| Basic Information | |
|---|---|
| Family ID | F042205 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MFASLVNRVTALFRRKRCPECGHKVRQTYCDVCGYDLIEQTRDKALYRR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.00 % |
| % of genes near scaffold ends (potentially truncated) | 29.11 % |
| % of genes from short scaffolds (< 2000 bps) | 88.61 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.823 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (22.152 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.709 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.557 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.97% β-sheet: 6.49% Coil/Unstructured: 67.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF01022 | HTH_5 | 10.13 |
| PF13847 | Methyltransf_31 | 5.06 |
| PF13239 | 2TM | 5.06 |
| PF03176 | MMPL | 3.80 |
| PF05988 | DUF899 | 3.16 |
| PF12697 | Abhydrolase_6 | 3.16 |
| PF12849 | PBP_like_2 | 1.27 |
| PF13463 | HTH_27 | 1.27 |
| PF03992 | ABM | 1.27 |
| PF01451 | LMWPc | 1.27 |
| PF02525 | Flavodoxin_2 | 1.27 |
| PF01814 | Hemerythrin | 0.63 |
| PF07366 | SnoaL | 0.63 |
| PF14310 | Fn3-like | 0.63 |
| PF07883 | Cupin_2 | 0.63 |
| PF08241 | Methyltransf_11 | 0.63 |
| PF12840 | HTH_20 | 0.63 |
| PF13450 | NAD_binding_8 | 0.63 |
| PF13358 | DDE_3 | 0.63 |
| PF12681 | Glyoxalase_2 | 0.63 |
| PF03706 | LPG_synthase_TM | 0.63 |
| PF09922 | DUF2154 | 0.63 |
| PF00528 | BPD_transp_1 | 0.63 |
| PF11528 | DUF3224 | 0.63 |
| PF02566 | OsmC | 0.63 |
| PF00400 | WD40 | 0.63 |
| PF02635 | DrsE | 0.63 |
| PF00582 | Usp | 0.63 |
| PF00106 | adh_short | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 3.80 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 3.80 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 3.16 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.63 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.72 % |
| Unclassified | root | N/A | 32.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01B8148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 511 | Open in IMG/M |
| 2170459024|GZTSFBX01BWYER | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 503 | Open in IMG/M |
| 2228664022|INPgaii200_c1007786 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300000550|F24TB_12922043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 827 | Open in IMG/M |
| 3300004152|Ga0062386_100135828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1911 | Open in IMG/M |
| 3300005179|Ga0066684_11115016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300005332|Ga0066388_101005373 | Not Available | 1397 | Open in IMG/M |
| 3300005332|Ga0066388_101170062 | Not Available | 1311 | Open in IMG/M |
| 3300005332|Ga0066388_102117735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1012 | Open in IMG/M |
| 3300005332|Ga0066388_102789120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300005332|Ga0066388_102892086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 877 | Open in IMG/M |
| 3300005332|Ga0066388_104342838 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005332|Ga0066388_106975576 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005332|Ga0066388_108343167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 516 | Open in IMG/M |
| 3300005435|Ga0070714_100270607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1575 | Open in IMG/M |
| 3300005598|Ga0066706_10169253 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300005713|Ga0066905_100355383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 1172 | Open in IMG/M |
| 3300005764|Ga0066903_100856662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1636 | Open in IMG/M |
| 3300005764|Ga0066903_100934162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1575 | Open in IMG/M |
| 3300005764|Ga0066903_101036625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1504 | Open in IMG/M |
| 3300005764|Ga0066903_101087982 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300005764|Ga0066903_101920578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1134 | Open in IMG/M |
| 3300005764|Ga0066903_103711996 | Not Available | 821 | Open in IMG/M |
| 3300005764|Ga0066903_104097668 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005764|Ga0066903_107209822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora azurea | 575 | Open in IMG/M |
| 3300005764|Ga0066903_107439543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 565 | Open in IMG/M |
| 3300006032|Ga0066696_10157856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1419 | Open in IMG/M |
| 3300006047|Ga0075024_100579523 | Not Available | 600 | Open in IMG/M |
| 3300006050|Ga0075028_101092936 | Not Available | 500 | Open in IMG/M |
| 3300006052|Ga0075029_100567512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 755 | Open in IMG/M |
| 3300006059|Ga0075017_100142599 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300006059|Ga0075017_100835748 | Not Available | 713 | Open in IMG/M |
| 3300006162|Ga0075030_100904403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 696 | Open in IMG/M |
| 3300006162|Ga0075030_101505490 | Not Available | 527 | Open in IMG/M |
| 3300006852|Ga0075433_10663088 | Not Available | 914 | Open in IMG/M |
| 3300007076|Ga0075435_100229977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
| 3300009522|Ga0116218_1406573 | Not Available | 607 | Open in IMG/M |
| 3300009698|Ga0116216_10165857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1357 | Open in IMG/M |
| 3300009792|Ga0126374_10580727 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300009792|Ga0126374_10633484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300009792|Ga0126374_10806306 | Not Available | 718 | Open in IMG/M |
| 3300010043|Ga0126380_10106399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1698 | Open in IMG/M |
| 3300010046|Ga0126384_10467041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 1081 | Open in IMG/M |
| 3300010046|Ga0126384_11079003 | Not Available | 735 | Open in IMG/M |
| 3300010046|Ga0126384_11491061 | Not Available | 633 | Open in IMG/M |
| 3300010046|Ga0126384_11850022 | Not Available | 574 | Open in IMG/M |
| 3300010047|Ga0126382_10301918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1203 | Open in IMG/M |
| 3300010047|Ga0126382_10843237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 786 | Open in IMG/M |
| 3300010047|Ga0126382_11441861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 630 | Open in IMG/M |
| 3300010048|Ga0126373_10715745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1060 | Open in IMG/M |
| 3300010048|Ga0126373_11720406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora azurea | 691 | Open in IMG/M |
| 3300010341|Ga0074045_10133729 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales | 1695 | Open in IMG/M |
| 3300010358|Ga0126370_11439028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 652 | Open in IMG/M |
| 3300010360|Ga0126372_10847046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora azurea | 911 | Open in IMG/M |
| 3300010360|Ga0126372_12474137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 570 | Open in IMG/M |
| 3300010360|Ga0126372_12617350 | Not Available | 556 | Open in IMG/M |
| 3300010361|Ga0126378_10558370 | Not Available | 1259 | Open in IMG/M |
| 3300010361|Ga0126378_11707517 | Not Available | 715 | Open in IMG/M |
| 3300010362|Ga0126377_13371612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 516 | Open in IMG/M |
| 3300010366|Ga0126379_10325526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1555 | Open in IMG/M |
| 3300010366|Ga0126379_10556101 | Not Available | 1227 | Open in IMG/M |
| 3300010376|Ga0126381_100765601 | Not Available | 1384 | Open in IMG/M |
| 3300010376|Ga0126381_100877060 | Not Available | 1291 | Open in IMG/M |
| 3300010376|Ga0126381_101875745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 865 | Open in IMG/M |
| 3300010379|Ga0136449_100337145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2720 | Open in IMG/M |
| 3300010379|Ga0136449_103247489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 627 | Open in IMG/M |
| 3300010379|Ga0136449_103399508 | Not Available | 609 | Open in IMG/M |
| 3300010379|Ga0136449_103947467 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010398|Ga0126383_10266437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1691 | Open in IMG/M |
| 3300010398|Ga0126383_12218420 | Not Available | 635 | Open in IMG/M |
| 3300012211|Ga0137377_10025896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5255 | Open in IMG/M |
| 3300012948|Ga0126375_10000669 | All Organisms → cellular organisms → Bacteria | 9879 | Open in IMG/M |
| 3300012971|Ga0126369_12492181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 603 | Open in IMG/M |
| 3300016341|Ga0182035_10857210 | Not Available | 799 | Open in IMG/M |
| 3300017821|Ga0187812_1023015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2149 | Open in IMG/M |
| 3300017821|Ga0187812_1079740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1080 | Open in IMG/M |
| 3300017821|Ga0187812_1095529 | Not Available | 973 | Open in IMG/M |
| 3300017821|Ga0187812_1155631 | Not Available | 735 | Open in IMG/M |
| 3300017926|Ga0187807_1074464 | Not Available | 1059 | Open in IMG/M |
| 3300017939|Ga0187775_10192131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300017939|Ga0187775_10379345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300017942|Ga0187808_10165083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella monticola | 979 | Open in IMG/M |
| 3300017959|Ga0187779_10049773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2443 | Open in IMG/M |
| 3300017959|Ga0187779_10269798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1081 | Open in IMG/M |
| 3300017959|Ga0187779_11189533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 536 | Open in IMG/M |
| 3300017961|Ga0187778_10339104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 977 | Open in IMG/M |
| 3300017966|Ga0187776_10019312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3718 | Open in IMG/M |
| 3300017966|Ga0187776_10146677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1448 | Open in IMG/M |
| 3300017973|Ga0187780_10077128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella mangrovi | 2290 | Open in IMG/M |
| 3300017973|Ga0187780_10178326 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300017973|Ga0187780_11016226 | Not Available | 604 | Open in IMG/M |
| 3300017974|Ga0187777_10430132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 916 | Open in IMG/M |
| 3300017974|Ga0187777_11083685 | Not Available | 582 | Open in IMG/M |
| 3300017974|Ga0187777_11339044 | Not Available | 527 | Open in IMG/M |
| 3300017999|Ga0187767_10009060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
| 3300017999|Ga0187767_10106240 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300018007|Ga0187805_10570399 | Not Available | 533 | Open in IMG/M |
| 3300018029|Ga0187787_10003887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3433 | Open in IMG/M |
| 3300018060|Ga0187765_10929519 | Not Available | 591 | Open in IMG/M |
| 3300018064|Ga0187773_10141108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1233 | Open in IMG/M |
| 3300018089|Ga0187774_10671604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300021560|Ga0126371_10630132 | Not Available | 1221 | Open in IMG/M |
| 3300021560|Ga0126371_10635592 | Not Available | 1216 | Open in IMG/M |
| 3300021560|Ga0126371_11098459 | Not Available | 934 | Open in IMG/M |
| 3300021560|Ga0126371_11269374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
| 3300021560|Ga0126371_11857009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 723 | Open in IMG/M |
| 3300021560|Ga0126371_13418133 | Not Available | 536 | Open in IMG/M |
| 3300021860|Ga0213851_1140719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300025898|Ga0207692_10585695 | Not Available | 716 | Open in IMG/M |
| 3300026523|Ga0209808_1077431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1441 | Open in IMG/M |
| 3300027680|Ga0207826_1060062 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales | 1049 | Open in IMG/M |
| 3300027703|Ga0207862_1169436 | Not Available | 652 | Open in IMG/M |
| 3300027812|Ga0209656_10366190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 652 | Open in IMG/M |
| 3300027874|Ga0209465_10417889 | Not Available | 671 | Open in IMG/M |
| 3300027898|Ga0209067_10376216 | Not Available | 792 | Open in IMG/M |
| 3300027907|Ga0207428_10339968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300027911|Ga0209698_11077454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300027915|Ga0209069_10961804 | Not Available | 521 | Open in IMG/M |
| 3300031544|Ga0318534_10174626 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300031546|Ga0318538_10036422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2334 | Open in IMG/M |
| 3300031549|Ga0318571_10140047 | Not Available | 828 | Open in IMG/M |
| 3300031561|Ga0318528_10237781 | Not Available | 976 | Open in IMG/M |
| 3300031751|Ga0318494_10436965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300031805|Ga0318497_10217513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
| 3300031947|Ga0310909_10506439 | Not Available | 1012 | Open in IMG/M |
| 3300031981|Ga0318531_10438147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 592 | Open in IMG/M |
| 3300032001|Ga0306922_10236830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1961 | Open in IMG/M |
| 3300032044|Ga0318558_10298707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 796 | Open in IMG/M |
| 3300032065|Ga0318513_10460239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 622 | Open in IMG/M |
| 3300032066|Ga0318514_10507088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microtetraspora | 642 | Open in IMG/M |
| 3300032067|Ga0318524_10485875 | Not Available | 647 | Open in IMG/M |
| 3300032076|Ga0306924_10475514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1426 | Open in IMG/M |
| 3300032160|Ga0311301_10372587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2211 | Open in IMG/M |
| 3300032160|Ga0311301_11997344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 677 | Open in IMG/M |
| 3300032160|Ga0311301_12249931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 623 | Open in IMG/M |
| 3300032261|Ga0306920_101475200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 972 | Open in IMG/M |
| 3300032770|Ga0335085_10011299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 13263 | Open in IMG/M |
| 3300032770|Ga0335085_10011790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 12935 | Open in IMG/M |
| 3300032770|Ga0335085_10027773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7931 | Open in IMG/M |
| 3300032770|Ga0335085_10801271 | Not Available | 1037 | Open in IMG/M |
| 3300032770|Ga0335085_11235365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis | 792 | Open in IMG/M |
| 3300032770|Ga0335085_12541297 | Not Available | 507 | Open in IMG/M |
| 3300032782|Ga0335082_10123252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2541 | Open in IMG/M |
| 3300032782|Ga0335082_10645778 | Not Available | 920 | Open in IMG/M |
| 3300032782|Ga0335082_10816908 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales | 794 | Open in IMG/M |
| 3300032783|Ga0335079_11233436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300032783|Ga0335079_11634819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300032805|Ga0335078_10930463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1040 | Open in IMG/M |
| 3300032828|Ga0335080_10063751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4083 | Open in IMG/M |
| 3300032828|Ga0335080_10609610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1147 | Open in IMG/M |
| 3300032828|Ga0335080_10898617 | Not Available | 908 | Open in IMG/M |
| 3300032829|Ga0335070_11196879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 697 | Open in IMG/M |
| 3300033158|Ga0335077_10480989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1317 | Open in IMG/M |
| 3300033805|Ga0314864_0045718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
| 3300033805|Ga0314864_0174029 | Not Available | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 22.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.29% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 12.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.53% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.27% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.27% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.63% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_613920 | 2040502001 | Soil | MFDSLVKRVTAPFRRKRCPECGHKVHETYCDVCGYDLIDQTRTKVMRER |
| FD1_08719850 | 2170459024 | Grass Soil | MFATIVQRMAAPFRRKRCPECGHTLRETYCDVCGYDLIEQTRDKLLRRRGPA |
| INPgaii200_10077862 | 2228664022 | Soil | MFATIVQRMAAPFRRKRCPECGRKLRETYCDVCGYDLIEQTRDKLLRRRGPA |
| F24TB_129220432 | 3300000550 | Soil | MFGQIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRRRGPA* |
| Ga0062386_1001358282 | 3300004152 | Bog Forest Soil | MFASLVNRVTALFRRKRCPECGHKVRQTYCDVCGYDLIEQTRDKALYRR* |
| Ga0066684_111150162 | 3300005179 | Soil | MFASLIERVSARFGRKRCPDCGHKVRETFCDVCGYDLVQQTRDKAFDRPRY* |
| Ga0066388_1010053734 | 3300005332 | Tropical Forest Soil | MFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYELIEQTRDKLLRYRRGPA* |
| Ga0066388_1011700623 | 3300005332 | Tropical Forest Soil | MFASFVNRVTGVFRRKRCPQCGHKVRETFCDVCGYDLIEQARDKALRNR* |
| Ga0066388_1021177352 | 3300005332 | Tropical Forest Soil | MFGQIVQRVTAPFRRKRCPECGHKLRESYCDVCGYDLIDQTRDKLLHRRGPA* |
| Ga0066388_1027891201 | 3300005332 | Tropical Forest Soil | MFATIVQRMTAPLRRRRCPECGHKLRETYCDVCGYDLIEQTRD |
| Ga0066388_1028920862 | 3300005332 | Tropical Forest Soil | MFASLFKRVTGPFRRKRCPECGHKVRETFCDVCGYDLVQQTRDKALRRR* |
| Ga0066388_1043428381 | 3300005332 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPDCGHKVRETFCDVCGYDLIQQTRDKAFRRPVI* |
| Ga0066388_1069755761 | 3300005332 | Tropical Forest Soil | RRKRCPECGHKLRETYCDMCGYDLIEQTRNKLLRGRGPA* |
| Ga0066388_1083431671 | 3300005332 | Tropical Forest Soil | MFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRYRGPA* |
| Ga0070714_1002706072 | 3300005435 | Agricultural Soil | MLTTLVQRVTAPFRRRRCPECGHRVRETFCDVCGYDLIEQTRTTLIRDR* |
| Ga0066706_101692531 | 3300005598 | Soil | VSARFGRKRCPDCGHKVRETFCDVCGYDLVQQTRDKAFDRPRY* |
| Ga0066905_1003553831 | 3300005713 | Tropical Forest Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRNKLLRDRGGPV* |
| Ga0066903_1008566622 | 3300005764 | Tropical Forest Soil | MFAKIVRRMTAPFRRKRCPECGHKLQETYCDVCGYDLIEQTRDKLFRGRGPA* |
| Ga0066903_1009341623 | 3300005764 | Tropical Forest Soil | MVAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRAKLLRRRGPA* |
| Ga0066903_1010366251 | 3300005764 | Tropical Forest Soil | MFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYELIEQTRDKLLRYR |
| Ga0066903_1010879822 | 3300005764 | Tropical Forest Soil | MFGQIVQRITAPFRRKRCPECGHKLRGSYCDVCGYDLIEQTRDRLFRGRGPA* |
| Ga0066903_1019205782 | 3300005764 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPDCGHKVRETFCDVCGYDLIQQTRDRAFRRPVI* |
| Ga0066903_1037119962 | 3300005764 | Tropical Forest Soil | TAPFRRKRCPECGHKLRETYCDVCGYELIEQTRDKLLRYRRGPA* |
| Ga0066903_1040976681 | 3300005764 | Tropical Forest Soil | GQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRNRLLRGRGPA* |
| Ga0066903_1072098222 | 3300005764 | Tropical Forest Soil | TAPFRRKRCPECGHKLRETYCDVCGYELIEQTRDKLLRYRGGPA* |
| Ga0066903_1074395431 | 3300005764 | Tropical Forest Soil | GQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRAKQLRDRGGPI* |
| Ga0066696_101578561 | 3300006032 | Soil | IERVSARFGRKRCPDCGHKVRETFCDVCGYDLVQQTRDKAFDRPRY* |
| Ga0075024_1005795231 | 3300006047 | Watersheds | AAMFASLVNRVTAVFHRKRCPECGHKVRQTYCDVCGYKLVEQTRDKALYRR* |
| Ga0075028_1010929362 | 3300006050 | Watersheds | MFASLVNRVTAVFHRKRCPECGHKVRQTYCDVCGYDLIEQTRDKAPHRPVI* |
| Ga0075029_1005675123 | 3300006052 | Watersheds | MPASLVKRVTAPFRRKRCPECGHKVRETYCDVCGYDLIEQTRTKILRGR* |
| Ga0075017_1001425992 | 3300006059 | Watersheds | MFASLVNRVTAVFRRKRCPECGHKVREQTFCDVCGYDLIEQARDNALRRR* |
| Ga0075017_1008357482 | 3300006059 | Watersheds | MSTSFVKRVTARFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRPVI* |
| Ga0075015_1010349472 | 3300006102 | Watersheds | MLISLWKRLMSHLRRNRCPECGNPVHETFCEVCGYDLIQRTRDEAHFPNPGPR* |
| Ga0075030_1009044032 | 3300006162 | Watersheds | MFSSLAKHVTAPFRRKRCPECGHKVRETYCDVCGYDLVEQTRTKILRGR* |
| Ga0075030_1015054902 | 3300006162 | Watersheds | MFASLVNRVTAVFHWKRCPECGHKVRQTYCDVCGYDLIEQTRDKAPHRPVI* |
| Ga0075433_106630882 | 3300006852 | Populus Rhizosphere | MFDPLVKRVTAPFRRKRCPEYGHKVHETYCDVCGYDLIDQTRTKVMRER* |
| Ga0075435_1002299772 | 3300007076 | Populus Rhizosphere | MFDPLVKRVTAPFRRKRCPECGHKVHETYCDVCGYDLIDQTRTKVMRER* |
| Ga0116218_14065732 | 3300009522 | Peatlands Soil | MFASLVNRVTAVFHRKRCPECGHKVRQTYCEVCGYDLIEQTRGKALHRR* |
| Ga0116216_101658572 | 3300009698 | Peatlands Soil | MFASLVNRVTAVFHRKRCPECGHKVRQTYCDVCGYDLIEQTRGKALHRR* |
| Ga0126374_105807271 | 3300009792 | Tropical Forest Soil | MFASLVKRVTSPFRRKRCPECGHKVHETFCDVCGYDLIQQTRDKAFRRPMI* |
| Ga0126374_106334842 | 3300009792 | Tropical Forest Soil | MFATIVQRMTAPFRRRRCPECGHKLRESYCDVCGYDLIEQTRN |
| Ga0126374_108063061 | 3300009792 | Tropical Forest Soil | MFASLINRVTAPFHRRRCPECGHKVRETYCDVCGYKLVEQTREKSLYHR* |
| Ga0126380_101063992 | 3300010043 | Tropical Forest Soil | MFAKIAGGMAAPFRRKRCPECGHKLWETYCDVCGYELIEQTRDKLLRYRRPVYRRDAQASS* |
| Ga0126384_104670413 | 3300010046 | Tropical Forest Soil | MFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRYRRPV* |
| Ga0126384_110790031 | 3300010046 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPECGHKVRERFCDECGYDLFLRTRDKTFHPPLI* |
| Ga0126384_114910611 | 3300010046 | Tropical Forest Soil | MFASLVKHVTGPFRRKRCPECGHKVHETFCDVCGYDLIQQTRDKAFRRPMI* |
| Ga0126384_118500222 | 3300010046 | Tropical Forest Soil | MFAKIAGRMTAPFRRKRCPECGHKLWETYCDVCGYELIEQTRDKLL |
| Ga0126382_103019182 | 3300010047 | Tropical Forest Soil | MFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLFRDRGQA* |
| Ga0126382_108432372 | 3300010047 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRPVI* |
| Ga0126382_114418611 | 3300010047 | Tropical Forest Soil | MFASLVKRMTGPLRRKRCPECGHKVRETFCDMCGYDLIRQTRDKTFHPPVI* |
| Ga0126373_107157453 | 3300010048 | Tropical Forest Soil | MFASLVKRVTRPFRRKRCPECGHKVRETFCDVCGYDLIQQTRDK |
| Ga0126373_117204061 | 3300010048 | Tropical Forest Soil | KIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRAKLLRRRGPA* |
| Ga0074045_101337293 | 3300010341 | Bog Forest Soil | MFASLVHRVSAVFRPKRCPQCGRKVRQTYCDVCGYRLIEQTRDQALYRR* |
| Ga0126370_114390281 | 3300010358 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRPMI* |
| Ga0126372_108470461 | 3300010360 | Tropical Forest Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTR |
| Ga0126372_124741372 | 3300010360 | Tropical Forest Soil | FGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRNKLLRDRGGPV* |
| Ga0126372_126173502 | 3300010360 | Tropical Forest Soil | FASLINRVTAPFHRRRCPECGHKVRETYCDVCGYKLVEQTREKSLYHR* |
| Ga0126378_105583702 | 3300010361 | Tropical Forest Soil | MVAKIVQRMTAPFRRKRCPRCGHKLRETYCDVCGYDLIEQTRAKLLRYRGPA* |
| Ga0126378_117075171 | 3300010361 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPECGRKVRETFCDVCGYDLIQQTRDKAFRRPVI* |
| Ga0126377_133716121 | 3300010362 | Tropical Forest Soil | MFAKIVQRMHVPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRGRGPA* |
| Ga0126379_103255261 | 3300010366 | Tropical Forest Soil | PGVVSKDAAMLGQIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLFRGRGPA* |
| Ga0126379_105561012 | 3300010366 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRR* |
| Ga0126381_1007656012 | 3300010376 | Tropical Forest Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIDQTRDKLLHRRGPA* |
| Ga0126381_1008770601 | 3300010376 | Tropical Forest Soil | AMFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRYRRPV* |
| Ga0126381_1018757451 | 3300010376 | Tropical Forest Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQ |
| Ga0136449_1003371453 | 3300010379 | Peatlands Soil | MFASFVNRVTARFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRPVI* |
| Ga0136449_1032474891 | 3300010379 | Peatlands Soil | NRVTAVFHRKRCPECGHKVRETYCDVCGYDLIEQTRDKAPHRPVI* |
| Ga0136449_1033995082 | 3300010379 | Peatlands Soil | DPAVLGKEAAMFASLINRVTAMFRRKRCPECGHKVRETFCDVCGYDLIEQPRDKAFYRR* |
| Ga0136449_1039474671 | 3300010379 | Peatlands Soil | KRVTAPFRRKLCPECGHKVRETYCDVCGYDLIEQTRTKVLRDR* |
| Ga0136449_1043940772 | 3300010379 | Peatlands Soil | VVCGDDPAAISKEAAMFASLVHRVTAVFHPKRCPECGHKVRQTYCDVCGYKLVEQTRDKYLYRR* |
| Ga0126383_102664372 | 3300010398 | Tropical Forest Soil | MVAKIVQRMTAPFRRKRCPQCGHKLRETYCDVCGYDLIEQTRAKLLRYRGPA* |
| Ga0126383_122184201 | 3300010398 | Tropical Forest Soil | MFGRIVQRMTAPFRRKRCPECGHKLRENYCDVCGYDLIEQTRDKLLHRRGPA* |
| Ga0137377_100258962 | 3300012211 | Vadose Zone Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRDKLLHRRGPA* |
| Ga0126375_100006695 | 3300012948 | Tropical Forest Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRAKLLRDRGGPI* |
| Ga0126369_124921812 | 3300012971 | Tropical Forest Soil | PFRRKRCPECGHKLQETYCDVCGYDLIEQTRDKLFRGRGPA* |
| Ga0182035_108572102 | 3300016341 | Soil | RVTAPFHGTRCPECGHKVRETYCDVCGYRLVEQTRDDTFYRR |
| Ga0187812_10230151 | 3300017821 | Freshwater Sediment | MFASLVQHVMAPFGRKRCPECGHKVHEQTFCDVCGYQLVEQTRDKMQRGR |
| Ga0187812_10797403 | 3300017821 | Freshwater Sediment | MFASLVKRLTAVFRRKRCPECGHKVRETFCDVCGYDLIEQTRDKALYRRR |
| Ga0187812_10955291 | 3300017821 | Freshwater Sediment | MFASLVNRVTAPFRRQRCPECGHKVRQTYCDVCGYKLVEQTRDKYPYRR |
| Ga0187812_11556311 | 3300017821 | Freshwater Sediment | AAMFASLIQHVMALFRRKHCPECGHKVREQTFCDVCGYQLIEQARDKMLRNR |
| Ga0187807_10744642 | 3300017926 | Freshwater Sediment | MFASFVNRVIAVFRRKRCPECGHKVREQTFCDVCGFKLFEQTRDSIFRSR |
| Ga0187775_101921312 | 3300017939 | Tropical Peatland | MFASLVNRVTAPFHRKRCPECGHKIRETYCDVCGYKLIEQTRDKYLYRR |
| Ga0187775_103793452 | 3300017939 | Tropical Peatland | MSASLVKRVMAPFRRKRCPECGHKVRETYCDVCGYDLIEHTRTKILRGR |
| Ga0187808_101650831 | 3300017942 | Freshwater Sediment | MFASFVNRVTARLHRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRPVI |
| Ga0187779_100497734 | 3300017959 | Tropical Peatland | MFASLISRVTAPFHRKRCPECGHKIRETYCDVCGYDLIEQTRDKALHRHVI |
| Ga0187779_102697982 | 3300017959 | Tropical Peatland | MFASLVNRVTAPFHRKRCPECGHKIRETYCDVCGYKLVEQTRDKYLYRR |
| Ga0187779_111895331 | 3300017959 | Tropical Peatland | EAAMFASLVRRVTAPFRRKRCPECGHKVRETYCDVCGYDLIEHTRTKILRGR |
| Ga0187778_103391042 | 3300017961 | Tropical Peatland | MFASLINRVTAPFHRQRCPECGHKVRQTYCDVCGYKLVEQ |
| Ga0187776_100193123 | 3300017966 | Tropical Peatland | MFASLVNRVTTVFHPKRCPECRHRIRETYCDVCGYDLIEQTRDKAPRRPVI |
| Ga0187776_101466772 | 3300017966 | Tropical Peatland | MSGSLAKRVTAPFRRKRCPECGHKVRETYCDVCGYDLIEHTRTKILRGR |
| Ga0187780_100771284 | 3300017973 | Tropical Peatland | MFASLINRVTAPFHRKRCPQCGHKIRQTYCDVCGYQLVEQTRDNYPYRR |
| Ga0187780_101783262 | 3300017973 | Tropical Peatland | MFASLINRVTAPFHRRRCPQCGHKVRQTYCDVCGYRLVEQTRDRYLYRR |
| Ga0187780_110162262 | 3300017973 | Tropical Peatland | MFASLINRVTAPFHHKRCPECGHKIRHTYCDVCGYKLVEQTRDNYPYRR |
| Ga0187777_104301322 | 3300017974 | Tropical Peatland | VVISKEAVMFASLVNRVTAPFHRKRCPECGHKIRETYCDVCGYKLVEQTRDKYFYRR |
| Ga0187777_110836851 | 3300017974 | Tropical Peatland | MFASLVNRVTAPFHRKRCPECGHKVRETYCDVCGYKLVEQTRDKILYRR |
| Ga0187777_113390442 | 3300017974 | Tropical Peatland | MFASLISRMTAPLHRKRCPECGHKIRETYCDVCGYHLIEQTRDRAIPRRMI |
| Ga0187767_100090604 | 3300017999 | Tropical Peatland | MFASLVRRVTAPFRRKRCPECGHKVRETYCDVCGYDLIEHTRTKILRGR |
| Ga0187767_101062401 | 3300017999 | Tropical Peatland | MFASLVNRVTAPFHRKRCPECGHKIRETYCDVCGYDLIEQTRDKVLHRHVI |
| Ga0187805_105703992 | 3300018007 | Freshwater Sediment | MFASLVKRLTAVFRRKRCPECGHKVRETFCDVCGYDLIEQTRDKALYRCR |
| Ga0187787_100038873 | 3300018029 | Tropical Peatland | MFASLVARATAPFRRKRCPECGHKVRETFCDVCGYDLIQQTRDDILRGR |
| Ga0187765_109295192 | 3300018060 | Tropical Peatland | MFASFVECVTAPFHHQRCPECGHRVREAYCDVCGYNLVRHTQDKTRRGR |
| Ga0187773_101411082 | 3300018064 | Tropical Peatland | MSASLVKRVTAPFRRKRCPECGHKVRETYCDVCGYDLIEHTRTKILRGR |
| Ga0187774_106716042 | 3300018089 | Tropical Peatland | MSASLVKRVTAPFRRKRCPECGHKVRETYCDVCGYDLIEQTRTKILRGR |
| Ga0126371_106301322 | 3300021560 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRR |
| Ga0126371_106355922 | 3300021560 | Tropical Forest Soil | MFASLVKRVTGPFRRKRCPDCGHKVRETFCDVCGYDLIQQTRDRAFRRPVI |
| Ga0126371_110984591 | 3300021560 | Tropical Forest Soil | MLGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRNRLLRGRGPA |
| Ga0126371_112693743 | 3300021560 | Tropical Forest Soil | MFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYELIEQTRDKLL |
| Ga0126371_118570092 | 3300021560 | Tropical Forest Soil | MFASLVKRVTRPFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKTFPRPVI |
| Ga0126371_134181331 | 3300021560 | Tropical Forest Soil | MFAKIVQRMTAPFRRKRCPECGHKLRETYCDVCGYELIEQTRDKLLRYRRGPA |
| Ga0213851_11407192 | 3300021860 | Watersheds | MFASLVNRVTAVFHRKRCPECGHKVRQTYCDVCGYDLIEQTRDKAPHRPVI |
| Ga0207692_105856951 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTTLVQRVTAPFRRRRCPECGHRVRETFCDVCGYDLIEQT |
| Ga0209808_10774313 | 3300026523 | Soil | MFASLIERVSARFGRKRCPDCGHKVRETFCDVCGYDLVQQTRDKAFDRPRY |
| Ga0207826_10600622 | 3300027680 | Tropical Forest Soil | VNRVTAVFHRKRCPECGHKIRETYCDVCGYDLIQQTRDKAFRRPVI |
| Ga0207862_11694361 | 3300027703 | Tropical Forest Soil | MFASLVNRVTAVFHRKRCPECGHKIRETYCDVCRYDLIQQTRDKAFRRPVI |
| Ga0209656_103661901 | 3300027812 | Bog Forest Soil | MFASLVNRVTALFRRKRCPECGHKVRQTYCDVCGYDLIEQTRDKALYRR |
| Ga0209465_104178892 | 3300027874 | Tropical Forest Soil | MFGQIVQRMTAPFRRKRCPECGHKLRETYCDVCGYELIEQ |
| Ga0209067_103762162 | 3300027898 | Watersheds | MFASLVNRVTAVFHPKRCPECGHKVRQTYCDVCGYKLVEQTRDKYLYRR |
| Ga0207428_103399682 | 3300027907 | Populus Rhizosphere | MFDPLVKRVTAPFRRKRCPEYGHKVHETYCDVCGYDLIDQTRTKVMRER |
| Ga0209698_110774541 | 3300027911 | Watersheds | MFSSLAKHVTAPFRRKRCPECGHKVREQTFCDVCGYDLIEQTRTKVLRD |
| Ga0209069_109618041 | 3300027915 | Watersheds | EAAMFASLVNRVTAVFHRKRCPECGHKVRQTYCDVCGYKLVEQTRDKALYRR |
| Ga0318534_101746262 | 3300031544 | Soil | MFASLINRVTAPFHRTRCPECGHKVRETYCDVCGYRLVEQTRDDTFYRR |
| Ga0318538_100364221 | 3300031546 | Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRDKLLHRRGPA |
| Ga0318571_101400472 | 3300031549 | Soil | AISKEAAMFASLINRVTAPFHRTRCPECGHKVRETYCDVCGYRLVEQTRDDTFYRR |
| Ga0318528_102377811 | 3300031561 | Soil | MFGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRDKLLRYRRPA |
| Ga0318494_104369652 | 3300031751 | Soil | MFDSLVQHVMAPFRRKHCPECGHKVREQTFCDVCGYRLIEQARD |
| Ga0318497_102175132 | 3300031805 | Soil | MFASLVKRVTGAFRRKRCPECGHKVRETFCDVCGYDLIQQTRDKAFRRPVI |
| Ga0310909_105064391 | 3300031947 | Soil | MFGQIVQRMTAPFRRKRCPECGHKLRENYCDICGYDLIEQTRDKLLHRRGPA |
| Ga0318531_104381472 | 3300031981 | Soil | SKDAAMLGQIVQRMTAPFRRKRCPECGHKLRESYCDVCGYDLIEQTRDKLLHRRGPA |
| Ga0306922_102368302 | 3300032001 | Soil | MFGQIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRLRGPA |
| Ga0318558_102987072 | 3300032044 | Soil | MFATIVQRMTARFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRLRG |
| Ga0318513_104602391 | 3300032065 | Soil | MFATIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRYRGPA |
| Ga0318514_105070881 | 3300032066 | Soil | HPGVVSKDAAMFATIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRYRGPA |
| Ga0318524_104858751 | 3300032067 | Soil | DHAAISKEAAMFASLINRVTAPFHGTRCPECGHKVRETYCDVCGYRLVEQTRDDTFYRR |
| Ga0306924_104755142 | 3300032076 | Soil | DAISKEAAMFASLINRVTAPFHGTRCPECGHKVRETYCDVCGYRLVEQTRDDTFYRR |
| Ga0311301_103725873 | 3300032160 | Peatlands Soil | MFASLVNRVTAVFHRKRCPECGHKVRQTYCDVCGYDLIEQTRGKALHRR |
| Ga0311301_113777581 | 3300032160 | Peatlands Soil | DPAVLGKEAAMFASLINRVTAMFRRKRCPECGHKVRETYCDVCGYDLIEQTRDKAPHRPV |
| Ga0311301_119973441 | 3300032160 | Peatlands Soil | MFASLIKRVTAPFHRKRCPECGHKVRETYCDVCGYDLIEQTRTKLLRNR |
| Ga0311301_122499312 | 3300032160 | Peatlands Soil | FASLVNRVTAVFRRKRCPECGHKVRQTYCDVCGYDLIEQTRDKALYRR |
| Ga0306920_1014752001 | 3300032261 | Soil | MFATIVQRMTAPFRRKRCPECGHKLRETYCDVCGYDLIEQTRDKLLRLRGPA |
| Ga0335085_1001129910 | 3300032770 | Soil | MFASLVNRVTVVFHRKRCPQCGHKVRETYCDACGYRLVEQARDKALYHR |
| Ga0335085_1001179012 | 3300032770 | Soil | MFASLVSRVTAPFHRKRCPECGHKIRETYCDVCGYDLIEQTRDKAFRRHVI |
| Ga0335085_100277732 | 3300032770 | Soil | MVASLVNRVTGVFRRQRCPECGHKVRQTYCDVCGYKLVEQTRDKALYRR |
| Ga0335085_108012712 | 3300032770 | Soil | MFASLVNRVTAVFHRKRCPECGHKVRETYCDACGYRLVEQTRDKAVYHR |
| Ga0335085_112353651 | 3300032770 | Soil | MFASLVHRVTAPFHRKRCPECGHKVRETYCDVCGYDLIRQARDKYPYHR |
| Ga0335085_125412972 | 3300032770 | Soil | MFASLINRVTAPFHRKRCPECGHKVRETYCDVCGYKLVEQARDKALYRR |
| Ga0335082_101232521 | 3300032782 | Soil | MFASLVHRVTAPFHRKRCPECGHKVRETYCDVCGYKLVEQARDKALYRR |
| Ga0335082_106457782 | 3300032782 | Soil | MFTSLVHRMTAVFHRKRCPQCGHKVRETYCDACGYRLVEQARDKALYHR |
| Ga0335082_108169082 | 3300032782 | Soil | MFASLAHRVTAPFHRRRCPECGHKVRQTYCDVCGYDLIRQARDKYPYHQ |
| Ga0335079_112334362 | 3300032783 | Soil | MFASLVNRVTAPFHRKRCPECGHKIRETYCDVCGYDLIEQTRDKALRRHVI |
| Ga0335079_116348191 | 3300032783 | Soil | MFASLVNRVTAVFHRKRCPECGHKVRQTYCDVCGYDLIEQTRGKAT |
| Ga0335078_109304631 | 3300032805 | Soil | MFASLVNRVTAVFHRKRCPECGHKVRETYCDVCGYDLIRQARDKYPYHQ |
| Ga0335080_100637513 | 3300032828 | Soil | MFASFVNHVTAVFHRKRCPECGHTVREAYCDVCGYHLIEQTRDKTPYRR |
| Ga0335080_106096102 | 3300032828 | Soil | MFASFVHRVTAPFHRRRCPECGHKVRETYCDVCGYDLIRQARDKYPYHQ |
| Ga0335080_108986171 | 3300032828 | Soil | MFASFVDRVTAPFHRKRCPECGHKVRETYCDVCGYKLVEQTRDKYLYRR |
| Ga0335070_111968792 | 3300032829 | Soil | MFASLVQRVTAPFHRKRCPECGHRVRETYCDVCGYDLIEQARDKEFRRPVI |
| Ga0335077_104809891 | 3300033158 | Soil | MSASLVQRVTAPFRRKRCPECGHKVREQAFCDACGYDLIEQTRDKMLRSR |
| Ga0314864_0045718_297_446 | 3300033805 | Peatland | MSASLVKRVTAPFRRKRCPECGHKVRETYCDVCGYDLIEHTRTKMLRGR |
| Ga0314864_0174029_2_142 | 3300033805 | Peatland | MFASFVNRVTAVFHRKHCPECGHKVRETYCDVCGYHLIEQTRDKTFY |
| ⦗Top⦘ |