| Basic Information | |
|---|---|
| Family ID | F041970 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGD |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.37 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 94.97 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.226 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.836 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.509 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.006 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.26% β-sheet: 0.00% Coil/Unstructured: 39.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF02355 | SecD_SecF | 36.48 |
| PF07549 | Sec_GG | 3.77 |
| PF03401 | TctC | 0.63 |
| PF14714 | KH_dom-like | 0.63 |
| PF03544 | TonB_C | 0.63 |
| PF02699 | YajC | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 40.25 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 40.25 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.63 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.23 % |
| Unclassified | root | N/A | 3.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111006|2214880213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 579 | Open in IMG/M |
| 2228664021|ICCgaii200_c0918399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104937939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1022304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300000891|JGI10214J12806_12634782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300000955|JGI1027J12803_109637772 | Not Available | 939 | Open in IMG/M |
| 3300000956|JGI10216J12902_109665736 | Not Available | 563 | Open in IMG/M |
| 3300001139|JGI10220J13317_10411388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300004156|Ga0062589_100694934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300004157|Ga0062590_102108027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300004463|Ga0063356_103123594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300004798|Ga0058859_11729974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005293|Ga0065715_11060011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 513 | Open in IMG/M |
| 3300005328|Ga0070676_10462888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300005330|Ga0070690_100862970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300005333|Ga0070677_10355813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300005334|Ga0068869_101291354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300005335|Ga0070666_10647315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300005335|Ga0070666_11398736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300005339|Ga0070660_101071733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300005340|Ga0070689_101049996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300005340|Ga0070689_101445577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300005341|Ga0070691_10523851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300005345|Ga0070692_10179701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1226 | Open in IMG/M |
| 3300005345|Ga0070692_10352765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300005345|Ga0070692_10604336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300005353|Ga0070669_101461819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300005438|Ga0070701_10676067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005440|Ga0070705_100235661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
| 3300005440|Ga0070705_100820387 | Not Available | 742 | Open in IMG/M |
| 3300005441|Ga0070700_100377101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300005444|Ga0070694_101773159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005535|Ga0070684_101284104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300005536|Ga0070697_101373045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300005546|Ga0070696_100238818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1370 | Open in IMG/M |
| 3300005547|Ga0070693_100389378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300005547|Ga0070693_100756038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300005564|Ga0070664_100348395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300005564|Ga0070664_101919434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300005577|Ga0068857_100006124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 10278 | Open in IMG/M |
| 3300005577|Ga0068857_102494968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300005616|Ga0068852_101108240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300005719|Ga0068861_102085183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300005842|Ga0068858_100071099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3226 | Open in IMG/M |
| 3300005842|Ga0068858_100088733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2877 | Open in IMG/M |
| 3300005844|Ga0068862_101904949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300005844|Ga0068862_102563593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005844|Ga0068862_102793818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300006173|Ga0070716_100285624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1141 | Open in IMG/M |
| 3300006791|Ga0066653_10606372 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006804|Ga0079221_11224528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300006806|Ga0079220_10457245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300006844|Ga0075428_100516285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1278 | Open in IMG/M |
| 3300006854|Ga0075425_101912289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300006954|Ga0079219_11014193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300006969|Ga0075419_10672053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300006969|Ga0075419_10753739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300009100|Ga0075418_11913474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 646 | Open in IMG/M |
| 3300009148|Ga0105243_12742578 | Not Available | 533 | Open in IMG/M |
| 3300009176|Ga0105242_12843832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 534 | Open in IMG/M |
| 3300009551|Ga0105238_12144759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 593 | Open in IMG/M |
| 3300009840|Ga0126313_11067257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300010038|Ga0126315_10981275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 565 | Open in IMG/M |
| 3300010038|Ga0126315_11159953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 524 | Open in IMG/M |
| 3300010041|Ga0126312_10425177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 946 | Open in IMG/M |
| 3300010044|Ga0126310_10649502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 793 | Open in IMG/M |
| 3300010046|Ga0126384_12414524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 509 | Open in IMG/M |
| 3300010047|Ga0126382_10626243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 890 | Open in IMG/M |
| 3300010159|Ga0099796_10214786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300010373|Ga0134128_11183116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 844 | Open in IMG/M |
| 3300010373|Ga0134128_12995352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 520 | Open in IMG/M |
| 3300010399|Ga0134127_12574504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 589 | Open in IMG/M |
| 3300010400|Ga0134122_10823700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 889 | Open in IMG/M |
| 3300010400|Ga0134122_12163492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300010401|Ga0134121_10892749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 863 | Open in IMG/M |
| 3300011119|Ga0105246_10468723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1063 | Open in IMG/M |
| 3300011119|Ga0105246_10503032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1029 | Open in IMG/M |
| 3300011436|Ga0137458_1209641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 592 | Open in IMG/M |
| 3300012022|Ga0120191_10101965 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012045|Ga0136623_10001495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 8047 | Open in IMG/M |
| 3300012210|Ga0137378_10725088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 905 | Open in IMG/M |
| 3300012212|Ga0150985_100603430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1371 | Open in IMG/M |
| 3300012684|Ga0136614_10024489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4459 | Open in IMG/M |
| 3300012899|Ga0157299_10225934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 579 | Open in IMG/M |
| 3300012899|Ga0157299_10267797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 550 | Open in IMG/M |
| 3300012907|Ga0157283_10069602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 864 | Open in IMG/M |
| 3300012910|Ga0157308_10322864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 573 | Open in IMG/M |
| 3300012917|Ga0137395_10603456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 793 | Open in IMG/M |
| 3300012930|Ga0137407_10135368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2159 | Open in IMG/M |
| 3300012951|Ga0164300_10362649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 782 | Open in IMG/M |
| 3300012955|Ga0164298_11642853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 508 | Open in IMG/M |
| 3300012958|Ga0164299_10684143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 715 | Open in IMG/M |
| 3300012961|Ga0164302_10212388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1200 | Open in IMG/M |
| 3300012987|Ga0164307_11403722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 588 | Open in IMG/M |
| 3300013102|Ga0157371_11103729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 608 | Open in IMG/M |
| 3300013306|Ga0163162_12184713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300013754|Ga0120183_1012841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300014325|Ga0163163_10776523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1021 | Open in IMG/M |
| 3300014326|Ga0157380_12507493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 581 | Open in IMG/M |
| 3300014487|Ga0182000_10255622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300014969|Ga0157376_10171069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1978 | Open in IMG/M |
| 3300015261|Ga0182006_1278117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 549 | Open in IMG/M |
| 3300015262|Ga0182007_10278428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 608 | Open in IMG/M |
| 3300015372|Ga0132256_102072190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300015373|Ga0132257_101857301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 775 | Open in IMG/M |
| 3300015374|Ga0132255_103949041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300018051|Ga0184620_10333271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 514 | Open in IMG/M |
| 3300018067|Ga0184611_1205323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300018422|Ga0190265_11685886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 744 | Open in IMG/M |
| 3300018422|Ga0190265_13769244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 505 | Open in IMG/M |
| 3300018466|Ga0190268_10903085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300018469|Ga0190270_11089759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 831 | Open in IMG/M |
| 3300018476|Ga0190274_12758133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300018476|Ga0190274_13143300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 555 | Open in IMG/M |
| 3300018920|Ga0190273_10534109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 867 | Open in IMG/M |
| 3300019362|Ga0173479_10036990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1522 | Open in IMG/M |
| 3300019377|Ga0190264_10605183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 783 | Open in IMG/M |
| 3300020002|Ga0193730_1180082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300020004|Ga0193755_1216436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 536 | Open in IMG/M |
| 3300021445|Ga0182009_10474573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 656 | Open in IMG/M |
| 3300025321|Ga0207656_10279544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 823 | Open in IMG/M |
| 3300025325|Ga0209341_10075408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2852 | Open in IMG/M |
| 3300025893|Ga0207682_10293495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 761 | Open in IMG/M |
| 3300025893|Ga0207682_10330303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300025903|Ga0207680_10772848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300025903|Ga0207680_11362778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 504 | Open in IMG/M |
| 3300025907|Ga0207645_10090410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1968 | Open in IMG/M |
| 3300025907|Ga0207645_10606910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 743 | Open in IMG/M |
| 3300025917|Ga0207660_10502422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 984 | Open in IMG/M |
| 3300025919|Ga0207657_10609685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 851 | Open in IMG/M |
| 3300025920|Ga0207649_10546849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300025921|Ga0207652_11301557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 629 | Open in IMG/M |
| 3300025925|Ga0207650_11659459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300025931|Ga0207644_10926205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 731 | Open in IMG/M |
| 3300025940|Ga0207691_11287005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 604 | Open in IMG/M |
| 3300025961|Ga0207712_11274597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300025972|Ga0207668_10920678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 779 | Open in IMG/M |
| 3300025981|Ga0207640_10517812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300026023|Ga0207677_11884741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 555 | Open in IMG/M |
| 3300026095|Ga0207676_12137057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 558 | Open in IMG/M |
| 3300026118|Ga0207675_100636454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1072 | Open in IMG/M |
| 3300027462|Ga0210000_1075248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300027761|Ga0209462_10069950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300027846|Ga0209180_10324561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 880 | Open in IMG/M |
| 3300028381|Ga0268264_11532719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 677 | Open in IMG/M |
| 3300031456|Ga0307513_10634194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 776 | Open in IMG/M |
| 3300031740|Ga0307468_102393875 | Not Available | 515 | Open in IMG/M |
| 3300031847|Ga0310907_10283921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 827 | Open in IMG/M |
| 3300031858|Ga0310892_11011467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 586 | Open in IMG/M |
| 3300031901|Ga0307406_10207220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
| 3300031908|Ga0310900_10418604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1022 | Open in IMG/M |
| 3300031908|Ga0310900_11458746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300031943|Ga0310885_10868309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300033412|Ga0310810_10754357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 891 | Open in IMG/M |
| 3300033475|Ga0310811_10970700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 750 | Open in IMG/M |
| 3300034672|Ga0314797_120730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300034817|Ga0373948_0018547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1308 | Open in IMG/M |
| 3300034965|Ga0370497_0196671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.14% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.26% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.26% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.26% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.63% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.63% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2213932178 | 2209111006 | Arabidopsis Rhizosphere | MFDNLVESSSHKDDISRKGSFVVATALIYGVLLLAFFVAGIYWYDNHLGEMELELTTL |
| ICCgaii200_09183992 | 2228664021 | Soil | MFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYDNHLGQMELE |
| INPhiseqgaiiFebDRAFT_1049379392 | 3300000364 | Soil | MFENLVESTTHKDDLARKGSFILATLVVYGVLGLAFFIAGIFWYDAHLENQNLEL |
| KanNP_Total_noBrdU_T14TCDRAFT_10223041 | 3300000596 | Soil | MFDNLVESSSHKADIERKGSFILGTAVIYGVLLVGFFVAGIYWYDNKL |
| JGI10214J12806_126347821 | 3300000891 | Soil | MFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLI |
| JGI1027J12803_1096377721 | 3300000955 | Soil | MFDNLVESSSHKDDITRKGSFIGVTALIYGVLLVG |
| JGI10216J12902_1096657361 | 3300000956 | Soil | MFDNLVESSSHKEDITRKGSFIGITLLIYAVLLPG |
| JGI10220J13317_104113882 | 3300001139 | Soil | MFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLITLVAPV |
| Ga0062589_1006949341 | 3300004156 | Soil | MFDNLVESNSHKGDISRKGSFILVTSVVYAVLGLAFFVAGIYWYDAHLENQSLDLITLVAPV |
| Ga0062590_1021080271 | 3300004157 | Soil | MFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLITLVA |
| Ga0063356_1031235941 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIY |
| Ga0058859_117299741 | 3300004798 | Host-Associated | MFDNLVESSSHKDDITRKGSFIGITFLIYGVLILTFFIAGIYWYDARLGDMELELTTLVAPV |
| Ga0065715_110600111 | 3300005293 | Miscanthus Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLAVYVVLIVVFVVAGILMYDAHLTAQDLELTTL |
| Ga0070676_104628881 | 3300005328 | Miscanthus Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIY |
| Ga0070690_1008629701 | 3300005330 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYW |
| Ga0070677_103558132 | 3300005333 | Miscanthus Rhizosphere | MFDNLVESSSHKKDIERKGSFIIVTAVIYLVLLVAFFVAG |
| Ga0068869_1012913541 | 3300005334 | Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELEL |
| Ga0070666_106473152 | 3300005335 | Switchgrass Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYDNHL |
| Ga0070666_113987361 | 3300005335 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKGSFVGITALIYTVLLVTFFVAGIYWYDARLGDMELEL |
| Ga0070660_1010717331 | 3300005339 | Corn Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITFLIYGVLILTFFIAGIYWYDARL |
| Ga0070689_1010499962 | 3300005340 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELELT |
| Ga0070689_1014455772 | 3300005340 | Switchgrass Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVIAGIFLYDAHLSEMELELTTLVA |
| Ga0070691_105238511 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFIAGIYW |
| Ga0070692_101797012 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDIARKGSFIGVTLAIYAVLIAVFFVAGIYLYDAHLSTLDLELTTLV |
| Ga0070692_103527652 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKSDLTRKGSFIGITALIYGVLLVVFFVAGIYLYDAHLADME |
| Ga0070692_106043362 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFIGVTALIYGVLLVTFFVAGIYWYDAKLGEMELELT |
| Ga0070669_1014618191 | 3300005353 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITAVIYGVLILAFFVVGIFWYDAK |
| Ga0070701_106760671 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGDM |
| Ga0070705_1002356612 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITALIYGVLLLAFFVAG |
| Ga0070705_1008203871 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKNDLTRKGSFIGVTLAIYFVGILTFFVVGIF |
| Ga0070700_1003771013 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKSDLTRKGSFIGITALIYGVLLVVFFVAGIYLYDAHLADMELE |
| Ga0070694_1017731591 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITFAVYAVLIATFFIAGIYLYDAHLATLDL |
| Ga0070684_1012841041 | 3300005535 | Corn Rhizosphere | MFENLVESNSHKDDIARKGSFIGVTLLIYGVLLLTFFVAGIYWYDNHLD |
| Ga0070697_1013730451 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITMAIYVVLIGVFFVAGIYLYDAH |
| Ga0070696_1002388182 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MFENLVESTSHKDDISRKGSFILVTTLVYLVLGVAFFVAGVYWYDNHLGELELE |
| Ga0070693_1003893781 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFIGVTLAIYAVLIGVFFVAGIYLYDAHLSTLDLE |
| Ga0070693_1007560381 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLAIYVVLIAVFVVAGILMYDAHLTAQDLELTTLVA |
| Ga0070664_1003483952 | 3300005564 | Corn Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFIAGIYWYDARLGDMEL |
| Ga0070664_1019194342 | 3300005564 | Corn Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVIAGIFLYDAHLS |
| Ga0068857_1000061241 | 3300005577 | Corn Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYD |
| Ga0068857_1024949681 | 3300005577 | Corn Rhizosphere | MFENLVESSSHKDDIARKGSFIGITALIYGLLLVGFFVAGIYWYDARLGDMELELTTL |
| Ga0068852_1011082401 | 3300005616 | Corn Rhizosphere | MFDNLVESSSHKQDLSRKGSFIVGTTIIYAVLLLTFFVAGIYWYDAKLGEM |
| Ga0068861_1020851832 | 3300005719 | Switchgrass Rhizosphere | MFDNLVESSSHKQDLSRKGSFIVGTTIIYAVLLLTFFVAGIYWYDAKLGEMELELTTL |
| Ga0068858_1000710991 | 3300005842 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYWYD |
| Ga0068858_1000887331 | 3300005842 | Switchgrass Rhizosphere | MFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTFFVAGIYWYDNKLGEMELELTTL |
| Ga0068862_1019049491 | 3300005844 | Switchgrass Rhizosphere | MFDNLVESSSHKQDLSRKGSFIVGTTIIYAVLLLTF |
| Ga0068862_1025635931 | 3300005844 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELELTTL |
| Ga0068862_1027938181 | 3300005844 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYWYDARLGDMELELTTLVA |
| Ga0070716_1002856241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLLIYGVLLVGFFVAGILWYDNHLSEQEYELTTLVA |
| Ga0066653_106063722 | 3300006791 | Soil | MFDNLVESSSHKDDITRKGSFIGITLLVYGVLFLAFFVAGSYWYDAHLEAQGLELTTLVA |
| Ga0079221_112245282 | 3300006804 | Agricultural Soil | MFDNLVESSSHRDDIARKGSFIGITALVYGVLLLAFFVAGIYWYDAHLEAQDLELTTLV |
| Ga0079220_104572451 | 3300006806 | Agricultural Soil | MFDNLVESSSHKDDIARKGSFIGVTLLVYAVLLLAFFVAGIYWYDNHLDQMELE |
| Ga0075428_1005162851 | 3300006844 | Populus Rhizosphere | MFDNLVESSSHKKDIERKGSFIIVTAVIYVVLLVAFFVAGIYWYDNHLGEMELEL |
| Ga0075425_1019122891 | 3300006854 | Populus Rhizosphere | MFENLVESNSHKDDIARKGSFIGVTLLIYGVLLLTFFVAGIYWYDNHLDQMELELTT |
| Ga0079217_101709691 | 3300006876 | Agricultural Soil | MFDNLVESSSHKQDISRKGSFVLVTALIYGVLLGGFFVAGILWYDAHLAEQELELTTLVAPVRVPQQQKEPEQKQ |
| Ga0079219_110141931 | 3300006954 | Agricultural Soil | MFDNLVESNSHKDDIARKGSFIGVTLLVYAVLLLAFFVAGIYWYDNHLDQMELELT |
| Ga0075419_106720531 | 3300006969 | Populus Rhizosphere | MFDNLVESSSHKDDIARKGSFIGVTALIYGVLIVAFFVV |
| Ga0075419_107537391 | 3300006969 | Populus Rhizosphere | MFDNLVESSSHKKDIERKGSFIIVTAFIYLVLVVSVFVARIYW* |
| Ga0075418_119134741 | 3300009100 | Populus Rhizosphere | MFDNLVESSSHKSDISRKGSFVAVTATIYLVLMAAFFIAGIYWYDTHL |
| Ga0105243_127425782 | 3300009148 | Miscanthus Rhizosphere | MFDNLVESSSHKSDISRKGSFVAVTALIYGVLLAGF |
| Ga0105242_128438321 | 3300009176 | Miscanthus Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYVVLLVAFFVAGIYWYDNHL |
| Ga0105238_121447591 | 3300009551 | Corn Rhizosphere | MFDNLVESSSHKDDITRKSSFIGITALIYGVLLVTFFVAGIYWYDARLGDMELEL |
| Ga0126313_110672571 | 3300009840 | Serpentine Soil | MFDNLVESSSHKDDIARKGSFIGITALIYGVLLVAF |
| Ga0126315_109812751 | 3300010038 | Serpentine Soil | MFDNLVESSSHKDDITRKSSFIGITALIYGVLLLTFFVAGIYWYDARLGD |
| Ga0126315_111599531 | 3300010038 | Serpentine Soil | MFDNLVESSSHKDDIARKGSFVGITALIYAVLLVTFFVAGIYWYDARLGDMELE |
| Ga0126312_104251771 | 3300010041 | Serpentine Soil | MFDNLVESSSHKDDIARKGSFIGITLLVYGVLITAFVIAGILWYDAR |
| Ga0126310_106495022 | 3300010044 | Serpentine Soil | MFDNLVESSSHKNDISRKGSFILVTALIYGVLIGVFVIAGIVFYDANMTPSDLELTTLIAPVPV |
| Ga0126384_124145241 | 3300010046 | Tropical Forest Soil | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVGFFVAGILWYDNHLS |
| Ga0126382_106262431 | 3300010047 | Tropical Forest Soil | MFENLVESSSHKDDIARKGSFIGVTALIYGVLLVAFFVVGIYLYDNHLDQMEL |
| Ga0099796_102147862 | 3300010159 | Vadose Zone Soil | MFDNLVESNSHKDDISRKGSFVVITLLVYTVLGVAFFVAG |
| Ga0134128_111831161 | 3300010373 | Terrestrial Soil | MFDNLVESSSHKDDIARKGSFIGVTALIYGVLMLAFFVAGIYWYDAHLDEQTLELTTLVA |
| Ga0134128_129953521 | 3300010373 | Terrestrial Soil | MFDNLVESSSHKDDIARKGSFIGITALIYGVLLVTFFV |
| Ga0134127_125745041 | 3300010399 | Terrestrial Soil | MFDNLVESSSHKQDISRKGSFIVVTALIYGVLLLGFFVAG |
| Ga0134122_108237002 | 3300010400 | Terrestrial Soil | MFENLVESSPHKDDLTRKGSFIGITMAIYVVLIAVFFVAGIYLYD |
| Ga0134122_121634922 | 3300010400 | Terrestrial Soil | MFDNLVESSSHKDDITRKGSFIGITMAIYVVLIGVFFVAGIYLYDAHLST |
| Ga0134121_108927491 | 3300010401 | Terrestrial Soil | MFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTIFVAGIYWYDNKLGEMELELTTLVA |
| Ga0105246_104687231 | 3300011119 | Miscanthus Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLAIYLVLIAVFFVAGIYLYDAHLAPSDLELTTLVA |
| Ga0105246_105030321 | 3300011119 | Miscanthus Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITALIYGVLLLAFFVAGIIWYDNHLSEQELELTTLVA |
| Ga0137458_12096411 | 3300011436 | Soil | MFDNLVESNSHKDDISRKGSFILVTIAVYTVLGTIFFVAGIYMYDAHMENQNQDMITLVAPVN |
| Ga0120191_101019652 | 3300012022 | Terrestrial | MFDNLVESSSHKDDISRKGSFILVTTVVYLVLGVAFFVAGIYWY |
| Ga0136623_100014959 | 3300012045 | Polar Desert Sand | MFENLVESNSHKGDLSRKGSFILVTTAIYFVLGLAFFIVGIYWYDAHLENQNLD |
| Ga0137378_107250881 | 3300012210 | Vadose Zone Soil | MFDNLVESSSHKNDISRKGSFVAITALIYLVLGVAFFVAGVYWYDNHLGEMELELTTLVA |
| Ga0150985_1006034303 | 3300012212 | Avena Fatua Rhizosphere | MFDNLVESSSHKDDLARKGSFIGATVAIYAVVLTALGIGSIFWYDAQLEN* |
| Ga0136614_100244891 | 3300012684 | Polar Desert Sand | MFDNLVESSSHKDDISRKGTFILVTVAVYAVLGIAFFVAG |
| Ga0157299_102259341 | 3300012899 | Soil | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFIAGIYWYDARLGDMELE |
| Ga0157299_102677971 | 3300012899 | Soil | MFDNLVESSSHKDDITRKGSFIGITFLIYGVLILTF |
| Ga0157283_100696021 | 3300012907 | Soil | MFDNLVESSSHRDDITRKGSFIGITFAIYAVLITTFFVAGIFLYDAHL |
| Ga0157308_103228641 | 3300012910 | Soil | LAPEVEDKKSMFDNLVESSSHKDDLSRKGSFVVATALIYGVLLLAFFVAGIYWYDNHLG |
| Ga0137395_106034561 | 3300012917 | Vadose Zone Soil | MFDNLVESSSHKDDISRKGSFVVITALIYAVLGVAFFVAGVYWYDNH |
| Ga0137407_101353681 | 3300012930 | Vadose Zone Soil | MFENLVESTSHKDDLSRKGSFILVTTLIYLVLGVAFFVAGVYWYENHLGEIE |
| Ga0164300_103626492 | 3300012951 | Soil | MFDNLVESSSHKDDLTRKGSFIGIPALIYGVLLVAFFVAGIIWYDNHLSVQ |
| Ga0164298_116428531 | 3300012955 | Soil | MFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYWYDNHLGEMELELTTLVAPV |
| Ga0164299_106841431 | 3300012958 | Soil | MFDNLVESSSHKDDLTRKGSFIGITLLIYGVLLVGFFVAGILWYDNHL |
| Ga0164302_102123882 | 3300012961 | Soil | MFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTFFIAGIYWYDN |
| Ga0164307_114037221 | 3300012987 | Soil | MFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYW |
| Ga0157371_111037291 | 3300013102 | Corn Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITALTYGVLLVTFFVAGIYWYDARLGDMELEL |
| Ga0163162_121847131 | 3300013306 | Switchgrass Rhizosphere | MFDNLVESSSHKSDLTRKGSFIGITALIYGVLLVVFFVAGIYLYDAHLADMEL |
| Ga0120183_10128411 | 3300013754 | Terrestrial | MFDNLVESSSHKDDITRKGSFVGITALIYLVLMVAFFVAGIYWYDAKLGEMELELT |
| Ga0163163_107765232 | 3300014325 | Switchgrass Rhizosphere | MFDNLVESSSHKDDIARKGSFIGITFLIYGVLIVTFFIAGIYWYDARLGDMELELTTLVA |
| Ga0157380_125074931 | 3300014326 | Switchgrass Rhizosphere | MFDNLVESSSHKDDISRKGSFIIATTVIYAVILVAF |
| Ga0182000_102556222 | 3300014487 | Soil | MFDNLVESSSHKDDIARKGSFIGVTFVVYLVLIVAFFIAGIYWYDARLGEMELE |
| Ga0157376_101710694 | 3300014969 | Miscanthus Rhizosphere | MFDNLVESSSHKDDIARKGSFIGITALIYGVLMLAFFVAGIYWYDAHLDEQTLELTTLV |
| Ga0182006_12781171 | 3300015261 | Rhizosphere | MFDNLVESNSHKDDITRKGSFIGITALIYGVLLLTFFVAG |
| Ga0182007_102784281 | 3300015262 | Rhizosphere | MFDNLVESSSHKDDITRKGSFIGVTLLVYAVLLLAFFVAGIYW |
| Ga0132256_1020721902 | 3300015372 | Arabidopsis Rhizosphere | MFDNLVESSSHKDDISRKGSFIGITALVYGVLILTFFVAGIYWYDAKLGE |
| Ga0132257_1018573012 | 3300015373 | Arabidopsis Rhizosphere | MFDNLVESSSHKDDLSRKGSFIVGTTVIYGVLLLTFFVAGIYWYDARLGNMELELTT |
| Ga0132255_1039490411 | 3300015374 | Arabidopsis Rhizosphere | MFDNLVESSSHKDDITRKGSFIGVTALIYGVLIVAFVVGGILWYDAKLGEMELELTT |
| Ga0184620_103332711 | 3300018051 | Groundwater Sediment | MFDNLVESSSHKDDLSRKGSFILVTAAIYLVLGLAFVIAGIYWYDNHLG |
| Ga0184611_12053232 | 3300018067 | Groundwater Sediment | MFDNLVESSSHKDDISRKGSFVLVTLTIYVVLAVAFFIGGIYWYD |
| Ga0190265_116858861 | 3300018422 | Soil | MFDNLVESSSHKDDIARKGSFIGVTALIYGVLMISFFVAGIYWYDAHLGEMELEL |
| Ga0190265_137692441 | 3300018422 | Soil | MFDHLVESSSHKQDLSRKGSFIAVTAAIYGVLLVVFFVAGIYMYDAHLAPSDLELTTLIAPVPVPQ |
| Ga0190268_109030851 | 3300018466 | Soil | MFDNLVESSSHKDDITRKGSFIGVTALIYGVLIGAFIIGGILWYDAKLSEMELELTT |
| Ga0190270_110897593 | 3300018469 | Soil | MFDNLVESSSHKDDISRKGSFVLVTLAIYGVLIVAFAIAGIYWYDNHLGNM |
| Ga0190274_127581331 | 3300018476 | Soil | MFDNLVESSSHKDDITRKGSFIGVTALIYFVLMAAFF |
| Ga0190274_131433001 | 3300018476 | Soil | MFDNLVESSSHKQDISRKGSFIVATALIYGVLLVGFFVAGILWYDAH |
| Ga0190273_105341091 | 3300018920 | Soil | MFDNLVESNSHKGDISRKGSFIFVTSVVYLVLGLAFFVAGIYWYD |
| Ga0173479_100369902 | 3300019362 | Soil | MFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYWYDNHLGEMELELTTLVA |
| Ga0190264_106051831 | 3300019377 | Soil | MFDNLVESSSHKGDISRKGSFILVTSVVYAVLGLAFFVAGIYWYDAHLENQSLD |
| Ga0193730_11800821 | 3300020002 | Soil | MFDNLVESSSHKNDISRKGSFVAITALIYAVLGVAF |
| Ga0193755_12164361 | 3300020004 | Soil | MFDNLVESSSHKDDISRKGSFVIVTLIVYTVLGVAFFVAGIYWYDNHLAEQDLELTTLV |
| Ga0182009_104745731 | 3300021445 | Soil | MFDNLVESSSHKQDISRKGSFIIVTALVYGVVLVAFFVVGIL |
| Ga0207656_102795441 | 3300025321 | Corn Rhizosphere | MFDNLVESSSHKDDISRKGSFVVATALIYGVLLLAFFV |
| Ga0209341_100754081 | 3300025325 | Soil | MFENLVESTSHKDDISRKGSFILVTTAVYAILGVAFFVGGIYWYDARLSELELE |
| Ga0207682_102934952 | 3300025893 | Miscanthus Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYAVLMVAFFVAGIYWYDNHLGQM |
| Ga0207682_103303032 | 3300025893 | Miscanthus Rhizosphere | MFDNLVESNSHKDDISRKGSFILATFAIYFVLGLAF |
| Ga0207680_107728482 | 3300025903 | Switchgrass Rhizosphere | MFDNLVESSSHKDDISRKGSFVVATALIYGVLLLAFFVAGIYWYDNHLGEMEL |
| Ga0207680_113627781 | 3300025903 | Switchgrass Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYVVLLVAFFVAGIYWYDNHLGQMELELT |
| Ga0207645_100904103 | 3300025907 | Miscanthus Rhizosphere | MFDNLVESSSHKKDIERKGSFIVGTAVIYGVLLLTFFVAGIYW |
| Ga0207645_106069101 | 3300025907 | Miscanthus Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGIYWYDNH |
| Ga0207660_105024221 | 3300025917 | Corn Rhizosphere | MFDNLVESNSHKGDISRKGSFILVTSVVYAVLGLAFFVA |
| Ga0207657_106096852 | 3300025919 | Corn Rhizosphere | MFDNLVESSSHKQDITRKGSFVIGTLIIYGVLIVA |
| Ga0207649_105468491 | 3300025920 | Corn Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITMAIYVVLIGVFF |
| Ga0207652_113015571 | 3300025921 | Corn Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGDMELELTTLVAGTAPMRAVPAK |
| Ga0207650_116594591 | 3300025925 | Switchgrass Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISTFVIA |
| Ga0207644_109262052 | 3300025931 | Switchgrass Rhizosphere | MFDNLVESSSHKDDITRKGSFVGITALIYAVLLVTFFVAG |
| Ga0207691_112870051 | 3300025940 | Miscanthus Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITMGIYVVLIGVFFVAGIYL |
| Ga0207712_112745972 | 3300025961 | Switchgrass Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVI |
| Ga0207668_109206781 | 3300025972 | Switchgrass Rhizosphere | MFDNLVESSSHKDDISRKGSFVAATALIYGVLMLAFFVAGI |
| Ga0207640_105178122 | 3300025981 | Corn Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITLVVYAVLISAFVIA |
| Ga0207677_118847411 | 3300026023 | Miscanthus Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITFLIYGVLILTFFIAGIYWYDARLGDMEL |
| Ga0207676_121370571 | 3300026095 | Switchgrass Rhizosphere | MFDNLVESSSHKDDLTRKGSFIGITALIYGVLLLAFFVAGIIWYDNHLSEQELELTTL |
| Ga0207675_1006364541 | 3300026118 | Switchgrass Rhizosphere | MFDNLVESSSHKDDIARKGSFIGITALIYGVLLVTFFVAG |
| Ga0210000_10752481 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MFDNLVESNSHKDDISRKGSFIIVTTIVYAVLGLAFFVAGIYWYDAHLENQNLDLITLV |
| Ga0209462_100699501 | 3300027761 | Agave | MFDNLVESSSHKDDIARKGSFIGVTALIYGVLMVAFFVAGIYWYDAHLGQMELELTTLVA |
| Ga0209180_103245612 | 3300027846 | Vadose Zone Soil | MFDNLVESSSHKDDISRKGSFVVITALIYAVLGVAFFVAGVYWYDN |
| Ga0268264_115327191 | 3300028381 | Switchgrass Rhizosphere | MFDNLVESSSHKKDIERKGSFIIVTAVIYLVLLVAFFVAGIYWYDNHLGEMEL |
| Ga0307513_106341942 | 3300031456 | Ectomycorrhiza | MFDNLVESNSHKDDISRKGSFILVTIAVYVVLGTVFFVAGIYLYDAHLENQ |
| Ga0307468_1023938751 | 3300031740 | Hardwood Forest Soil | MFDNLVESSSNMDDIARKGSFIGVTVLVYGVLLIAFVIVSIYAIDAHMENQNLEL |
| Ga0310907_102839212 | 3300031847 | Soil | MFDNLVESSSHKKDIERKGSFIIVTAVIYLVLLVAF |
| Ga0310892_110114671 | 3300031858 | Soil | MFDNLVESSSHKDDIARKGSFIGVTALIYGVLLVTFFVAGI |
| Ga0307406_102072202 | 3300031901 | Rhizosphere | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVT |
| Ga0310900_104186041 | 3300031908 | Soil | MFDNLVESSSHKSDLTRKGSFIGITLLVYAVLIVTFVIAGIFLYDAHLSEMELE |
| Ga0310900_114587461 | 3300031908 | Soil | MFDNLVESSSHKDDIARKGSFIGVTALIYGVLMLAFFVA |
| Ga0310885_108683091 | 3300031943 | Soil | MFDNLVESSSHKDDITRKGSFVGITALIYVVLLVTFFVAG |
| Ga0310810_107543572 | 3300033412 | Soil | MFDNLVESSSHKDDITRKGSFIGITLLIYAVLIGVFFVVGIYLY |
| Ga0310811_109707002 | 3300033475 | Soil | MFDNLVESSSHKDDITRKGSFIGITLLIYAVLIGVFFVVGIYL |
| Ga0314797_120730_2_109 | 3300034672 | Soil | MFDNLVESSSHKDDLTRKGSFIGITALIYGVLLVAF |
| Ga0373948_0018547_1_150 | 3300034817 | Rhizosphere Soil | MFDNLVESSSHKDDITRKGSFIGITALIYGVLLVTFFVAGIYWYDARLGD |
| Ga0370497_0196671_1_132 | 3300034965 | Untreated Peat Soil | MFDNLVESSSHKDDISRKGSFVIVTGSIYLVLMAAFFIAGIYWY |
| ⦗Top⦘ |