Metagenome Family F042142

Overview

Basic Information

• Family ID: F042142
• Family Type: Metagenome
• Number of Sequences: 158
• Average Sequence Length: 40 residues
• Representative Sequence: MSIEKQQDMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT
• Number of Associated Samples: 74
• Number of Associated Scaffolds: 158

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 69.62 %
• % of genes near scaffold ends (potentially truncated): 32.91 %
• % of genes from short scaffolds (< 2000 bps): 99.37 %
• Associated GOLD sequencing projects: 73
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.367 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (86.076 % of family members)
• Environment Ontology (ENVO): Unclassified (87.975 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (87.342 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
All Organisms	root	All Organisms	0.63 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
cellular organisms	root	All Organisms → cellular organisms	0.63 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.63 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.63 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.63 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.63 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.63 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.63 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.63 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.63 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.63 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.63 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.63 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.63 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.63 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.63 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.63 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.63 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.63 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.63 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.63 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.63 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Saccharum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum	0.63 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Saccharum officinarum complex	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex	0.63 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.37 %
Saccharum hybrid cultivar	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	0.63 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005288|Ga0065714_10424670	Not Available	572
3300005334|Ga0068869_100637359	Not Available	903
3300005334|Ga0068869_101283293	Not Available	645
3300005459|Ga0068867_101956627	Not Available	553
3300005543|Ga0070672_101929575	Not Available	531
3300005543|Ga0070672_102033591	Not Available	517
3300005616|Ga0068852_100985083	Not Available	861
3300005718|Ga0068866_11129954	Not Available	562
3300005718|Ga0068866_11466579	Not Available	500
3300009036|Ga0105244_10206737	Not Available	924
3300009098|Ga0105245_13053581	Not Available	519
3300013296|Ga0157374_11170004	Not Available	790
3300013296|Ga0157374_12149648	Not Available	585
3300014745|Ga0157377_11398732	Not Available	552
3300014969|Ga0157376_11315417	Not Available	753
3300015267|Ga0182122_1015508	Not Available	764
3300015267|Ga0182122_1048203	Not Available	565
3300015267|Ga0182122_1049348	Not Available	561
3300015268|Ga0182154_1047232	Not Available	571
3300015269|Ga0182113_1076088	Not Available	543
3300015269|Ga0182113_1095757	Not Available	505
3300015274|Ga0182188_1014072	Not Available	738
3300015274|Ga0182188_1044701	Not Available	551
3300015275|Ga0182172_1024263	Not Available	696
3300015275|Ga0182172_1038783	Not Available	614
3300015275|Ga0182172_1048453	Not Available	577
3300015275|Ga0182172_1052478	Not Available	564
3300015276|Ga0182170_1031261	Not Available	653
3300015276|Ga0182170_1069291	Not Available	520
3300015277|Ga0182128_1040917	Not Available	610
3300015277|Ga0182128_1050277	Not Available	576
3300015279|Ga0182174_1063523	Not Available	552
3300015279|Ga0182174_1070611	Not Available	534
3300015282|Ga0182124_1017843	Not Available	769
3300015282|Ga0182124_1054642	Not Available	568
3300015282|Ga0182124_1059331	Not Available	554
3300015282|Ga0182124_1060321	Not Available	552
3300015282|Ga0182124_1067784	Not Available	533
3300015283|Ga0182156_1053631	Not Available	584
3300015283|Ga0182156_1086591	Not Available	504
3300015285|Ga0182186_1039704	Not Available	624
3300015285|Ga0182186_1061888	Not Available	549
3300015285|Ga0182186_1070030	Not Available	529
3300015286|Ga0182176_1041566	Not Available	632
3300015286|Ga0182176_1063204	Not Available	554
3300015286|Ga0182176_1067967	Not Available	542
3300015287|Ga0182171_1068339	Not Available	544
3300015287|Ga0182171_1073815	Not Available	531
3300015287|Ga0182171_1087204	Not Available	504
3300015288|Ga0182173_1063752	Not Available	551
3300015291|Ga0182125_1056067	Not Available	589
3300015292|Ga0182141_1043568	Not Available	631
3300015292|Ga0182141_1065546	Not Available	561
3300015294|Ga0182126_1091364	Not Available	510
3300015295|Ga0182175_1069683	Not Available	560
3300015296|Ga0182157_1037064	Not Available	682
3300015296|Ga0182157_1072072	Not Available	562
3300015298|Ga0182106_1090850	Not Available	523
3300015298|Ga0182106_1097788	Not Available	510
3300015299|Ga0182107_1080762	Not Available	545
3300015302|Ga0182143_1088467	Not Available	530
3300015303|Ga0182123_1073931	Not Available	549
3300015303|Ga0182123_1088160	Not Available	520
3300015303|Ga0182123_1088792	Not Available	519
3300015305|Ga0182158_1097443	Not Available	514
3300015308|Ga0182142_1050369	Not Available	648
3300015308|Ga0182142_1104254	Not Available	519
3300015313|Ga0182164_1122569	Not Available	526
3300015314|Ga0182140_1041019	Not Available	690
3300015314|Ga0182140_1049352	Not Available	654
3300015321|Ga0182127_1110335	Not Available	523
3300015322|Ga0182110_1085100	Not Available	568
3300015341|Ga0182187_1061965	Not Available	761
3300015341|Ga0182187_1161502	Not Available	544
3300015341|Ga0182187_1162462	Not Available	543
3300015341|Ga0182187_1199523	Not Available	502
3300015342|Ga0182109_1189987	Not Available	535
3300015343|Ga0182155_1063493	Not Available	790
3300015343|Ga0182155_1144731	Not Available	593
3300015343|Ga0182155_1168101	Not Available	561
3300015343|Ga0182155_1183334	Not Available	543
3300015343|Ga0182155_1198423	Not Available	527
3300015343|Ga0182155_1202249	Not Available	523
3300015344|Ga0182189_1123033	Not Available	636
3300015344|Ga0182189_1133520	Not Available	617
3300015344|Ga0182189_1153054	Not Available	587
3300015344|Ga0182189_1175937	Not Available	556
3300015344|Ga0182189_1183765	Not Available	547
3300015344|Ga0182189_1203174	Not Available	526
3300015345|Ga0182111_1129781	Not Available	643
3300015345|Ga0182111_1195354	Not Available	549
3300015346|Ga0182139_1208612	Not Available	536
3300015347|Ga0182177_1214360	Not Available	533
3300015351|Ga0182161_1196215	Not Available	570
3300015355|Ga0182159_1183455	Not Available	667
3300015355|Ga0182159_1194457	Not Available	651
3300015355|Ga0182159_1241189	Not Available	593
3300015355|Ga0182159_1302034	Not Available	537
3300015355|Ga0182159_1304527	Not Available	535
3300015355|Ga0182159_1308200	Not Available	532
3300015355|Ga0182159_1315535	Not Available	527
3300015355|Ga0182159_1324025	Not Available	520
3300017404|Ga0182203_1078077	Not Available	640
3300017404|Ga0182203_1096857	Not Available	598
3300017404|Ga0182203_1112348	Not Available	570
3300017404|Ga0182203_1149578	Not Available	518
3300017407|Ga0182220_1056153	Not Available	606
3300017407|Ga0182220_1069027	Not Available	572
3300017407|Ga0182220_1083406	Not Available	543
3300017407|Ga0182220_1088519	Not Available	533
3300017407|Ga0182220_1107183	Not Available	504
3300017409|Ga0182204_1031453	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	750
3300017409|Ga0182204_1065489	Not Available	605
3300017409|Ga0182204_1075814	Not Available	579
3300017409|Ga0182204_1090286	Not Available	549
3300017410|Ga0182207_1055632	Not Available	737
3300017410|Ga0182207_1097914	Not Available	614
3300017410|Ga0182207_1105093	Not Available	600
3300017410|Ga0182207_1131828	Not Available	556
3300017411|Ga0182208_1042165	Not Available	709
3300017411|Ga0182208_1095637	Not Available	554
3300017411|Ga0182208_1098166	Not Available	549
3300017413|Ga0182222_1093838	Not Available	522
3300017413|Ga0182222_1103252	Not Available	508
3300017415|Ga0182202_1097975	Not Available	564
3300017415|Ga0182202_1127050	Not Available	518
3300017417|Ga0182230_1024802	Not Available	1049
3300017420|Ga0182228_1112510	Not Available	529
3300017424|Ga0182219_1115644	Not Available	534
3300017425|Ga0182224_1110726	Not Available	574
3300017425|Ga0182224_1158507	Not Available	509
3300017430|Ga0182192_1080322	Not Available	656
3300017430|Ga0182192_1089316	Not Available	633
3300017430|Ga0182192_1108970	Not Available	591
3300017430|Ga0182192_1158633	Not Available	518
3300017430|Ga0182192_1161553	Not Available	515
3300017436|Ga0182209_1076255	Not Available	656
3300017436|Ga0182209_1170713	Not Available	505
3300017442|Ga0182221_1169766	Not Available	503
3300017442|Ga0182221_1171741	Not Available	501
3300017443|Ga0182193_1062733	Not Available	741
3300017443|Ga0182193_1162197	Not Available	539
3300017682|Ga0182229_1057771	Not Available	659
3300017683|Ga0182218_1148244	Not Available	508
3300017683|Ga0182218_1154685	Not Available	501
3300017684|Ga0182225_1095112	Not Available	573
3300017684|Ga0182225_1131275	Not Available	518
3300017686|Ga0182205_1120217	Not Available	568
3300017686|Ga0182205_1134798	Not Available	546
3300017689|Ga0182231_1084116	Not Available	608
3300017689|Ga0182231_1085840	Not Available	602
3300017689|Ga0182231_1120638	Not Available	513
3300021060|Ga0182232_1050946	Not Available	686
3300025907|Ga0207645_10040833	Not Available	2971
3300025907|Ga0207645_11088557	Not Available	539
3300025926|Ga0207659_10985112	Not Available	725
3300026142|Ga0207698_10498653	Not Available	1184
3300026753|Ga0207528_100455	Not Available	1065

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.37%
Environmental	Environmental	0.63%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.37%
Terrestrial	Environmental → Terrestrial	0.63%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	87.34%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.96%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.06%
Soil	Environmental → Terrestrial → Soil	0.63%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	87.34%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.80%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.16%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.63%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	87.34%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.16%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.63%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	86.08%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.16%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.16%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.63%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.63%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.63%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1	Host-Associated
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300026753	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-12 (SPAdes)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0065714_104246701	3300005288	Miscanthus Rhizosphere	SIEKQQGMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT*
Ga0068869_1006373591	3300005334	Miscanthus Rhizosphere	LRPDGKSIEKQQDMEVLGVDLSPSVSIKDCTVVGASDKIERMPLT*
Ga0068869_1012832931	3300005334	Miscanthus Rhizosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGTFDKIERMPIT*
Ga0068867_1019566271	3300005459	Miscanthus Rhizosphere	LRPDGKSIGKQQGMEVLGVDLSPSVSIKDRTVVGASDKIERMPLT
Ga0070672_1019295752	3300005543	Miscanthus Rhizosphere	MSIEKQQDMEVLGVDLSPSVSIKDHTIVGASDKIERMPIT*
Ga0070672_1020335911	3300005543	Miscanthus Rhizosphere	MSIEKQQGMEVLGVDLSPSVSIKDRTVVGTSDKIERMPIT*
Ga0068852_1009850831	3300005616	Corn Rhizosphere	KQQDMEVLGVDLSPSVSIKDRTVVGASDKIERMPLT*
Ga0068866_111299542	3300005718	Miscanthus Rhizosphere	MSIEKQQDMEVLGVDLSLSVLIKDRTIVGASDKIERMPIT*
Ga0068866_114665792	3300005718	Miscanthus Rhizosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTIVGTSDKIERMPLT*
Ga0105244_102067372	3300009036	Miscanthus Rhizosphere	MSIEKQQDIEVLGVDLSPSVSINVRTVVGASDKIERMPLT*
Ga0105245_130535811	3300009098	Miscanthus Rhizosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT*
Ga0157374_111700041	3300013296	Miscanthus Rhizosphere	PDGKSIGKQQGMEVLGVDLSPSVSIKDRTVVGASDKIERMPLT*
Ga0157374_121496481	3300013296	Miscanthus Rhizosphere	MLIEKQQDMDVLGVDLSPSVSIKDRTIVGASDKIERMPIT*
Ga0157377_113987322	3300014745	Miscanthus Rhizosphere	RPGGMSIEKQQDMEVLGVDLSPSVSIKDRTVVGASDKIERLPLT*
Ga0157376_113154171	3300014969	Miscanthus Rhizosphere	MLIEKQQDMEVLGVDLSPSMSIKDRTIVGASDKIEHMPLT*
Ga0182122_10155081	3300015267	Miscanthus Phyllosphere	NEWRPSEMSIEKQQDMEVLGVDLSPSVSVKDRTVVGTSDKIERMPLS*
Ga0182122_10482031	3300015267	Miscanthus Phyllosphere	KQQDMEVLGVDLSPSVSINDCTVVDTSDKIEHMPLT*
Ga0182122_10493481	3300015267	Miscanthus Phyllosphere	QDMEVLGVDLSPSVSIKDRTVVGASDKIERMPLT*
Ga0182154_10472321	3300015268	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGTFDKIERMPLT*
Ga0182113_10760881	3300015269	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVLIKDRTIVGASDKIQHMPIT*
Ga0182113_10957571	3300015269	Miscanthus Phyllosphere	MSIERQQDMEVLGVDLYLSMSIKDRTIVGTSNKIECMSIT*
Ga0182188_10140721	3300015274	Miscanthus Phyllosphere	MLIEKQQDMEVLGVDLSPSVSIKDHTVVALFDKIERMPIS*
Ga0182188_10447012	3300015274	Miscanthus Phyllosphere	MSIEKQQDMEVLGADLSPSMSIKDRTIVGASDKIERMPIT*
Ga0182172_10242631	3300015275	Miscanthus Phyllosphere	MIEKQQDMEVLGVDLSLSVSIKDHTVVGTSDKIERMPIT*
Ga0182172_10387831	3300015275	Miscanthus Phyllosphere	MLIEKQQDMEVLGVDLSPSVSIKDRTVVGASDKIERMPLT*
Ga0182172_10484531	3300015275	Miscanthus Phyllosphere	GRMSIEKQQDMEVLGVDLSPSVSIKDRTVVGTFNKIERIPIT*
Ga0182172_10524781	3300015275	Miscanthus Phyllosphere	MSIEKQQDMEVFCVDLSPSVSIKDRTVVGAFDKIERMPIT*
Ga0182170_10312611	3300015276	Miscanthus Phyllosphere	GGTSIEKQQDMEVLGVDLSPSMSINDRTVVGASDKIEHMPTT*
Ga0182170_10692911	3300015276	Miscanthus Phyllosphere	MSIAKQQDVEVLGVDLSPSVSIKDRTVVGASDKIERMPLT*
Ga0182128_10409171	3300015277	Miscanthus Phyllosphere	YKWRPGRMSIEKQQDMEVLGVDLSPSMLIKDCTVVGTSDKIKRMPLT*
Ga0182128_10502771	3300015277	Miscanthus Phyllosphere	MLIEKQQDMEVLGVDLSPSVSIKDRIVVGPSDKIECMPIT*
Ga0182174_10635231	3300015279	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSMSIKDSTVVGASDKIERMPLT*
Ga0182174_10706112	3300015279	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGASDKTERMPIT*
Ga0182124_10178431	3300015282	Miscanthus Phyllosphere	MLIEKQQDMEVLGVDLSPSMSIKDSTVVGPSDKIKHMPTT*
Ga0182124_10546421	3300015282	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPFVSIKDRTVVGTSDKIECMPIT*
Ga0182124_10593311	3300015282	Miscanthus Phyllosphere	QDMEILGVDLSLSVLIKDRTIVGTFDKIECMPIT*
Ga0182124_10603211	3300015282	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPFVSIKDRTVVGTSDKIELMLIT*
Ga0182124_10677842	3300015282	Miscanthus Phyllosphere	MSIQKQQDMEVLGVDLSLSVSVKDCTVVGTFDAIERMPIT*
Ga0182156_10536311	3300015283	Miscanthus Phyllosphere	MSIEKQQDIEVLGVDLSPSVLIKDRTVVGASNKIERMPLT*
Ga0182156_10865912	3300015283	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVLIKDRTSVGTSDKIERMPIT*
Ga0182186_10397042	3300015285	Miscanthus Phyllosphere	MSIEKQQDIEVLGVDLSPSVLIKDRTVVGASDKIE
Ga0182186_10618881	3300015285	Miscanthus Phyllosphere	MSIEKQQDMEVLGMDVSPSMLIKDHTIVGPSNKIECMPIT*
Ga0182186_10700301	3300015285	Miscanthus Phyllosphere	MSIEKQQDMEVLDVDLSPFVSIKDRTVVGTSDKIERMPIT*
Ga0182176_10415661	3300015286	Miscanthus Phyllosphere	MSIEKQHGKDVLGVDLSPSVSIKDRTVVGTSDKIERMPLT*
Ga0182176_10632042	3300015286	Miscanthus Phyllosphere	MSIEKQQGMEVLGVDLSLFVLVKDRIVDGTFDEIERMSIT*
Ga0182176_10679671	3300015286	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDSTIVGASDKIERMPIT*
Ga0182171_10683391	3300015287	Miscanthus Phyllosphere	MSIEKQQNMEVLGVDRSPSMSIKDHTIVGTFDEIEHMPIT*
Ga0182171_10738151	3300015287	Miscanthus Phyllosphere	IEKQQDMEVLGVDLSPSVSIKDRTIVGTFDKIEHMHIT*
Ga0182171_10872041	3300015287	Miscanthus Phyllosphere	MSIEKQQDMEVFCVDLSPSVLIKDRTVVGASDKTERMPFTYLAG*
Ga0182173_10637521	3300015288	Miscanthus Phyllosphere	VIERQQDMEVLGVDLSPSVSIKDHTVVGASDKIERMPIT*
Ga0182125_10560671	3300015291	Miscanthus Phyllosphere	MTIEMQQDMEVLGVNLSPSVSTKDRTVVGASNKIERMPII*
Ga0182141_10435682	3300015292	Miscanthus Phyllosphere	MLIEKQQGMEALGVDLSPSVLVKDRTIVGTSNKIERMPIT*
Ga0182141_10655461	3300015292	Miscanthus Phyllosphere	EKQQDMEILGVDLSPSVSIKDRTIVGASDKIERMPLT*
Ga0182126_10913641	3300015294	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGASNKIERMPLT*
Ga0182175_10696831	3300015295	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSVKDRTIVGTSDKIERMPII*
Ga0182157_10370641	3300015296	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDHTVVGTFDKIERMPIT*
Ga0182157_10720721	3300015296	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDHTVVGASDKIERM
Ga0182106_10908501	3300015298	Miscanthus Phyllosphere	KQQGKEVLGVDLSPSVSIKDRTVVSASDKIERMPIS*
Ga0182106_10977881	3300015298	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSMSIKDRTVVGTSDKIERMPLT*
Ga0182107_10807621	3300015299	Miscanthus Phyllosphere	MSIEKRQDMKVLGVDLSLSMSIKDRTVVGPSDNIECMPIT*
Ga0182143_10884671	3300015302	Miscanthus Phyllosphere	MLIEKQQDMEVLSVDLSPSVSIKDRTVVGASDKIKCMPLT*
Ga0182123_10739311	3300015303	Miscanthus Phyllosphere	SRPDGRSIEKQQDMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT*
Ga0182123_10881601	3300015303	Miscanthus Phyllosphere	MSIEKQQDIEVLGVDLSLSVLIKDRTIIGASDKIERMPIT*
Ga0182123_10887921	3300015303	Miscanthus Phyllosphere	MSIEKQQDIEVLGVDLSPSVLIKDRTIVGTSNKIEHMPLT*
Ga0182158_10974431	3300015305	Miscanthus Phyllosphere	QDMEVLGVDLSPSVSIKDRTIVGTSDKIERMPIT*
Ga0182142_10503691	3300015308	Miscanthus Phyllosphere	MSIEKQQGMKVLGVDLSPSVSIKDHIVVGPSDNIECMPIT*
Ga0182142_11042542	3300015308	Miscanthus Phyllosphere	MSIEKQQDIEVLGVDLSPPVSIKDRTVVGASDKIEHMPIT*
Ga0182164_11225691	3300015313	Switchgrass Phyllosphere	KQQDMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT*
Ga0182140_10410192	3300015314	Miscanthus Phyllosphere	MSIEKKQDMEVLGVDLSPSMSIKDRTVVGTSYKIERMPLT*
Ga0182140_10493521	3300015314	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSLSVSIKDRTVVGASDKIERMAIT*
Ga0182127_11103351	3300015321	Miscanthus Phyllosphere	MSIEKQQGMEVLGVDLSPFMWIKDRTVVGPSDKIERMPIT*
Ga0182110_10851001	3300015322	Miscanthus Phyllosphere	MLIEKQQDMEVLGADLSPSVSIKDRTIVGTFVEIERMPLT*
Ga0182187_10619651	3300015341	Miscanthus Phyllosphere	RPGGMSIEKQQDMEVLGVDLSLSVSIKDRTVVGPFDKIERMPLT*
Ga0182187_11615021	3300015341	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSMLIKDCTVVGTSDKIKRMHV
Ga0182187_11624621	3300015341	Miscanthus Phyllosphere	MSIEKQQDMEALDVDLSPYVSIKDRTVVGTSNKIECILIT*
Ga0182187_11995231	3300015341	Miscanthus Phyllosphere	MSIEKQQDMEILGVDLSLSVLIKDRTIVGASDKIQHMPIT*
Ga0182109_11899871	3300015342	Miscanthus Phyllosphere	MSIEKQQDKEVLGVDLSLSVLIKDRTVVGTFDKIECMPIT*
Ga0182155_10634931	3300015343	Miscanthus Phyllosphere	MSIEKQQNMEVLGVDRSPSMSIKDHTIVGTSDKIECMPLT*
Ga0182155_11447311	3300015343	Miscanthus Phyllosphere	MSIEKQQDTEVLGVDLSPSVSIKDRTVVGASDKIECMPLT*
Ga0182155_11681011	3300015343	Miscanthus Phyllosphere	KQQDMEVFGVDLSPSVSIKDHTVVGTFDKIERMPIT*
Ga0182155_11833341	3300015343	Miscanthus Phyllosphere	MSIEKQQDMEVLVVDLSPSVSIKDRTIVGTFDKIERM
Ga0182155_11984232	3300015343	Miscanthus Phyllosphere	MPIEKQQDMEVLGVDLSPSVSIKDRTVVGTSNKIERMPLT*
Ga0182155_12022492	3300015343	Miscanthus Phyllosphere	MSIEKQQGMEVLGVDLSPSVSIKDRTVVVTFDKIERMPIT*
Ga0182189_11230331	3300015344	Miscanthus Phyllosphere	KRKLRPSGMSIEKQQDMEVLGVDLSLSVSIKDSTVVGASDKIERMPLT*
Ga0182189_11335201	3300015344	Miscanthus Phyllosphere	KQQGMEVLGVDLSPSVSIKDRTVAGTSDKIERMPLT*
Ga0182189_11530541	3300015344	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSTSMSVKDRTVIGTSDKIERIPIT*
Ga0182189_11759371	3300015344	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDCNVVGPFDKIERMPIT*
Ga0182189_11837651	3300015344	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPFVSIKDRIAIDTSDKIERMPII*
Ga0182189_12031741	3300015344	Miscanthus Phyllosphere	IEKQQDMEVLGVDLSPSMSIKDHTVVGPFGKIERIAIT*
Ga0182111_11297811	3300015345	Miscanthus Phyllosphere	MEVLGVDLFPSVSIKDHTVVGASDKIEHMPVTLLAG*
Ga0182111_11953541	3300015345	Miscanthus Phyllosphere	IEKQQDMEVLGVDLSPFVLIKDRTVVGTFNKIECMPIT*
Ga0182139_12086121	3300015346	Miscanthus Phyllosphere	MSIEKEQGKEVLGVDLSPSVSVKDHTVVRSFDKIERMPVT*
Ga0182177_12143601	3300015347	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSLSVSFKDRTIVGASDKIERMPLT*
Ga0182161_11962151	3300015351	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSINDRTVVGASDKIERMPIT*
Ga0182159_11834551	3300015355	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGASDQIERLPLT*
Ga0182159_11944572	3300015355	Miscanthus Phyllosphere	MSIAKQQDVEVLGVDLSSSVSIEDRTVVGTSDKIERMPIT*
Ga0182159_12411892	3300015355	Miscanthus Phyllosphere	MSIEKKQDMEVLGVDLSSFVSIKDHTVVGTSDKIEHMTIT*
Ga0182159_13020342	3300015355	Miscanthus Phyllosphere	MWIEKQQDMEALGVDLSPSVSIKDRTVVGTFDKIERMPIT*
Ga0182159_13045271	3300015355	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDCTIVGVSDKIERMPLT*
Ga0182159_13082002	3300015355	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSLSVSIKDRTIVGTSNKIERIPIT*
Ga0182159_13155351	3300015355	Miscanthus Phyllosphere	MSIEKQQDVEVLGVDLSPSVSIKDRTIVGTSDKIERMPLT*
Ga0182159_13240251	3300015355	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGTFDKIQRMPIT*
Ga0182203_10780771	3300017404	Miscanthus Phyllosphere	WRPGGMSIEKQQDIEVLGVDLSLSVSIMDHTVVGASNKIERMPIT
Ga0182203_10968571	3300017404	Miscanthus Phyllosphere	QQDMEVLGVDLSLSMSIKDHTVVGASDKIECMPLT
Ga0182203_11123481	3300017404	Miscanthus Phyllosphere	MSIEKQQDMKVLGVDLSLSVSIKDRTVVGASNKIERMSLT
Ga0182203_11495781	3300017404	Miscanthus Phyllosphere	MLIEKQQYMEVLGVDLSPSVSIKDRTVVGASNKIERMPIT
Ga0182220_10561531	3300017407	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSFKDRTVVGASDKIERMPIT
Ga0182220_10690271	3300017407	Miscanthus Phyllosphere	QQDMEVLGVDLSLSVSIKDRTVVGPFDKIERMPLA
Ga0182220_10834061	3300017407	Miscanthus Phyllosphere	MSIEKQQDMEVLVVDLSPSMSIKDRTIVGASNKIERMPIT
Ga0182220_10885191	3300017407	Miscanthus Phyllosphere	KWRPGEMSIEKQQDMKVLGVDLSPCVLIKDLTVVGTFDKIERMPIT
Ga0182220_11071832	3300017407	Miscanthus Phyllosphere	MSIEKQQGMEVLGVDLSPSVSIKDRTVVGTFDKIERMPIT
Ga0182204_10314531	3300017409	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSMSVKDRTVVGASDKIERMPLT
Ga0182204_10654891	3300017409	Miscanthus Phyllosphere	MSIEKQQDMEIFGVDLSPSVSIKDRTVVGASDKIERMPLT
Ga0182204_10758141	3300017409	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGTSDKIERMPIN
Ga0182204_10902861	3300017409	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGASNKIEHMPIT
Ga0182207_10556321	3300017410	Miscanthus Phyllosphere	MSIEKQRDMEVLGVDLSSSVSIKDRTVVGASDKIERMPIT
Ga0182207_10979141	3300017410	Miscanthus Phyllosphere	KWRPSGMLIEKQQDMEVLGVDLSPSVSIKDHTVVGTFNKIERMSIT
Ga0182207_11050931	3300017410	Miscanthus Phyllosphere	MSIEKQQDMEVLSVDLSPSVSIKDHTIVGASDKIERMPIT
Ga0182207_11318281	3300017410	Miscanthus Phyllosphere	NEXRLGRMSIEKQQDMEVLGVDLSPSMSIKDRTVVGASNKIERMPLT
Ga0182208_10421651	3300017411	Miscanthus Phyllosphere	MSIEKQQDIEVLDVDLSLSVSIKDCTVVGTSDKIERMPIT
Ga0182208_10956371	3300017411	Miscanthus Phyllosphere	MSIERQQDMEVLGVDLSPSMSIKDHTIVGTFDEIEHMPIT
Ga0182208_10981661	3300017411	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSLSVSIKDRTVVGASDKIERMPLT
Ga0182222_10938381	3300017413	Miscanthus Phyllosphere	GMSIEKQQDMEVLGVDLSPSVSIKDHTIVGTSDKIERMPLT
Ga0182222_11032521	3300017413	Miscanthus Phyllosphere	WRPGRMSIEKQQGMEVLGVDLSPSMSIKDRTVVGTSDKIERMPII
Ga0182202_10979751	3300017415	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSLSVSINYRTVVGASDKIERMPLT
Ga0182202_11270501	3300017415	Miscanthus Phyllosphere	MSIEKQQGMEVLGVDLSPSVSIKDHTIVGTSNKIERK
Ga0182230_10248021	3300017417	Miscanthus Phyllosphere	GMSIEKQQDMEVLSVDLSPSMSIKDRTVVGASDKIERMPIT
Ga0182228_11125101	3300017420	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGASDKIKRMPIT
Ga0182219_11156441	3300017424	Miscanthus Phyllosphere	MSIEKQQGTEVLGVDLSPSMSIKDRTIVGPFDKIERMPLT
Ga0182224_11107261	3300017425	Miscanthus Phyllosphere	EKQQDMEVLGVNLSPSMSIKDHTIVGTSDKIERMPLT
Ga0182224_11585071	3300017425	Miscanthus Phyllosphere	MSIEKQQGMEVLGVDLSPSMSIKEHTIVGASDKIERMPIT
Ga0182192_10803221	3300017430	Miscanthus Phyllosphere	MLLEKQQDMEVLGVDLSPSMSIKDRTIVGTFVEIERMHLT
Ga0182192_10893161	3300017430	Miscanthus Phyllosphere	ATSMEVLGVDLSPSMSIKDRTVVGTSNKIECMPLT
Ga0182192_11089701	3300017430	Miscanthus Phyllosphere	MSIEKQQDMEVLGVNLSPSVSIKDHTIVGTSDKIQHMPLT
Ga0182192_11586331	3300017430	Miscanthus Phyllosphere	MSIEKQQDMEVLCVDLSPSVSIKDRTVVGASDKIERMLIT
Ga0182192_11615531	3300017430	Miscanthus Phyllosphere	MSIERQQDMEVLGVDLYLSMSIKDRTIVGTSNKIECMSIT
Ga0182209_10762551	3300017436	Miscanthus Phyllosphere	MSIEKKQDMEVLGVDLSPSMSIKDRTVVGTSYKIERMPLT
Ga0182209_11707131	3300017436	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPSVSIKDYTVVGGSDKIERMPITKLAG
Ga0182221_11697661	3300017442	Miscanthus Phyllosphere	MSIERQQDMEVLGMDLSSSVSIKDRTVARTFDEIERMPLT
Ga0182221_11717412	3300017442	Miscanthus Phyllosphere	MSIEKQQNMEVLGVDLSLSVSIKDRTIVGASDKIERMPIT
Ga0182193_10627331	3300017443	Miscanthus Phyllosphere	MPIEKQQDMKVLGVDLSLSVSVKDRTVVGTSNKIERMPIT
Ga0182193_11621972	3300017443	Miscanthus Phyllosphere	VNNEWRLGEMWIEKQQDMEALGVDLSPSVSIKDRTVVGTFDKIERMPIT
Ga0182229_10577711	3300017682	Miscanthus Phyllosphere	GMLIKKQQDIEVLGVDLFPSVSIKDCTVVGPFDEIEHMPIT
Ga0182218_11482441	3300017683	Miscanthus Phyllosphere	MSIEKQQDMEVLGVDLSPFVSIKDRTVVGASDKIE
Ga0182218_11546851	3300017683	Miscanthus Phyllosphere	MPIEKQQDIEVLGVDLSPSVSIKDRTVVGASDKIERMP
Ga0182225_10951122	3300017684	Miscanthus Phyllosphere	MSIGKQQDMEVLGVDLSPSMSIKDHTVVGTSDKIEHRPLT
Ga0182225_11312751	3300017684	Miscanthus Phyllosphere	MSIEKQRDMEVLGVDLSPSVSIKDRTVVGASDKIERMPLT
Ga0182205_11202171	3300017686	Miscanthus Phyllosphere	MSIEKQEYMEVLGVNLSLSVSIKDRTVVGASNKIERMPLT
Ga0182205_11347981	3300017686	Miscanthus Phyllosphere	RPGGMSIEKQQDMEVLGVDLSLSVYIKDRTVVGASDKIERMPIT
Ga0182231_10841161	3300017689	Miscanthus Phyllosphere	MSIEKQQDMDVLGVDLSPSVSVKDRTVVGPFDKIERMPIT
Ga0182231_10858402	3300017689	Miscanthus Phyllosphere	GGGGGQQDIEVFGMDLSPSVSIKGRTVVGASDKIERMPIT
Ga0182231_11206382	3300017689	Miscanthus Phyllosphere	IEKRQDMEVLGVDLSPSVSIKDRTVVGPSDKIERMPIT
Ga0182232_10509462	3300021060	Phyllosphere	MSIEKQQGMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT
Ga0207645_100408333	3300025907	Miscanthus Rhizosphere	PGGMSIEKQQGMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT
Ga0207645_110885571	3300025907	Miscanthus Rhizosphere	MSIEKQQDMEVLGVDLSPSVSIKDRAVVGTSDKIERMPLT
Ga0207659_109851121	3300025926	Miscanthus Rhizosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGTSDKIERMPLT
Ga0207698_104986532	3300026142	Corn Rhizosphere	MSIEKQQDMEVLGVDLSPSVSIKDRTVVGASDKIERM
Ga0207528_1004552	3300026753	Soil	MSIEKQQDMEVLGVNLSPSVSIKDRTVVGASDKIERMPLT