NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042294

Metagenome / Metatranscriptome Family F042294

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042294
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 53 residues
Representative Sequence DRIKDCGWDVGDLWYNHVFANHPRPRYTTNKVYSKQAEGFSLLDLTVKTWS
Number of Associated Samples 132
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.91 %
% of genes near scaffold ends (potentially truncated) 96.20 %
% of genes from short scaffolds (< 2000 bps) 86.08 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (46.203 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(13.924 % of family members)
Environment Ontology (ENVO) Unclassified
(34.810 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(48.101 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.25%    β-sheet: 7.59%    Coil/Unstructured: 72.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF01467CTP_transf_like 18.35
PF01075Glyco_transf_9 11.39
PF00294PfkB 1.27
PF03237Terminase_6N 0.63
PF136402OG-FeII_Oxy_3 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 11.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.77 %
UnclassifiedrootN/A8.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001352|JGI20157J14317_10028954All Organisms → Viruses → Predicted Viral2948Open in IMG/M
3300001830|ACM40_1039509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium646Open in IMG/M
3300001846|ACM22_1130651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium553Open in IMG/M
3300002363|B570J29624_106285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales716Open in IMG/M
3300002408|B570J29032_109044720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales576Open in IMG/M
3300002408|B570J29032_109406782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales742Open in IMG/M
3300002835|B570J40625_100783479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales841Open in IMG/M
3300002835|B570J40625_100860751All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales789Open in IMG/M
3300002835|B570J40625_101044184All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium695Open in IMG/M
3300002835|B570J40625_101278468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium610Open in IMG/M
3300004096|Ga0066177_10400847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium596Open in IMG/M
3300004240|Ga0007787_10053388All Organisms → Viruses → Predicted Viral1812Open in IMG/M
3300004460|Ga0066222_1144744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales605Open in IMG/M
3300006641|Ga0075471_10352494All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77743Open in IMG/M
3300006867|Ga0075476_10109185All Organisms → Viruses → Predicted Viral1059Open in IMG/M
3300007546|Ga0102874_1129644Not Available790Open in IMG/M
3300007549|Ga0102879_1156048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales697Open in IMG/M
3300007557|Ga0102821_1054059All Organisms → Viruses → Predicted Viral1041Open in IMG/M
3300007562|Ga0102915_1013497Not Available2722Open in IMG/M
3300007562|Ga0102915_1137268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales799Open in IMG/M
3300007625|Ga0102870_1171423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium621Open in IMG/M
3300007630|Ga0102903_1148548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium643Open in IMG/M
3300007649|Ga0102912_1206183All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium564Open in IMG/M
3300007973|Ga0105746_1031489All Organisms → Viruses → Predicted Viral1618Open in IMG/M
3300008107|Ga0114340_1261709All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon520Open in IMG/M
3300008108|Ga0114341_10015578All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon5570Open in IMG/M
3300008110|Ga0114343_1130978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales826Open in IMG/M
3300008113|Ga0114346_1018207All Organisms → Viruses → Predicted Viral3830Open in IMG/M
3300008113|Ga0114346_1073532Not Available1632Open in IMG/M
3300008262|Ga0114337_1008580Not Available8636Open in IMG/M
3300008262|Ga0114337_1247467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales684Open in IMG/M
3300009000|Ga0102960_1297408All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae570Open in IMG/M
3300009079|Ga0102814_10073354All Organisms → Viruses → Predicted Viral1880Open in IMG/M
3300009080|Ga0102815_10787972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium540Open in IMG/M
3300009158|Ga0114977_10061436All Organisms → Viruses → Predicted Viral2313Open in IMG/M
3300009172|Ga0114995_10209668All Organisms → Viruses → Predicted Viral1080Open in IMG/M
3300009441|Ga0115007_10172969All Organisms → Viruses → Predicted Viral1390Open in IMG/M
3300009445|Ga0115553_1029715Not Available2679Open in IMG/M
3300009495|Ga0115571_1108330All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300009599|Ga0115103_1283230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium556Open in IMG/M
3300009705|Ga0115000_10715940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium617Open in IMG/M
3300012012|Ga0153799_1102229All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon508Open in IMG/M
3300012525|Ga0129353_1262092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.535Open in IMG/M
3300012663|Ga0157203_1007828All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1879Open in IMG/M
3300013004|Ga0164293_10482465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales821Open in IMG/M
3300013372|Ga0177922_11164563All Organisms → Viruses → Predicted Viral1342Open in IMG/M
3300016791|Ga0182095_1390076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales891Open in IMG/M
3300017751|Ga0187219_1068086All Organisms → Viruses → Predicted Viral1136Open in IMG/M
3300017763|Ga0181410_1044291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1384Open in IMG/M
3300017766|Ga0181343_1232408All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium500Open in IMG/M
3300017786|Ga0181424_10228631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales782Open in IMG/M
3300017818|Ga0181565_10968568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium528Open in IMG/M
3300017967|Ga0181590_10552836All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales794Open in IMG/M
3300017969|Ga0181585_10582110All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon743Open in IMG/M
3300018418|Ga0181567_10137220All Organisms → Viruses → Predicted Viral1692Open in IMG/M
3300018421|Ga0181592_10427353All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales930Open in IMG/M
3300018424|Ga0181591_10229929All Organisms → Viruses → Predicted Viral1444Open in IMG/M
3300018428|Ga0181568_10175453All Organisms → Viruses → Predicted Viral1781Open in IMG/M
3300020051|Ga0181555_1272518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium604Open in IMG/M
3300020055|Ga0181575_10216196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1121Open in IMG/M
3300020141|Ga0211732_1329166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium561Open in IMG/M
3300020141|Ga0211732_1477197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium656Open in IMG/M
3300020141|Ga0211732_1583440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales640Open in IMG/M
3300020151|Ga0211736_10291171All Organisms → Viruses → Predicted Viral1410Open in IMG/M
3300020159|Ga0211734_10024647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.815Open in IMG/M
3300020161|Ga0211726_10300717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales894Open in IMG/M
3300020162|Ga0211735_11231223All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1887Open in IMG/M
3300020188|Ga0181605_10118021All Organisms → Viruses → Predicted Viral1310Open in IMG/M
3300020205|Ga0211731_10941538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium694Open in IMG/M
3300020205|Ga0211731_11338536All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon546Open in IMG/M
3300020207|Ga0181570_10079958All Organisms → Viruses → Predicted Viral1882Open in IMG/M
3300020222|Ga0194125_10160654All Organisms → cellular organisms → Bacteria1688Open in IMG/M
3300020527|Ga0208232_1004225All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon2422Open in IMG/M
3300020527|Ga0208232_1040662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium609Open in IMG/M
3300020539|Ga0207941_1031664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.731Open in IMG/M
3300020541|Ga0208359_1037039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales743Open in IMG/M
3300020562|Ga0208597_1026971All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1248Open in IMG/M
3300020562|Ga0208597_1036800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae994Open in IMG/M
3300020563|Ga0208082_1054616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium681Open in IMG/M
3300020810|Ga0181598_1071470All Organisms → Viruses → Predicted Viral1587Open in IMG/M
3300021092|Ga0194122_10163498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1189Open in IMG/M
3300021141|Ga0214163_1077404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales804Open in IMG/M
3300021438|Ga0213920_1098041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium560Open in IMG/M
3300021961|Ga0222714_10294603All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon892Open in IMG/M
3300021962|Ga0222713_10751321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium550Open in IMG/M
3300021963|Ga0222712_10090529All Organisms → Viruses → Predicted Viral2163Open in IMG/M
3300021963|Ga0222712_10623416All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium619Open in IMG/M
3300021963|Ga0222712_10625566All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium618Open in IMG/M
3300022927|Ga0255769_10013900Not Available6264Open in IMG/M
3300022928|Ga0255758_10320377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium650Open in IMG/M
3300023087|Ga0255774_10012715Not Available5544Open in IMG/M
3300023105|Ga0255782_10074437All Organisms → Viruses → Predicted Viral1843Open in IMG/M
3300023108|Ga0255784_10448925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium601Open in IMG/M
3300023110|Ga0255743_10337789All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales764Open in IMG/M
3300023180|Ga0255768_10247234All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300024223|Ga0228601_1067794All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon508Open in IMG/M
3300024228|Ga0228633_1047938All Organisms → Viruses → Predicted Viral1085Open in IMG/M
3300024236|Ga0228655_1047074All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon998Open in IMG/M
3300024291|Ga0228660_1045628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales837Open in IMG/M
3300024319|Ga0228670_1095946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium599Open in IMG/M
3300024328|Ga0228635_1142131All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon506Open in IMG/M
3300024329|Ga0228631_1040144All Organisms → Viruses → Predicted Viral1327Open in IMG/M
3300024346|Ga0244775_10577249All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon914Open in IMG/M
3300025701|Ga0209771_1058864All Organisms → Viruses → Predicted Viral1386Open in IMG/M
3300025704|Ga0209602_1002067Not Available16859Open in IMG/M
3300025767|Ga0209137_1259811All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon546Open in IMG/M
3300025828|Ga0208547_1078417All Organisms → Viruses → Predicted Viral1061Open in IMG/M
3300025880|Ga0209534_10011578Not Available7036Open in IMG/M
3300025880|Ga0209534_10015836All Organisms → cellular organisms → Bacteria5747Open in IMG/M
3300026123|Ga0209955_1097509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium537Open in IMG/M
3300026483|Ga0228620_1118986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium524Open in IMG/M
3300026506|Ga0228604_1008599All Organisms → Viruses → Predicted Viral1255Open in IMG/M
3300027631|Ga0208133_1066581All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300027631|Ga0208133_1152742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium532Open in IMG/M
3300027649|Ga0208960_1093443Not Available829Open in IMG/M
3300027734|Ga0209087_1065211All Organisms → Viruses → Predicted Viral1620Open in IMG/M
3300027746|Ga0209597_1010797All Organisms → cellular organisms → Archaea5306Open in IMG/M
3300027779|Ga0209709_10171983All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300027782|Ga0209500_10021157All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon3785Open in IMG/M
3300027804|Ga0209358_10017886All Organisms → cellular organisms → Bacteria4548Open in IMG/M
3300027883|Ga0209713_10694000All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon650Open in IMG/M
3300028129|Ga0228634_1013398All Organisms → Viruses → Predicted Viral2713Open in IMG/M
3300028273|Ga0228640_1009697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1821Open in IMG/M
3300028275|Ga0255174_1021437All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1197Open in IMG/M
3300028414|Ga0228627_1042382All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300031519|Ga0307488_10185406All Organisms → Viruses → Predicted Viral1424Open in IMG/M
3300031784|Ga0315899_11548529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium553Open in IMG/M
3300031787|Ga0315900_10083431Not Available3183Open in IMG/M
3300031787|Ga0315900_10294543All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1349Open in IMG/M
3300031851|Ga0315320_11000033All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon505Open in IMG/M
3300031857|Ga0315909_10800550Not Available596Open in IMG/M
3300031951|Ga0315904_10817191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales765Open in IMG/M
3300031951|Ga0315904_11035887All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon647Open in IMG/M
3300031963|Ga0315901_10545982All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon892Open in IMG/M
3300031963|Ga0315901_10770439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium702Open in IMG/M
3300032050|Ga0315906_10231624All Organisms → Viruses → Predicted Viral1713Open in IMG/M
3300033996|Ga0334979_0154997All Organisms → Viruses → Predicted Viral1382Open in IMG/M
3300033996|Ga0334979_0491684All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon665Open in IMG/M
3300034018|Ga0334985_0256212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1120Open in IMG/M
3300034018|Ga0334985_0453419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales752Open in IMG/M
3300034019|Ga0334998_0316468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales921Open in IMG/M
3300034021|Ga0335004_0639634All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium557Open in IMG/M
3300034064|Ga0335001_0215699All Organisms → Viruses → Predicted Viral1068Open in IMG/M
3300034066|Ga0335019_0257540All Organisms → Viruses → Predicted Viral1109Open in IMG/M
3300034066|Ga0335019_0369637All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon883Open in IMG/M
3300034093|Ga0335012_0028170All Organisms → cellular organisms → Archaea3311Open in IMG/M
3300034102|Ga0335029_0217583All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1256Open in IMG/M
3300034102|Ga0335029_0768070All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon512Open in IMG/M
3300034104|Ga0335031_0233901All Organisms → Viruses → Predicted Viral1227Open in IMG/M
3300034104|Ga0335031_0330077All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon982Open in IMG/M
3300034108|Ga0335050_0500131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium520Open in IMG/M
3300034110|Ga0335055_0135468All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300034117|Ga0335033_0208574All Organisms → Viruses → Predicted Viral1049Open in IMG/M
3300034117|Ga0335033_0444669All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon631Open in IMG/M
3300034272|Ga0335049_0547323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales727Open in IMG/M
3300034284|Ga0335013_0083927All Organisms → Viruses → Predicted Viral2252Open in IMG/M
3300034356|Ga0335048_0453596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.624Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.92%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh12.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater8.23%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.59%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.70%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.43%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.80%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.16%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.53%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.53%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.53%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.90%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.90%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.90%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.27%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton1.27%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.27%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.63%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.63%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.63%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.63%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.63%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.63%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.63%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001830Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3lEnvironmentalOpen in IMG/M
3300001846Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25bEnvironmentalOpen in IMG/M
3300002363Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300016791Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020051Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020188Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020207Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020539Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020541Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020562Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020563Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020810Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022927Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaGEnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300023087Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaGEnvironmentalOpen in IMG/M
3300023105Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaGEnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300024223Seawater microbial communities from Monterey Bay, California, United States - 1DEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024236Seawater microbial communities from Monterey Bay, California, United States - 67DEnvironmentalOpen in IMG/M
3300024291Seawater microbial communities from Monterey Bay, California, United States - 74DEnvironmentalOpen in IMG/M
3300024319Seawater microbial communities from Monterey Bay, California, United States - 85DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300026123Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026483Seawater microbial communities from Monterey Bay, California, United States - 23DEnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300028275Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8dEnvironmentalOpen in IMG/M
3300028414Seawater microbial communities from Monterey Bay, California, United States - 33DEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20157J14317_1002895413300001352Pelagic MarineEKQWWLDRIEDCEWDVADLWYNHVFYHHPRPRYTTNKMYSNQAEGFSLLDLTNKTWK*
ACM40_103950923300001830Marine PlanktonWYNHVFYQHPEKRYTTNKVYSKQAEGYSLLDLKNKTWL*
ACM22_113065113300001846Marine PlanktonDRIKDCEWDAADLWYNHVFYQHPEKRYTTNKVYSKQAEGYSLLDLKNKTWL*
B570J29624_10628513300002363FreshwaterREKQWWMDRLVDCGWDVGDLWYNHVFINHPRLRYTTNKVYSKQAEGFSLLDLTVKTWS*
B570J29032_10904472013300002408FreshwaterDVGDLWFNHVFHNHPRPRYTTNKMYSKQAEGYSLLDLTVKTWNT*
B570J29032_10940678223300002408FreshwaterWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
B570J40625_10078347923300002835FreshwaterQWWADRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
B570J40625_10086075113300002835FreshwaterGDLWYNHVFANHPKPRYTTNKVYSNQGAGYSLLDETIKKWEL*
B570J40625_10104418423300002835FreshwaterYLIPNRTKGWWLDRIVDCGWDVGDLWFNHVFYHHPMKRYTTNKVYSKQAEGFSLLDLTIKTWS*
B570J40625_10127846813300002835FreshwaterGDLWFNHVFHNHPKLRVTTNKVYSKQAEGYSLLDETVKTWS*
Ga0066177_1040084713300004096Freshwater LakeDRLKDCGWDVGDLWYNHVFANYSRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
Ga0007787_1005338833300004240Freshwater LakeDCGWDVGDLWFNHVFHNHPKLRVTTNKVYSKQAEGYSLLDETVKTWS*
Ga0066222_114474423300004460MarineSSDVCSSDLNHVFYHHQRPRYTTNKMYSNQAEGFSLLDLTNKTWK*
Ga0075471_1035249413300006641AqueousVANRHKNWWTARIQDCEWDVGDLWFNHIFCHHPQLRYTTNKVYSRQADGYSLLDRTVKTW
Ga0075476_1010918523300006867AqueousWAHAYLIPNRDKQWYMDRIKDCEWDVADLWYNHVFYNHKRLRYTTHYPYSKQAEGVSLLDNTNKSWK*
Ga0102874_112964413300007546EstuarineKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
Ga0102879_115604813300007549EstuarineNHVFINHPRPRYTTNKMYSKQAEGFSLLDLTVKTWS*
Ga0102821_105405913300007557EstuarineWDVADLWYNHVFFHHHRPRYTTNKVYSKQAEGFSLLDLTNKTWK*
Ga0102915_101349713300007562EstuarineVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
Ga0102915_113726813300007562EstuarineIVDCGWDVGDLWFNHVFYNHPKPRYTTNKVYSKQAEGFSLLDLTVKTWS*
Ga0102870_117142323300007625EstuarineDVGDLWYNHVFINHPRLRYTTNKVYSKQAEGFSLLDLTVKTWS*
Ga0102903_114854813300007630EstuarineADRLNDCGWDVGDLWYNHVFINHPRPRYTTNKMYSKQAEGFSLLDLTVKTWS*
Ga0102912_120618313300007649EstuarineNRTKGWWMDRLIDCGWDVGDLWFNHVFYHHPMKRYTTNKVYSKQAEGFSLLDLTVKTWS*
Ga0105746_103148933300007973Estuary WaterRTKGWWMDRLEDCGWDVGDLWYNHVFHNHPKARYTTNKVYSKQAEGYSLLDETVKTWS*
Ga0114340_126170913300008107Freshwater, PlanktonKTAYNQDLAHAYLIPNRTKGWWMERLKDCGWDVGDLWYNHVFANHPKLRYTTNKMYSKQAEGYSLLDLMVKTWN*
Ga0114341_1001557833300008108Freshwater, PlanktonMDRLVDCGWDVGDLWYNHVFYNHPKNRYTTNKVYSKQAEGFSLLDLTVKTWS*
Ga0114343_113097823300008110Freshwater, PlanktonDVGDLWYNHVFYHHPKPRYTTNKVYSKQAEGYSLLDETIKTWS*
Ga0114346_101820713300008113Freshwater, PlanktonRLKDCGWDVGDLWYNHVFANHPKLRYTTNKMYSKQAEGYSLLDLMVKTWN*
Ga0114346_107353233300008113Freshwater, PlanktonLDRIVDCGWDVGDLWYNHVFANHPKLRYTTNKMYSKQAEGFSLLDLTVKTWS*
Ga0114337_100858013300008262Freshwater, PlanktonNRTKGWWLDRIVDCGWDVGDLWFNHVFYNHPKPRYTTNKVYSKQAEGFSLLDLTVKTWS*
Ga0114337_124746723300008262Freshwater, PlanktonNRTKGWWLDRIVDCGWDVGDLWFNHVFYNHPKPRYTTNEVYSKQAEGFSLLDLTVKTWS*
Ga0102960_129740813300009000Pond WaterHVFYNHPRPRYTTNKVYSKQAEGYSLLDEKVKVW*
Ga0102814_1007335443300009079EstuarineNREKQWWADRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
Ga0102815_1078797213300009080EstuarineVFFHHHRPRYTTNKVYSKQAEGFSLLDLTNKTWK*
Ga0114977_1006143653300009158Freshwater LakeYLIPNREKQWWADRLKDCGWDVGDLWYNHVFANYSRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
Ga0114995_1020966823300009172MarineMDRIEDCEWDVADLWYNHVFYNHKRNRYTTNYPFSKQAEGLSLLDNTNKSWK*
Ga0115007_1017296913300009441MarineKDCEWDVADLWYNHVFYHHQRPRYTTNKMYSKQAEGFSLLDLTNKTWK*
Ga0115553_102971553300009445Pelagic MarineDWAHAYLIPNRDKQWYMDRIEDCEWDVADLWYNHVFYNHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK*
Ga0115571_110833013300009495Pelagic MarineKQWYMDRIKDCEWDVADLWYNHVFFNHRRKRYTTNYPFSKQAEGLSLLDNTNKSWK*
Ga0115103_128323023300009599MarineDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK*
Ga0115000_1071594023300009705MarineEWWLDRIKDCEWDVADLWYNHVFYHHQRPRYTTNKMYSNQAEGFSLLDLTNKTWK*
Ga0153799_110222913300012012FreshwaterTKQWWADRIIDCGWDVGDLWFNHVFYNHPKPRYTTNKMYSKQAEGFSLLDLTVKTWS*
Ga0129353_126209213300012525AqueousAYLIPNRDKQWYMDRIKDCEWDVADLWYNHVFYNHKRLRYTTHYPYSKQAEGVSLLDNTNKSWK*
Ga0157203_100782813300012663FreshwaterGWDVGDLWFNHVFYNHPKPRYTTNKMYSKQAEGYSLLDLTVKTWNT*
Ga0164293_1048246523300013004FreshwaterLIPNRTKGWWMERLDDCGWDVGDLWFNHVFYHHPMKRYTTNKMYSKQAEGYSLLDLTVKTWS*
Ga0177922_1116456323300013372FreshwaterDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS*
Ga0182095_139007613300016791Salt MarshRIKDCEWDVGDLWYNHVFYNHPRKRYTTNKVYSLQANGFSLLDLRSKTWN
Ga0187219_106808613300017751SeawaterAYLIPNRDKQWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0181410_104429133300017763SeawaterWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0181343_123240813300017766Freshwater LakeHVFANHPKLRYTTNKMYSKQAEGFSLLDLTVKTWN
Ga0181424_1022863113300017786SeawaterDCEWDVADLWYNHVFFNHRRKRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0181565_1096856823300017818Salt MarshFDRINDCEWDVGDLWLNHVFFTHPRLRYTTNKVYSLQADGFSLLDLYDKKWS
Ga0181590_1055283623300017967Salt MarshPNRDKQWYMDRIKDCEWDVADLWYNHVFYNHKRLRYTTNYPFSKQAEGVSLLDNTNKSWK
Ga0181585_1058211023300017969Salt MarshAYLIPNREKQWYMDRIEDCEWDVADLWYNHVFYHHRRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0181567_1013722033300018418Salt MarshAYLIPNRDKQWYMDRIKDCEWDVADLWYNHVFYNHKRLRYTTNYPFSKQAEGVSLLDNTNKSWK
Ga0181592_1042735323300018421Salt MarshNQDLAHAYLIPNRDKGWWMDRIKDCEWDVGDLWYNHVFYNHPRKRYTTNKVYSLQANGFSLLDLTSKTWN
Ga0181591_1022992913300018424Salt MarshWYMDRIKDCEWDVADLWYNHVFYHHRRPRYTTQYRYSKQVEGVSLLDNTNKSWK
Ga0181568_1017545313300018428Salt MarshKDCEWDVGDLWLNHVFYTHPRPRYTTNKVYSLQADGFSLLDLYDKKWS
Ga0181555_127251823300020051Salt MarshWWLDRIKDCKWDVADLWYNHVFYEHPEKRYTTNKVYSKQAEGYSLLDLKNKTWL
Ga0181575_1021619613300020055Salt MarshNRDKQWYMDRIKDCEWDVADLWYNHVFYHHRRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0211732_132916613300020141FreshwaterAYIVRNKDKSWWMDRLVDCGWDVGDLWYNHVFANHPMLRYTTNKVYSNQGAGYSLLDETVKKWEL
Ga0211732_147719713300020141FreshwaterDREWWYDRIKDCEWDVGDLWFNHVFYHHDQHRYTTNKLYSNQAEGYSLLDDTIKTWQV
Ga0211732_158344023300020141FreshwaterLIPNREKQWWLDRIKDCGWDVGDLWFNHVFANHPRPRYTTNKMYSKQAEGFSLLDLTVKTWS
Ga0211736_1029117113300020151FreshwaterKTKSWWMDRLVDCGWDVGDLWFNHVFHNHPKLRVTTNKVYSKQAEGYSLLDETVKTWS
Ga0211734_1002464713300020159FreshwaterHNQDLAHAYLIPNRKKQWWIDRIADCEWDVADLWYNHVFYNHPEKRYTTNKMYSKQAEGYSLLDLTVKTWS
Ga0211726_1030071713300020161FreshwaterGDLWFNHVFANYSRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0211735_1123122333300020162FreshwaterKTGHNQDLAHAYLIPNRTKQWWLDRIKDCTWDVADLWYNHVFYHHPKPRYTTNKMYSKQAEGYSLLDQTVKTWNV
Ga0181605_1011802123300020188Salt MarshCEWDVADLWYNHVFYHHPEKRYTTNKVYSKQAEGFSLLDLTNKTWK
Ga0211731_1094153823300020205FreshwaterIPNRCKQWYMDRLADCTWDVADLWYNHVFYHHPKLRYTTTKMYSKQAEGYSLLDETVKTW
Ga0211731_1133853623300020205FreshwaterWIDRIADCEWDVADLWYNHVFYNHPEKRYTTNKMYSKQAEGYSLLDLTVKTWS
Ga0181570_1007995843300020207Salt MarshKEWYMDRIKDCEWDVADLWYNHVFYNHQRLRYTTNYPFSKQAEGVSLLDNTNKSWK
Ga0194125_1016065433300020222Freshwater LakeGWWMERIKDCGWDVGDLWYNHVFYHHPQKRYTTNKIYSKQAEGYSLLDLQIKTWS
Ga0208232_100422543300020527FreshwaterQWWVDRLKDCGWDVGDLWYNHVFINHPRPRYTTNKMYSKQAEGFSLLDLTVKTWS
Ga0208232_104066213300020527FreshwaterDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0207941_103166423300020539FreshwaterNRTKQWWMDRIEDCGWDVGDLWYNHVFANHPKPRYTTNKMYSKQAEGYSLLDETVKTWS
Ga0208359_103703913300020541FreshwaterGDLWYNHVFANHPKPRYTTNKVYSNQGAGYSLLDETIKKWEL
Ga0208597_102697113300020562FreshwaterLIPNREKQWWMDRLVDCGWDVGDLWYNHVFINHPRLRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0208597_103680023300020562FreshwaterNHVFYDHRHLRYTTNKNYSKQAEGYSLLDEKIKSWKENWN
Ga0208082_105461623300020563FreshwaterGWDVGDLWYNHVFINHPRLRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0181598_107147013300020810Salt MarshCEWDVADLWYNHVFYHHQRPRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0194122_1016349813300021092Freshwater LakeNHVFYNHPQKRYTTNKIYSKQAEGYSLLDLQIKTWS
Ga0214163_107740423300021141FreshwaterWADRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0213920_109804123300021438FreshwaterNHVFYHHPKPRYTTNKMYSKQAEGYSLLDQTVKTWNV
Ga0222714_1016569423300021961Estuarine WaterDLFSKTGHNQDLAHAYLIPNRTKQWWLDRIKDCTWDVADLWYNHVFYHHPKPRYTTNKMYSKQAEGYSLLDQTVKTWNV
Ga0222714_1029460323300021961Estuarine WaterWMERIKDCGWDVGDLWFNHVFANHPKLRYTTNKMYSKQAEGYSLLDETIKTWS
Ga0222713_1075132123300021962Estuarine WaterKQWWADRLKDCGWDVGDLWYNHVFINHPRPRYTTNKMYSKQAEGFSLLDLTVKTWS
Ga0222712_1009052943300021963Estuarine WaterEKQWWADRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0222712_1062341623300021963Estuarine WaterVGDLWYNHVFINHPRPRYTTNKMYSKQAEGFSLLDLTVKTWS
Ga0222712_1062556613300021963Estuarine WaterDLAHAYLIPNRTKGWWMERIKDCGWDVGDLWYNHVFYNHPKNRYTTNKIYSKQAEGFSLLDLTVKTWS
Ga0255769_1001390063300022927Salt MarshDCEWDVADLWYNHVFYHHQRPRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0255758_1032037723300022928Salt MarshVADLWYNHVFYEHPEKRYTTNKVYSKQAEGYSLLDLKNKTWL
Ga0255774_1001271513300023087Salt MarshKDCEWDVADLWYNHVFYHHRRPRYTTQYRYSKQVEGVSLLDNTNKSWK
Ga0255782_1007443713300023105Salt MarshYMDRIKDCEWDVADLWYNHVFYHHRRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0255784_1044892523300023108Salt MarshCEWDVADLWYNHVFYNHQRLRYTTNYPFSKQAEGVSLLDNTNKSWK
Ga0255743_1033778923300023110Salt MarshEWDVADLWYNHVFYHHRRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0255768_1024723413300023180Salt MarshAHAYLIPNRKKQWWLDRIKDCKWDVADLWYNHVFYEHPEKRYTTNKVYSKQAEGYSLLDLKNKTWL
Ga0228601_106779423300024223SeawaterDWAHAYLIPNRDKQWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0228633_104793823300024228SeawaterYNQDWAHAYLIPNRDKQWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0228655_104707413300024236SeawaterRIKDCEWDVADLWYNHVFFNHRRKRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0228660_104562813300024291SeawaterYLIPNRDKQWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0228670_109594613300024319SeawaterIKDCEWDVADLWYNHVFYHHPRLRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0228635_114213123300024328SeawaterAYLIPNRDKQWYMDRIKDCEWDVADLWYNHVFYHHPRLRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0228631_104014413300024329SeawaterPNRDKQWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0244775_1057724923300024346EstuarineWWLDRIVDCGWDVGDLWFNHVFYNHPKPRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0209771_105886423300025701MarineHAYLIPNREKEWWLDRIKDCEWDVADLWYNHVFYHHQRPRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0209602_1002067183300025704Pelagic MarineWWLDRIEDCEWDVADLWYNHVFYHHPRPRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0209137_125981113300025767MarineSDFNQDWAHAYLIPNRDKGWYMDRIKDCEWDVADLWYNHVFYHHPRPRYTTNYRYSKQAEGISLLDNTNKSWK
Ga0208547_107841723300025828AqueousWAHAYLIPNRDKQWYMDRIKDCEWDVADLWYNHVFYNHKRLRYTTHYPYSKQAEGVSLLDNTNKSWK
Ga0209534_1001157813300025880Pelagic MarineWDVADLWYNHVFYHHPRPRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0209534_1001583663300025880Pelagic MarineADLWYNHVFYHHPRPRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0209955_109750923300026123WaterWYNHVFYEHPEKRYTTNKVYSKQAEGYSLLDLKNKTWL
Ga0228620_111898623300026483SeawaterNRDKQWYMDRIKDCEWDVADLWYNHVFYHHPRLRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0228604_100859913300026506SeawaterYRDKQWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYHFSKQAEGLSLLDNTNKSWK
Ga0208133_106658123300027631EstuarineVFYNHPRPRYTTNKMYSKQAEGYSLLDLTVKTWNT
Ga0208133_115274213300027631EstuarineDRIKDCGWDVGDLWYNHVFANHPRPRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0208960_109344323300027649Freshwater LenticCYLIPNREKQWWADRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0209087_106521113300027734Freshwater LakeFYDHRHLRYTTNKNYSKQAEGYSLLDEKIKSWKENWN
Ga0209597_101079763300027746Freshwater LakeLDRIVDCGWDVGDLWYNHVFFHHPRLRYTTNKMYSKQAEGYSLLDETIKTWS
Ga0209709_1017198323300027779MarineYNQDWAHAYLIPNREKQWYMDRIKDCEWDVADLWYNHVFYNHKRNRYTTNYPFSKQAEGISLLDNTNKSWK
Ga0209500_1002115743300027782Freshwater LakeHVFANNPRPRYTTNKMYSKQAEGFSLLDLTIKTWS
Ga0209358_1001788613300027804Freshwater LakeNHVFYHHPMKRYTTNKMYSKQAEGFSLLDLTVKTWS
Ga0209713_1069400023300027883MarineMDRIEDCEWDVADLWYNHVFYNHKRNRYTTNYPFSKQAEGISLLDNTNKSWK
Ga0228634_101339853300028129SeawaterLIPNRDKQWYMDRIKDCEWDVADLWYNHVFYHHPRLRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0228640_100969743300028273SeawaterRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0255174_102143723300028275FreshwaterAYLIPNRTKGWWMERIKDCGWDVGDLWFNHVFYNHPKNRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0228627_104238213300028414SeawaterYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0307488_1018540613300031519Sackhole BrineRIKDCEWDVADLWYNHVFYHHQRPRYTTNKMYSNQAEGFSLLDLTNKTWK
Ga0315899_1154852923300031784FreshwaterDCEWDVGDLWFNHVFYNHDQHRYTTNKLYSNQAEGYSLLDDTIKTWQV
Ga0315900_1008343153300031787FreshwaterAYLIPNRTKGWWMERIKDCGWDVGDLWYNHVFYNHPKNRYTTNKIYSKQAEGFSLLDLTVKTWS
Ga0315900_1029454323300031787FreshwaterVRNKDRQWWNDRIKDCEWDVGDLWFNHIFYHHHELRYTTNKLYSNQAEGYSLLDNTIKTWQV
Ga0315320_1100003323300031851SeawaterNAYLIPNRDKQWYMDRIEDCEWDVADLWYNHVFYHHKRLRYTTNYPFSKQAEGLSLLDNTNKSWK
Ga0315909_1080055023300031857FreshwaterKGWWMDRIKDCGWDVGDLWYNHVFYHHPMKRYTTNKMYSKQAEGYSLLDLTVKTWS
Ga0315904_1081719123300031951FreshwaterGWDVGDLWYNHVFYHHPMKRYTTNKMYSKQAEGYSLLDLTVKTWS
Ga0315904_1103588723300031951FreshwaterTGANQDLAHAYLIPNRTKSWWMDRLNDCGWDVGDLWFNHVFYHHPMKRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0315901_1054598223300031963FreshwaterHNQDLAHAYLVRNKDRQWWNDRIKDCEWDVGDLWFNHIFYHHHELRYTTNKLYSNQAEGYSLLDNTIKTWQV
Ga0315901_1077043923300031963FreshwaterWWMERLKDCGWDVDDLWYNHVFANHPKLRYTTNKMYSKQAEGYSLLDLMVKTWN
Ga0315906_1023162413300032050FreshwaterWMDRLNDCGWDVGDLWFNHVFYHHPMKRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0334979_0154997_1240_13803300033996FreshwaterCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0334979_0491684_429_6653300033996FreshwaterELFSKTAFNQDLAHAYLIPNRTKQWWMDRIVDCGWDVGDLWFNHVFYNHPKPRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0334985_0256212_2_1123300034018FreshwaterNHVFYNHPKPRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0334985_0453419_2_1483300034018FreshwaterVDCGWDVGDLWFNHVFYNHPKPRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0334998_0316468_3_1643300034019FreshwaterHDRIKDCEWDVGDLWFNHVFYNHDQHRYTTNKLYSNQAEGYSLLDDTIKTWQV
Ga0335004_0639634_370_5553300034021FreshwaterRNKDREWWHDRIKDCEWDVGDLWFNHVFCHHDQHRYTTNKLYSNQAEGYSLLDDTIKTWQ
Ga0335001_0215699_882_10673300034064FreshwaterIPNREKQWWADRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTW
Ga0335019_0257540_2_1363300034066FreshwaterWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0335019_0369637_724_8823300034066FreshwaterADRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0335012_0028170_2_1483300034093FreshwaterDDCGWDVGDLWFNHVFYHHPMKRYTTNKMYSKQAEGYSLLDLTVKTWS
Ga0335029_0217583_1121_12553300034102FreshwaterWDVGDLWFNHVFYNHPKNRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0335029_0768070_311_4693300034102FreshwaterMDRLVDCGWDVGDLWFNHVFHHHPKLRVTTNKVYSKQAEGYSLLDETVKTWS
Ga0335031_0233901_1063_12213300034104FreshwaterMDRIEDCGWDVGDLWYNHVFANHPKPRYTTNKMYSKQAEGYSLLDETVKTWS
Ga0335031_0330077_846_9803300034104FreshwaterWDVGDLWFNHVFYNHPKPRYTTNKVYSKQAEGFSLLDLTVKTWS
Ga0335050_0500131_403_5193300034108FreshwaterFNHVFYNHPRPRYTTNKMYSKQAEGYSLLDLTVKTWNT
Ga0335055_0135468_3_2033300034110FreshwaterHAYLVRNKDREWWHDRIKDCEWDVGDLWFNHVFYNHDQHRYTTNKLYSNQAEGYSLLDDTIKTWQV
Ga0335033_0208574_921_10493300034117FreshwaterVGDLWYNHVFANHPKPRYTTNKMYSKQAEGYSLLDETVKTWS
Ga0335033_0444669_5_2413300034117FreshwaterLFSQTAHNQDLAHAYLVRNKDKQWWKDRIADCEWDVGDLWYNHVFAKYPMKRYTTNKMCSNQTEGFSLLDQTIKTWNV
Ga0335049_0547323_1_1383300034272FreshwaterGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0335013_0083927_2098_22503300034284FreshwaterRLKDCGWDVGDLWYNHVFANYPRPRYTTNKLYSKQAEGFSLLDLTVKTWS
Ga0335048_0453596_482_6223300034356FreshwaterVGDLWYNHVFYDHRHLRYTTNKNYSKQAEGYSLLDEKIKSWKENWN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.