGASYRYDATAAGTFQLCASVDGTAANSNGGATCP* |
| Ga0105241_103876491 | 3300009174 | Corn Rhizosphere | LNSTPTLPAGWGGSGTSYKYTTTAAGTFTICGTGDSTGADSNGGAPTACP* |
| Ga0105242_107762882 | 3300009176 | Miscanthus Rhizosphere | SGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP* |
| Ga0134067_101349473 | 3300010321 | Grasslands Soil | FLNSTPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP* |
| Ga0126372_126385472 | 3300010360 | Tropical Forest Soil | PFLNSSPTLPAGWTGSGTSYKYSSTASGTFMLCATGDSTGANSNAGTNCP* |
| Ga0105239_123650021 | 3300010375 | Corn Rhizosphere | GPFLNALPRLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP* |
| Ga0134127_108727001 | 3300010399 | Terrestrial Soil | AWTGSGTSYKYSLAANGTFLVCGSGDGTAADSNGGTTCP* |
| Ga0134122_103169911 | 3300010400 | Terrestrial Soil | NTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0134121_100958445 | 3300010401 | Terrestrial Soil | FLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0134121_133022542 | 3300010401 | Terrestrial Soil | FMNSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSNGGATCP* |
| Ga0134123_121113861 | 3300010403 | Terrestrial Soil | TQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP* |
| Ga0105246_122885231 | 3300011119 | Miscanthus Rhizosphere | VGGPFMNSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSSGGATCP* |
| Ga0137464_11722021 | 3300011434 | Soil | VGGPFLNNAPTLPAGWTGSGTSYKYTSTSVGTFTPCASGDSTAAYSN* |
| Ga0137399_108353631 | 3300012203 | Vadose Zone Soil | WTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137397_101466744 | 3300012685 | Vadose Zone Soil | FLNSLPTLPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137397_104896231 | 3300012685 | Vadose Zone Soil | ALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP* |
| Ga0137394_1000113923 | 3300012922 | Vadose Zone Soil | SGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137394_105052551 | 3300012922 | Vadose Zone Soil | PLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP* |
| Ga0137419_101137803 | 3300012925 | Vadose Zone Soil | TLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137419_105804211 | 3300012925 | Vadose Zone Soil | SGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137416_107525023 | 3300012927 | Vadose Zone Soil | NTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP* |
| Ga0137404_112085963 | 3300012929 | Vadose Zone Soil | GPFLNSMPTMPQGWTGSGTSYKYSSTASGTYLVCATGDGSGANSNGGITCP* |
| Ga0137404_117186571 | 3300012929 | Vadose Zone Soil | NNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137410_100236741 | 3300012944 | Vadose Zone Soil | GSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137410_105987953 | 3300012944 | Vadose Zone Soil | GALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP* |
| Ga0163162_117599551 | 3300013306 | Switchgrass Rhizosphere | NSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP* |
| Ga0157380_117850702 | 3300014326 | Switchgrass Rhizosphere | VGGPFMNSTPTLPAAWTGSGTSYRYSLNATGTFLVCGIVDNTAADSSGGSTCP* |
| Ga0137418_112398161 | 3300015241 | Vadose Zone Soil | LPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGAVCP* |
| Ga0137409_100462745 | 3300015245 | Vadose Zone Soil | QIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP* |
| Ga0137409_106622953 | 3300015245 | Vadose Zone Soil | QIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP* |
| Ga0137403_103612053 | 3300015264 | Vadose Zone Soil | LSVQVGALQLPSAQTWLSQSLLVQQQNAQNQTGGPFLNAMPTLPAAWTGNGTSYRYDATAAGTFKICASGDSTAANSNGGSVCP* |
| Ga0132257_1022784481 | 3300015373 | Arabidopsis Rhizosphere | RLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGTTCP* |
| Ga0132255_1002436591 | 3300015374 | Arabidopsis Rhizosphere | TAGPFLNALPRLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP* |
| Ga0163161_104367974 | 3300017792 | Switchgrass Rhizosphere | TLPQGWAGSGTSYKYISTTFGTYTVCGSGDSTAADSNGGATCP |
| Ga0187775_104013052 | 3300017939 | Tropical Peatland | GWTGSGTSYKYSSTAVGTFMICGSGDSTAADSNGGTTCP |
| Ga0187779_105359512 | 3300017959 | Tropical Peatland | PFLNSTPTLPAGWTGSGTSYKYSSAATGTFIICGSGDSTAADSNGGTTCP |
| Ga0184608_103018123 | 3300018028 | Groundwater Sediment | QGWTGSGTSYKYSSTAGGVYMVCATGDGTGADSNGGTTCP |
| Ga0184638_10136175 | 3300018052 | Groundwater Sediment | FLNTMPTLPQGWTGSGTSYKYSSTPGGVYMVCATGDGTGADSNGSTTCP |
| Ga0184615_101985121 | 3300018059 | Groundwater Sediment | LPAGWAGSGTSYKYSQTTAGTFMLCGSGDTVGVNSNAGTTCP |
| Ga0187773_100893051 | 3300018064 | Tropical Peatland | NQVGGPFLNSMPTLPAGWTGSGTSYKYSSTAVGTFLICGSGDSTAANSNGGTTCP |
| Ga0187773_101447101 | 3300018064 | Tropical Peatland | GPFLNSLPTLPAGWTGSGTSYKYSSTAVGTFMICGSGDSTAADSNGGTTCP |
| Ga0066667_101922243 | 3300018433 | Grasslands Soil | GWTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP |
| Ga0210377_1000218720 | 3300021090 | Groundwater Sediment | LPAGWTGSGTSYKYSQTVAGTFMLCGSGDSTGADSSGGATCP |
| Ga0210377_102078004 | 3300021090 | Groundwater Sediment | SGASYKYSQTAAGTFMLCGSGDSTAADSSGGSTCP |
| Ga0207642_102912064 | 3300025899 | Miscanthus Rhizosphere | FLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP |
| Ga0207706_102411673 | 3300025933 | Corn Rhizosphere | RLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP |
| Ga0207709_109407512 | 3300025935 | Miscanthus Rhizosphere | SGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP |
| Ga0207689_110940513 | 3300025942 | Miscanthus Rhizosphere | GPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP |
| Ga0207668_119751381 | 3300025972 | Switchgrass Rhizosphere | QGWTGSGTSYKYVSTTFGTYTVCGSGDSTAADSNGGATCP |
| Ga0207703_112041211 | 3300026035 | Switchgrass Rhizosphere | QGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Ga0207703_118711911 | 3300026035 | Switchgrass Rhizosphere | TNQPLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP |
| Ga0207678_105786233 | 3300026067 | Corn Rhizosphere | QIGGPFLNSMPTLPAGWGGSGTSYKYTSTAVGTFVICGTGDSTGADSNGGSPTACP |
| Ga0207698_126195962 | 3300026142 | Corn Rhizosphere | LNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Ga0209761_11870441 | 3300026313 | Grasslands Soil | PTLPAGWTGNGASYRYDATAAGTFALCASGDSTAANSNASATCP |
| Ga0209152_102065413 | 3300026325 | Soil | LPVLPAGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGAVCP |
| Ga0209473_10289701 | 3300026330 | Soil | AGWTGSGTSYKYSSSSTGTFMLCGSGDSTAANSNGGATCP |
| Ga0209803_12062852 | 3300026332 | Soil | GGPFLNSLPTLPAGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Ga0209377_11827121 | 3300026334 | Soil | QPLSPALLVQQNNAQGQLGGPFLNALPTLPSGWTGNGASYRYDATAAGTFALCASGDSTAANSNASTTCP |
| Ga0209804_10441721 | 3300026335 | Soil | QVGGPFLNSTPTLPAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP |
| Ga0209059_13263671 | 3300026527 | Soil | NAAPTLPAGWAGSGTSYKYSSTAAGTFLICGSGDSTAADSAGGATCP |
| Ga0209056_106590721 | 3300026538 | Soil | AGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Ga0209805_14338491 | 3300026542 | Soil | NQVGGPFLNSLPTLPAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP |
| Ga0214469_11842661 | 3300027636 | Soil | MNSMPSLPSGWTGSGVSYKYAIVASGTYLACGSGDGTAANSSGGSTCP |
| Ga0207428_103134334 | 3300027907 | Populus Rhizosphere | LPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP |
| Ga0209382_104058414 | 3300027909 | Populus Rhizosphere | TGSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP |
| Ga0268264_117267362 | 3300028381 | Switchgrass Rhizosphere | TQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP |
| Ga0137415_104337071 | 3300028536 | Vadose Zone Soil | QIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP |
| Ga0137415_106753211 | 3300028536 | Vadose Zone Soil | QIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP |
| Ga0247822_100294455 | 3300028592 | Soil | AVPSLPGGWTGSGTSYKYTTTAAGSFVVCATGDGTAVDSGGGSNCP |
| Ga0247822_104112371 | 3300028592 | Soil | FLNSAPTLPAAWTGSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP |
| Ga0247825_100767591 | 3300028812 | Soil | AEVGQNQLGGPFMMAPPALPSGWTGSGSSYKYSATAAGTFTICASGDSTAADSNGGTTCL |
| Ga0247827_105240872 | 3300028889 | Soil | AGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCATGDGTAVDSGGGSTCP |
| Ga0247826_100007196 | 3300030336 | Soil | AGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCASGDGTAVDSGGGSSCP |
| Ga0247826_111353151 | 3300030336 | Soil | GPFMNSIPSLPAGWTGSGASYKYSIVSSGTFLACGSGDGTAANSSGGNVCP |
| Ga0247826_114804962 | 3300030336 | Soil | PFLNSMPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPTACP |
| Ga0307408_1006644861 | 3300031548 | Rhizosphere | AGNGTTGYKYSTSAAGTFLVCGTGDATGANSNGGVTCP |
| Ga0310813_100545021 | 3300031716 | Soil | SGTSYKYASTAVGTFVICGSGDSTAADSNGGSTCP |
| Ga0307468_1001345561 | 3300031740 | Hardwood Forest Soil | FLNSTPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPVACP |
| Ga0307468_1011258991 | 3300031740 | Hardwood Forest Soil | GPFLNSLPTLPAGWTGSGTSYRYDATAAGTFALCASGDSTAANSNGGATCP |
| Ga0307473_105816282 | 3300031820 | Hardwood Forest Soil | PTLPAGWTGSGTSYKYSSSSTGTFLICGSGDSTAANSNGGTTCP |
| Ga0307473_108382571 | 3300031820 | Hardwood Forest Soil | FLNGSPRLPSGWTGSGTSYKYSSTAAGTFTICGAGDSTAADSNGGTTCP |
| Ga0310904_103094781 | 3300031854 | Soil | SQNQAAGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCASGDGTAVDSGGGSNCP |
| Ga0310885_100709193 | 3300031943 | Soil | WTGSGASYKYSSTAAGTFTICGSGDSTAADSNGGASCP |
| Ga0307416_1033837911 | 3300032002 | Rhizosphere | TGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP |
| Ga0310906_100956563 | 3300032013 | Soil | MNSAPTLPANWAGSGTTYKYSLNATGTFLVCGSGDNSAANSNGGPDLLLTAV |
| Ga0310906_113745441 | 3300032013 | Soil | SPRLPSGWTGSGASYKYSSTAAGTFTICGSGDSTAADSNGGASCP |
| Ga0307471_1006324523 | 3300032180 | Hardwood Forest Soil | TIPAGWTGSGTSYKYSSSSTGTFLICGSGDSTAADSNGGTTCP |
| Ga0307471_1024849921 | 3300032180 | Hardwood Forest Soil | SLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP |
| Ga0310896_100463763 | 3300032211 | Soil | NGQNQVGGPFLNASPRLPSGWTGSGASYKYSSTAAGTFTICGSGDSTAADSNGGASCP |
| Ga0310812_100156581 | 3300032421 | Soil | GGPFLNTMPTLPQGWTGSGTSYKYSSTASGTYLVCATGDSTGANSNGDTTCP |
| Ga0247829_106726001 | 3300033550 | Soil | QNQAAGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCATGDGTAVDSGGGSTCP |
| Ga0247830_105755462 | 3300033551 | Soil | LNGAPRLPATWTGSGTSYKYSLAANGTFLVCGSGDGTAADSNGGTTCP |
| Ga0364934_0016530_2518_2646 | 3300034178 | Sediment | LPAGWTGSGTSYKYASTSVGTFTICGTGDSTAADSNGGATCP |
| Ga0314787_031116_19_165 | 3300034665 | Soil | MNSTPPLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSNGGATCP |
| ⦗Top⦘ |