 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F042016 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MGPEAKFYQQIKRNFKQFSLIRLENSSLLGTPDLLVCN |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.23 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.730 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.591 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.761 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.679 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.18% β-sheet: 15.15% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 26.42 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.26 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 26.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.73 % |
| All Organisms | root | All Organisms | 23.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.59% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.21% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.80% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.66% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.40% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.77% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.77% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.14% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.52% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.89% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.89% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.26% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.26% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.26% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.26% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.63% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.63% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.63% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.63% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.63% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.63% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.63% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.63% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.63% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.63% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.63% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026106 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031703 | Marine microbial communities from water near the shore, Antarctic Ocean - #34 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101651233 | 3300000101 | Marine | MGPEAKLYQNVKQNFKQLSLIRIENNSLLGTPDLLVCNTS |
| DelMOSum2010_101809393 | 3300000101 | Marine | MGPEAKFYQNVKQNFKQLSLIRIENNSLLGTPDLLVCNT |
| DelMOSpr2010_101623951 | 3300000116 | Marine | MGPEAKFYQQIKRNFKQLSLIRIENSSLLGTPDLLVCN |
| BBAY92_100710973 | 3300000947 | Macroalgal Surface | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVCNTSGH |
| BBAY92_101450441 | 3300000947 | Macroalgal Surface | MAPERKFYQKIKRAFSNFSLIRLENNSLHGTPDLLVC |
| JGI24006J15134_100339521 | 3300001450 | Marine | MGPERKLYQKLKKNFTDISLIRLENNSLLGTPDILACNSFGHF |
| JGI24006J15134_101574581 | 3300001450 | Marine | MGPEAKLYQNVKQNFKQFSLIRLENISLLGTPDLLVCNT |
| JGI24003J15210_100043061 | 3300001460 | Marine | MGPEAKLYQKVKRNFKEFSLIRLENLSLLGTPDLLVSNNS |
| JGI24003J15210_101215343 | 3300001460 | Marine | MGPEAKFYQQIKRNFKSLSLIRIENNSLLGTPDVLVCNT |
| JGI24005J15628_100918864 | 3300001589 | Marine | MGPERKLYQKLKKNFTNISLIRLENNSLLGTPDILACNS |
| JGI24005J15628_101535213 | 3300001589 | Marine | MGPERKLYQKLKKNFTDISLIRLENNSLLGTPDILA |
| KVWGV2_102960771 | 3300002242 | Marine Sediment | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDXLVCNTSGHF |
| JGI25127J35165_10696441 | 3300002482 | Marine | MAPERKLYQKVKKSFSNFSLIRLENHSLHGTPDLLVSNTRGH |
| JGI25128J35275_10268041 | 3300002488 | Marine | MGPEAKFYQQIKRNFKQFSLIRLENSSLLGTPDLLVCNTSG |
| JGI25133J35611_100998431 | 3300002514 | Marine | MAPERKFYQKIKRAFSDFSLIRLENNSLHGTPDLLVCNANG |
| Ga0068511_10461333 | 3300005057 | Marine Water | MGPERKLYQKIKKSFSNFSLIRLENNSLHGTPDLLVSNARG |
| Ga0066856_102865751 | 3300005404 | Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVCNTSGHF |
| Ga0066862_101664351 | 3300005521 | Marine | MGPEAKFHKEIKRKLPEFSWIRIENISLLGTPDLLG |
| Ga0075462_101331703 | 3300006027 | Aqueous | MGPEAKFYQNVKQNFKQFSLIRLENISLLGTPDLLVCNT |
| Ga0075441_101762204 | 3300006164 | Marine | MAMSESVFYRYLRGQFKSLSLIRIENSALQGTPDL |
| Ga0075443_102450441 | 3300006165 | Marine | MGPEANFYQNVKKNFKCLSLIRLENSSLLGTPDLL |
| Ga0075446_101346963 | 3300006190 | Marine | MGPERKLYQKVKKTFTDFSLIRLENSSLLGTPDLLVSNN |
| Ga0098038_11804471 | 3300006735 | Marine | MGPEAKFYQKIKRNFKSLSLIRIENSSLLGTPDLL |
| Ga0098038_12271371 | 3300006735 | Marine | MGPEAKFYQQIKKNFKSFSLIRLENSSLLGTPDLL |
| Ga0098042_10300351 | 3300006749 | Marine | MAPERKLYQKIKKHFSDFSLIRLENNSLHGTPDLLVSNAR |
| Ga0098048_11150484 | 3300006752 | Marine | MGPEAKLYQKIRKNSKGISWNRLENRSLSGTPDLL |
| Ga0098048_11799411 | 3300006752 | Marine | MGPEAKFYQQIKKKFKSLSLIRIENNSLLGTPDLLVCNT |
| Ga0098055_11766491 | 3300006793 | Marine | MGPEAKLYQNVKQNFKQFSLIRIENISLLGTPDLL |
| Ga0070749_104079931 | 3300006802 | Aqueous | MGPERKLYQKLKKNFTDISLIRLENNSLLGTPDILACNSSGH |
| Ga0070749_104161591 | 3300006802 | Aqueous | MGPEAKFYQNVKQNFKQLSLIRIENNSLLGTPDLL |
| Ga0098051_11115691 | 3300006924 | Marine | MGPEAKFYQQIKKKFKSFSLIRLENSSLLGTPDLLVCNTSGHFR |
| Ga0098041_11339671 | 3300006928 | Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLV |
| Ga0098036_11276741 | 3300006929 | Marine | MGPEAKFYQQIKRNFKSFSLIRLENSSLLGTPDLLVCNTS |
| Ga0098036_12636711 | 3300006929 | Marine | MGPERKLYQKVKKNFSDFSLIRLENNSLHGTPDLLV |
| Ga0098046_11325723 | 3300006990 | Marine | MGPERKLYQKIKKHFTDISLIRLENNSLHGTPDLLAYN |
| Ga0075468_100694551 | 3300007229 | Aqueous | MGPEAKFYQQIKRNFKQLSLIRIENSSLLGTPDLLVY |
| Ga0075468_102138471 | 3300007229 | Aqueous | MGPEAKFYQQIKRNFKQFSLIRLENSSLLGTPDLLVCN |
| Ga0075460_100626201 | 3300007234 | Aqueous | MGPERKLYQKVKNKLTSISWIRLENNSLLGTPDLL |
| Ga0070753_10320791 | 3300007346 | Aqueous | MGPEAKFYQQIKRNFKQLSLIRIENNSLLGTPDLLVCNTSGN |
| Ga0102817_11366583 | 3300007555 | Estuarine | MGPERKLYQKVKKSFSDFSLIRLENSSLHGTPDLLVSN |
| Ga0070751_13213773 | 3300007640 | Aqueous | MGPEAKFYQQIKRNFKSLSLIRIENSSLLGTPDLLVCNTS |
| Ga0110931_11282621 | 3300007963 | Marine | MGPEAKFYQQIKRNFKSFSLIRIENSSLLGTPDLL |
| Ga0105748_103844121 | 3300007992 | Estuary Water | MGPEAKFYQQIKRNFKSLSLIRIENSSLLGTPDLLVCN |
| Ga0075480_101819594 | 3300008012 | Aqueous | MGPEAKFYQQIKRNFKQLSLIRIENNSLLGTPDLLVCNTSG |
| Ga0114905_12715661 | 3300008219 | Deep Ocean | MGPEAKFYQQIKRNFKQLSLIRIENSSLLGTPDLLVCNT |
| Ga0102810_12963163 | 3300009002 | Estuarine | MGPEAKFYQQIKRNFKQFSLIRIENSSLLGTPDLLVCNTSG |
| Ga0115552_10717165 | 3300009077 | Pelagic Marine | MGPEAKLYQKVKRHFKDFSLLRLENISLLGTPDLLVY |
| Ga0114903_11283463 | 3300009412 | Deep Ocean | MGPERKLYQKLKKSFSDFSLIRLENNSLHGTPDLLVSNVRGHFF |
| Ga0114902_10901664 | 3300009413 | Deep Ocean | MGPERKLYQKVKKAFDSFSLIRLENNRLLGTPDLLGYN |
| Ga0115546_11327414 | 3300009435 | Pelagic Marine | MAPERKLYQKVKKSFNSFSLIRLENNSLHGTPDLLGYN |
| Ga0115558_10499491 | 3300009449 | Pelagic Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLL |
| Ga0115572_104259001 | 3300009507 | Pelagic Marine | MGPEAKLYQNVKQNFKQFSLIRLENISLLGTPDLLVCNTS |
| Ga0115013_113226141 | 3300009550 | Marine | MGPERKLYQKIKKHFTDISLIRLENNSLHGTPDLLAYNNS |
| Ga0115011_112280221 | 3300009593 | Marine | MGPEAKLYQNVKQNFKQFSLIRLENISLLGTPDLL |
| Ga0114911_11873313 | 3300009603 | Deep Ocean | MGPEAKFYQQIKRNFKSFSLIRIENNSLLGTPDVLVC |
| Ga0115000_105105251 | 3300009705 | Marine | MGPEAKFYQKIKRNFNGFSLSRVENLSSLGHPDVLGYNTNRHF |
| Ga0098056_10808374 | 3300010150 | Marine | MGPERKLYQKVKKNFSDFSLIRLENNSLHGTPDLLVSN |
| Ga0098056_10937591 | 3300010150 | Marine | MGSEAKFYQQIKKNFKSFSLIRLENSSLLGTPDLLVCNTSGH |
| Ga0098059_11744441 | 3300010153 | Marine | MGPEAKLYQNVKQNFKSFSLIRIENISLLGTPDLLV |
| Ga0114922_101253361 | 3300011118 | Deep Subsurface | MGPERKLYQKVKKTFTDFSLNRLENNSLLGTPDLL |
| Ga0160423_106190951 | 3300012920 | Surface Seawater | MAPERKFYQKIKRNFTEFSLIRLENNSLLGTPDLLVYNAN |
| Ga0163110_113218301 | 3300012928 | Surface Seawater | MAPERKFYQKIKKHFSDFSLIRLENSSLHGTPDLLVCN |
| Ga0163179_106756571 | 3300012953 | Seawater | MGPEAKFYQQIKRNFKSFSLIRIENNSLLGTPDVLVCNTSG |
| Ga0181387_10434671 | 3300017709 | Seawater | MGPEAKFYQQIKRNLKEFSFIRLENSSLLGTPDLLV |
| Ga0181403_10682841 | 3300017710 | Seawater | MGPERKLYQKVKKSFKDFSLNRLENTSLHGTPDILACNNSGHF |
| Ga0181404_11021581 | 3300017717 | Seawater | MGPEAKLYQNVKQNFKQFSLIRLENISLLGTPDLLVCN |
| Ga0181373_10435193 | 3300017721 | Marine | MGPEAKLYQNVKQNFRQFSLIRIENISLLGTPDLLVCNTSG |
| Ga0181381_10270021 | 3300017726 | Seawater | MGPEAKFYQQIKKNFKSLSLIRIENSSLLGTPDIL |
| Ga0181416_10706953 | 3300017731 | Seawater | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVCN |
| Ga0181426_10225414 | 3300017733 | Seawater | MGPEAKFYQQIKRNFKSLSLIPIENGRLLETADLLDYNT |
| Ga0181428_10174151 | 3300017738 | Seawater | MGPEAKFYQNVKQNFRQNSLIRLENLSLLRSLGLLVRNNSGHY |
| Ga0181428_10900343 | 3300017738 | Seawater | MGPEAKFYQQIKRNFKQLSFIRIENSSLLGTPDLLV |
| Ga0181433_11070683 | 3300017739 | Seawater | MGPEAKFYQQIKRNFKSLSLIRLENNSLLGTPVLLVYTTSGNFFTLALHV |
| Ga0181421_11049211 | 3300017741 | Seawater | MGPEAKFYQQIKRNFKQLSLIRIENSSLLGTPDLLVCNTS |
| Ga0181393_10575414 | 3300017748 | Seawater | MAPERKLYQKVKKSFDSFSLIRLENNSLLGTPDILACNNSGHFF |
| Ga0181382_11810111 | 3300017756 | Seawater | MGPERKLYQKVKKTFDSFSLIRLENNSLHGTPDLLG |
| Ga0181408_10726521 | 3300017760 | Seawater | MGPERKLYQKIKKHFSDFSLIRLENNSLHGTPDLLVSNAR |
| Ga0181413_11191544 | 3300017765 | Seawater | MGPERKLYQKVKKSFSDFSLIRLENNSLHGTPDLLVS |
| Ga0181406_11220911 | 3300017767 | Seawater | MGPEAKFYKEIKRKLSEFSFVRIENSSLLGTPDLL |
| Ga0187220_11421883 | 3300017768 | Seawater | MGPEAKFYQQIKRNLKEFSFIRIENSSLLGTPDLLVCNTS |
| Ga0181430_11515471 | 3300017772 | Seawater | MGPEAKFYQQIKKNFKEFSLIRLENSSLLGTPDLLVCNT |
| Ga0181380_10850875 | 3300017782 | Seawater | MGPERKFYQKIKKHFTNISLIRLENNSLHGTPDLLA |
| Ga0181576_105271314 | 3300017985 | Salt Marsh | MGPERKLYQKVKKSFSNFSLIRLENHSLHGTPDLLVSN |
| Ga0181576_105389391 | 3300017985 | Salt Marsh | LKPEQKFYEKIKKSFKQFSLIRLENNSLHGTPDLLV |
| Ga0181601_106552083 | 3300018041 | Salt Marsh | MGPEAKFYQQIKKNFKSFSLIRLENSSLLGTPDLLVCN |
| Ga0181560_105433783 | 3300018413 | Salt Marsh | LKPEQKVYGKVKKYFKGFSLIRLENNSLHGTPDLLVCN |
| Ga0181592_105925521 | 3300018421 | Salt Marsh | MAPERKFYQKIKRAFSDFSLIRLENNSLHGTPDLLVCN |
| Ga0206124_100430241 | 3300020175 | Seawater | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVYN |
| Ga0211483_102395003 | 3300020281 | Marine | MAPERKFYQKIKRAFSDFSLIRLENNSLHGTPDLLVCNA |
| Ga0211652_100417511 | 3300020379 | Marine | MGPEAKLYQNVKQNFKQFSLIRIENISLLGTPDLLVC |
| Ga0211486_104389901 | 3300020460 | Marine | LKPEQKFYAKIKKYFKTFSLIRLENNSLHGTPDLLV |
| Ga0206123_104666791 | 3300021365 | Seawater | MGPEAKLYQNVKQNFKQLSLIRIENNSLLGTPDLL |
| Ga0213861_106073771 | 3300021378 | Seawater | MGPEAKLYQNVKQNFKQLSLIRIENNSLLGTPDLLVCNTSEH |
| Ga0222715_105092191 | 3300021960 | Estuarine Water | MAPERKLYQKIKKHFNEFSLIRLENLSLSGTPDLLVYN |
| Ga0212023_10133824 | 3300022061 | Aqueous | MGPEAKLYQNVKQNFKQLSLIRIENNSLLGTPDLLVCN |
| Ga0224906_10465525 | 3300022074 | Seawater | MGPERKLYQKVKKSFSDFSLIRLENNSLHGTPDLLVSNAR |
| Ga0224906_10644991 | 3300022074 | Seawater | MGPEAKFYQQIKRNFKQFSLIRIENSSLLGTPDLLVCNT |
| Ga0224906_11570481 | 3300022074 | Seawater | MGPEAKFYQQIKRNLKEFSFIRIENSSLLGTPDLLVCNT |
| Ga0212022_10264904 | 3300022164 | Aqueous | MGPEAKFYQQIKRNFKQLSLIRIENNSLLGTPDLLVC |
| Ga0255772_105816343 | 3300023176 | Salt Marsh | MAPERKFYQKIKRAFSNFSLIRLENNSLHGTPDLLVCNANGHF |
| Ga0228653_10760693 | 3300024237 | Seawater | MGPEAKFYQQIKRNLKGFSFIRIENSSLLGTPDLL |
| Ga0209992_103250181 | 3300024344 | Deep Subsurface | MGPEAKFYQKLKRNFKSISLIRIENSSLHGTPDLL |
| Ga0207905_10336124 | 3300025048 | Marine | MGPEAKFYQNVKQNFRQFSLIRLENISLLGTPDLL |
| Ga0207896_10289951 | 3300025071 | Marine | MGPEAKLYQKVKRNFKEFSLIRLENLSLLGTPDLLV |
| Ga0208434_10246405 | 3300025098 | Marine | MGPEAKFYQQIKKNFKSFSLIRLENSSLLGTPDLLVCNT |
| Ga0208434_10705443 | 3300025098 | Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVCNTSGHFC |
| Ga0208669_10416574 | 3300025099 | Marine | MGPEAKFYQNVKQNFKQFSLIRLENISLLGTPDLLVCN |
| Ga0208669_10867071 | 3300025099 | Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVCNTS |
| Ga0208666_10587984 | 3300025102 | Marine | MGPEAKFYQNVKQNFQQFSLIRIENIGLLGTPDLL |
| Ga0208158_10390851 | 3300025110 | Marine | MGPERKLYQKVKNNFKDISLIRLENNSLHGTPDLL |
| Ga0208158_10587214 | 3300025110 | Marine | MGPEAKFYQQIKRNFKSFSLIRLENSSLLGTPDLL |
| Ga0208158_10732371 | 3300025110 | Marine | MGPEAKFYQQIKRNFKQFSLIRLENSSLLGTPDLLVCNTS |
| Ga0209349_11375801 | 3300025112 | Marine | MGPEAKFYQQIKRNFKSLSLIRIENNSLLGTPDLLVCNT |
| Ga0209535_10860604 | 3300025120 | Marine | MGPEAKFYQNVKQNFKQFSLIRLENISLLGTPDLLV |
| Ga0209535_12047841 | 3300025120 | Marine | MGPEAKFYQQIKRNFKQLSLIRIENNSLLGTPDLLVCK |
| Ga0209348_11825613 | 3300025127 | Marine | MGPEAKFYQQIKRNFKSLSLIRIENNSLLGTPDLLV |
| Ga0208919_12319293 | 3300025128 | Marine | MGPEAKFYQQIKRNFKSFSLIRLENSSLLGTPDLLVCNT |
| Ga0208919_12565163 | 3300025128 | Marine | MGPEAKFYQQIKKNFKLFSLIRLENSSLLGTPDLLVCNTSG |
| Ga0209232_10962134 | 3300025132 | Marine | MAPERKLYQKLKKNCNYISWIRLENITLSGTPDLL |
| Ga0209232_11383111 | 3300025132 | Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVC |
| Ga0209336_101211851 | 3300025137 | Marine | MGPERKLYQKLKKNFTDISLIRLENNSLLGTPDILACNS |
| Ga0209337_10636115 | 3300025168 | Marine | MGPEAKFYQQIKRNFKQLSLIRIENSSLLGTPDLL |
| Ga0208031_10389041 | 3300025237 | Deep Ocean | MGPEAKFYQKIKRNFNEFSLSRVENLSSLGHPDILG |
| Ga0208182_10788023 | 3300025251 | Deep Ocean | MGPEAKFYQQIKRNFKQLSLIRIENSSLLGTPDLLV |
| Ga0208182_10823101 | 3300025251 | Deep Ocean | MAPERKLYQKVKKAFNSFSLIRLENNSLHGTPDLL |
| Ga0208149_10961543 | 3300025610 | Aqueous | MGPEAKLYQNVKQNFKQLSLIRIENNSLLGTPDLLVCNTSG |
| Ga0209657_11954333 | 3300025676 | Marine | MGPEAKLYQKVKRHFKDFSLLRLENISLLGTPDLL |
| Ga0208543_10636321 | 3300025810 | Aqueous | MGPEAKLYQNVKQNFKQLSLIRIENNSLLGTPDLLVCNTSGH |
| Ga0209193_11083843 | 3300025816 | Pelagic Marine | MGPERKLYQKVKKTFSNFSLNRLENTSLHGTPDILACNSF |
| Ga0208542_11229471 | 3300025818 | Aqueous | MGPEAKLYQNVKQNFKQLSLIRIENNSLLGTPDLLVCNT |
| Ga0209534_102565151 | 3300025880 | Pelagic Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVY |
| Ga0209630_102515761 | 3300025892 | Pelagic Marine | MGPEAKFYQQIKRNFKSLSLIRIENNSLLGTPDLLVCNTS |
| Ga0209927_10380611 | 3300026106 | Soil | MAPERKLYQKIKKHFNEFSLIRLENLSLSGTPDLLVY |
| Ga0208797_10433333 | 3300027186 | Estuarine | MGPERKLYQKVKKTFDNFSLNRLENTSLHGTPDILACN |
| Ga0209192_101487021 | 3300027752 | Marine | MGPEAKFYQIVKKNLPGFSLIRLENSSLLGTPDLLVYNTS |
| Ga0209709_1000426830 | 3300027779 | Marine | MGPEAKFYQKIKRNFSEFSLTRVENLSSLGHPDIL |
| Ga0209502_101560844 | 3300027780 | Marine | MGPEAKFYQQIKRNFKQFSLIRLENSSLLGTPDLL |
| Ga0209830_103499961 | 3300027791 | Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVCNTSGN |
| Ga0209404_103237171 | 3300027906 | Marine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDLLVCNT |
| (restricted) Ga0233414_103655793 | 3300028045 | Seawater | MGPERKLYQKVKNNFKDFSLIRLENNSLLGTPDLL |
| Ga0257107_10708681 | 3300028192 | Marine | MGPEAKLYQKLRKNSKGISWIRLENLSSLGTPDLLGYNDSGHFFTV |
| Ga0247572_11646481 | 3300028290 | Seawater | MAPERKLYQKVKKHFKDFSLIRLENNSLHGTPDLL |
| Ga0256383_1011225 | 3300028448 | Seawater | MGPEAKFHKEIKRKLPEFSWIRIENISLLGTPDLL |
| Ga0256383_1211171 | 3300028448 | Seawater | LKQERKFYEKIKKSIPHISWIRLENNSLLGTPDLLACL |
| Ga0135227_10393131 | 3300029302 | Marine Harbor | MGPERKFYQKVKKSFTNISLIRLENNSLHGTPPIVTGK |
| Ga0185543_11143893 | 3300029318 | Marine | MGPERKLYQKVKKSFSDFSLIRLENNSLHGTPDLL |
| Ga0183757_10348804 | 3300029787 | Marine | MGPEAKFYQKIKRNFKSISLIRIENSSLHGTPDLL |
| Ga0183757_10419921 | 3300029787 | Marine | MAPERKLYQKVKKTFNSFSLIRLENNSLHGTPDLLGYN |
| Ga0308022_11740833 | 3300031142 | Marine | MGPEAKLYKKLKQNFKGFYLSRVENLSSLGHPDVLG |
| Ga0308010_13419301 | 3300031510 | Marine | MGPEAKFYQKIKRNFNDFSLTRVENLSSLGHPDVL |
| Ga0308008_11431821 | 3300031687 | Marine | MGPEAKFYQKIKRNFNGFSLSRVENLSSLGHPDVL |
| Ga0308016_102749663 | 3300031695 | Marine | MGPEANFYQNVKKNFKCLSLIRLENSSLLGTPDLLVSNT |
| Ga0307995_12886781 | 3300031696 | Marine | MGPEAKLYQNVKKNFKQFSLIRLENLSLLGTPDLLVSN |
| Ga0308002_11218201 | 3300031703 | Marine | MGPEAKLYQNVKKHFKQFSLIRLENLSLLGTPDLL |
| Ga0315315_114631613 | 3300032073 | Seawater | MAPERKLYQKVKKAFNSFSLIRLENNSLHGTPDLLGYN |
| Ga0316201_111627131 | 3300032136 | Worm Burrow | MGPERKLYQKVKKTFTDFSLNRLENNSLLGTPDLLVYNNS |
| Ga0316208_10384005 | 3300032254 | Microbial Mat | MGPEAKFYQQIKRNFKSLSLIRIENSSLLGTPDLL |
| Ga0314858_009984_2_127 | 3300033742 | Sea-Ice Brine | MGPEAKFYQQIKRNFREFSLIRLENNSLLGTPDLLVCNNSPT |
| Ga0314858_136526_1_123 | 3300033742 | Sea-Ice Brine | MGPEAKFYQQIKRNFKEFSLIRLENSSLLGTPDILVCNTSG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |