NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F041966

Metagenome Family F041966

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041966
Family Type Metagenome
Number of Sequences 159
Average Sequence Length 51 residues
Representative Sequence MESTAAEKRKALRKMLAEPTCHIAPSCNDGIQARLVEWLGFPLVHISGSGQH
Number of Associated Samples 137
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.23 %
% of genes near scaffold ends (potentially truncated) 98.74 %
% of genes from short scaffolds (< 2000 bps) 89.31 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.277 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.805 % of family members)
Environment Ontology (ENVO) Unclassified
(30.818 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(30.818 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.00%    β-sheet: 0.00%    Coil/Unstructured: 65.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF00596Aldolase_II 56.60
PF00528BPD_transp_1 3.14
PF13416SBP_bac_8 3.14
PF01494FAD_binding_3 2.52
PF12891Glyco_hydro_44 1.26
PF02515CoA_transf_3 0.63
PF06472ABC_membrane_2 0.63
PF01370Epimerase 0.63
PF13378MR_MLE_C 0.63
PF08530PepX_C 0.63
PF13688Reprolysin_5 0.63
PF01977UbiD 0.63
PF01548DEDD_Tnp_IS110 0.63
PF09338Gly_reductase 0.63
PF02129Peptidase_S15 0.63
PF00012HSP70 0.63
PF02371Transposase_20 0.63
PF00041fn3 0.63
PF09084NMT1 0.63
PF03401TctC 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 5.03
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 2.52
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 2.52
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 2.52
COG3547TransposaseMobilome: prophages, transposons [X] 1.26
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.63
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.63
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.63
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.63
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.63
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.63
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.28 %
UnclassifiedrootN/A15.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003999|Ga0055469_10053676Not Available1064Open in IMG/M
3300004009|Ga0055437_10144117All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300004011|Ga0055460_10052570All Organisms → cellular organisms → Bacteria → Proteobacteria1052Open in IMG/M
3300004047|Ga0055499_10011994All Organisms → cellular organisms → Bacteria → Proteobacteria1031Open in IMG/M
3300004052|Ga0055490_10288709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300004114|Ga0062593_100674642All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300004156|Ga0062589_101875382All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300004156|Ga0062589_102384620All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300004268|Ga0066398_10158454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300004463|Ga0063356_104947546All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300004463|Ga0063356_105646278All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005093|Ga0062594_103192142All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005176|Ga0066679_10906326All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005332|Ga0066388_105909331All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005341|Ga0070691_10063699All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300005353|Ga0070669_100913740All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300005467|Ga0070706_101983867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium527Open in IMG/M
3300005544|Ga0070686_101896221All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005549|Ga0070704_101185294All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300005549|Ga0070704_102261402All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005554|Ga0066661_10199415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1238Open in IMG/M
3300005558|Ga0066698_11050084All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005614|Ga0068856_101908250All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005719|Ga0068861_100189557All Organisms → cellular organisms → Bacteria1718Open in IMG/M
3300005764|Ga0066903_107997843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300005829|Ga0074479_10373838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium674Open in IMG/M
3300005834|Ga0068851_10344717All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005836|Ga0074470_10945020All Organisms → cellular organisms → Bacteria → Proteobacteria6039Open in IMG/M
3300005879|Ga0075295_1019911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium781Open in IMG/M
3300005887|Ga0075292_1008706All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300005937|Ga0081455_10164025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1700Open in IMG/M
3300006049|Ga0075417_10669777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300006173|Ga0070716_100552110All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300006844|Ga0075428_100069874All Organisms → cellular organisms → Bacteria3839Open in IMG/M
3300006844|Ga0075428_102668122All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300006853|Ga0075420_100661626Not Available901Open in IMG/M
3300006854|Ga0075425_100552297All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300006854|Ga0075425_102177972All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006881|Ga0068865_100214854All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300006904|Ga0075424_100979595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium902Open in IMG/M
3300006904|Ga0075424_102486133Not Available543Open in IMG/M
3300006918|Ga0079216_10075719All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300006918|Ga0079216_12014310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300007076|Ga0075435_101457617All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300009078|Ga0105106_10909112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium626Open in IMG/M
3300009093|Ga0105240_10310212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1802Open in IMG/M
3300009094|Ga0111539_11104667Not Available921Open in IMG/M
3300009094|Ga0111539_13174037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300009162|Ga0075423_12508368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300009176|Ga0105242_12674719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300009609|Ga0105347_1358247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium623Open in IMG/M
3300009792|Ga0126374_10946509All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300009810|Ga0105088_1070729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300009820|Ga0105085_1064451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium678Open in IMG/M
3300010043|Ga0126380_11873517All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300010358|Ga0126370_12265822All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300010359|Ga0126376_10296206All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300010359|Ga0126376_11816132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300010361|Ga0126378_10098127All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2885Open in IMG/M
3300010362|Ga0126377_11453217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium759Open in IMG/M
3300010362|Ga0126377_11728793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium701Open in IMG/M
3300010396|Ga0134126_11185789Not Available849Open in IMG/M
3300010398|Ga0126383_11332075All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium808Open in IMG/M
3300010403|Ga0134123_12897377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium548Open in IMG/M
3300010403|Ga0134123_13196048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium527Open in IMG/M
3300011409|Ga0137323_1034005Not Available1125Open in IMG/M
3300011424|Ga0137439_1107283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300011430|Ga0137423_1093705Not Available894Open in IMG/M
3300011434|Ga0137464_1025145All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300011435|Ga0137426_1007324All Organisms → cellular organisms → Bacteria2497Open in IMG/M
3300011437|Ga0137429_1048837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1236Open in IMG/M
3300011445|Ga0137427_10338406All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300012207|Ga0137381_10978617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium730Open in IMG/M
3300012227|Ga0137449_1140831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium529Open in IMG/M
3300012357|Ga0137384_10103692All Organisms → cellular organisms → Bacteria2374Open in IMG/M
3300012486|Ga0157331_1000622All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300012486|Ga0157331_1017746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium604Open in IMG/M
3300012501|Ga0157351_1010964Not Available832Open in IMG/M
3300012511|Ga0157332_1093612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300012514|Ga0157330_1074858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300012922|Ga0137394_10360116All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300012922|Ga0137394_11344112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300012923|Ga0137359_10048877All Organisms → cellular organisms → Bacteria → Proteobacteria3677Open in IMG/M
3300012931|Ga0153915_13453916All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012944|Ga0137410_11787123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300012948|Ga0126375_11324898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300012971|Ga0126369_10039663All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3944Open in IMG/M
3300012971|Ga0126369_10312697All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300012971|Ga0126369_12206207All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300012985|Ga0164308_10618380Not Available924Open in IMG/M
3300013307|Ga0157372_10135540Not Available2835Open in IMG/M
3300014272|Ga0075327_1144604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium738Open in IMG/M
3300014300|Ga0075321_1015330Not Available1132Open in IMG/M
3300014302|Ga0075310_1002466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3264Open in IMG/M
3300014319|Ga0075348_1094973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium743Open in IMG/M
3300014879|Ga0180062_1082879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium717Open in IMG/M
3300014880|Ga0180082_1166379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium512Open in IMG/M
3300014882|Ga0180069_1080771All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium758Open in IMG/M
3300014883|Ga0180086_1081269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium809Open in IMG/M
3300016404|Ga0182037_11644793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium572Open in IMG/M
3300017936|Ga0187821_10022883All Organisms → cellular organisms → Bacteria2186Open in IMG/M
3300018000|Ga0184604_10001246All Organisms → cellular organisms → Bacteria3528Open in IMG/M
3300018000|Ga0184604_10244161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium627Open in IMG/M
3300018031|Ga0184634_10430396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium598Open in IMG/M
3300018054|Ga0184621_10325303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300018056|Ga0184623_10346272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium666Open in IMG/M
3300018056|Ga0184623_10409378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300018074|Ga0184640_10192793Not Available919Open in IMG/M
3300018078|Ga0184612_10476915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300018079|Ga0184627_10048079All Organisms → cellular organisms → Bacteria2199Open in IMG/M
3300018422|Ga0190265_12128191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium665Open in IMG/M
3300018433|Ga0066667_11363384Not Available621Open in IMG/M
3300018920|Ga0190273_10798666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium748Open in IMG/M
3300019377|Ga0190264_11857754Not Available545Open in IMG/M
3300019881|Ga0193707_1023024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2057Open in IMG/M
3300021063|Ga0206227_1021623Not Available1062Open in IMG/M
3300022534|Ga0224452_1130544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium773Open in IMG/M
3300025324|Ga0209640_10122164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2237Open in IMG/M
3300025324|Ga0209640_11319928All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300025791|Ga0210115_1036310All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300025918|Ga0207662_10232655Not Available1204Open in IMG/M
3300025937|Ga0207669_10757547Not Available802Open in IMG/M
3300025939|Ga0207665_10294845All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300026536|Ga0209058_1145579Not Available1125Open in IMG/M
3300027395|Ga0209996_1057976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300027647|Ga0214468_1187708Not Available515Open in IMG/M
3300027722|Ga0209819_10127352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium891Open in IMG/M
3300027819|Ga0209514_10355072All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300027873|Ga0209814_10510056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300027886|Ga0209486_10986489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium565Open in IMG/M
3300027907|Ga0207428_10955915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium603Open in IMG/M
3300027961|Ga0209853_1119072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300028145|Ga0247663_1007361All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300028802|Ga0307503_10949491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium501Open in IMG/M
3300028884|Ga0307308_10606144Not Available525Open in IMG/M
3300030006|Ga0299907_10331980All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1235Open in IMG/M
3300031226|Ga0307497_10547868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium578Open in IMG/M
3300031228|Ga0299914_11156975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300031548|Ga0307408_100056755Not Available2840Open in IMG/M
3300031548|Ga0307408_100122524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2016Open in IMG/M
3300031548|Ga0307408_101698820Not Available601Open in IMG/M
3300031562|Ga0310886_10644616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium654Open in IMG/M
3300031754|Ga0307475_10814739All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031852|Ga0307410_12128142Not Available502Open in IMG/M
3300031890|Ga0306925_11262428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium736Open in IMG/M
3300031908|Ga0310900_11595488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium552Open in IMG/M
3300031944|Ga0310884_10883017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium551Open in IMG/M
3300031949|Ga0214473_12172722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300031965|Ga0326597_11251621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium729Open in IMG/M
3300032829|Ga0335070_10061241All Organisms → cellular organisms → Bacteria4086Open in IMG/M
3300033289|Ga0310914_11232872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300033407|Ga0214472_10467349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1175Open in IMG/M
3300033407|Ga0214472_10500471All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300033413|Ga0316603_11020188Not Available782Open in IMG/M
3300033481|Ga0316600_10415833Not Available924Open in IMG/M
3300033813|Ga0364928_0040945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium996Open in IMG/M
3300034148|Ga0364927_0215349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300034149|Ga0364929_0025217All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300034149|Ga0364929_0053060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1232Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.66%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil3.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.52%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.52%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.26%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.26%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.26%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.26%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.26%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.26%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.63%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.63%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.63%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.63%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012227Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012486Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510EnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014302Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027395Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027647Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeqEnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055469_1005367633300003999Natural And Restored WetlandsMEPTAAEKRQALKTMLAEPLCHIAPSCNDGIQARLVEWLG
Ga0055437_1014411713300004009Natural And Restored WetlandsMEMTAGEKRKTLKAMMQQPTCNLAPSCNDGIQARLVEWLGFPLVHISGSGQHRSQGFADA
Ga0055460_1005257013300004011Natural And Restored WetlandsMELTATEKRKALKALMQQPTCHIAPSCNDGIQARLVEWLGFP
Ga0055499_1001199413300004047Natural And Restored WetlandsMEMTAGEKRKTLKAMMQQPTCHLAPSCNDGIQARLVEWLGFPLVHISGSGQH
Ga0055490_1028870923300004052Natural And Restored WetlandsMDTTATEKRKALRKMMEGPICHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFAD
Ga0062593_10067464213300004114SoilMEPTAAEKRQALKTMLAEPLCHIAPSCNDGIQARLVEWLGFPVVHISGSGQHRTLGFADAGL
Ga0062589_10187538213300004156SoilMELTATEKRKALRAMLQESVCHLAPSCNDGIQARLVEWLGFPLVHISGS
Ga0062589_10238462013300004156SoilMAMTANEKRKALKAMMQQPTCHLAPSCNDGIQARLVEWLGLPLVHISGSGQHRSLGFADAGLLTL
Ga0066398_1015845413300004268Tropical Forest SoilMEATTTDKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRS
Ga0063356_10494754623300004463Arabidopsis Thaliana RhizosphereMTEKRKTLRGLLQGPGCSIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADAGMLT
Ga0063356_10564627823300004463Arabidopsis Thaliana RhizosphereMTMTANEKRRALKAMMRQPTCHLAPSCNDGIQSRLVEWLGFPLVHISGSGQHRSLGFADAGL
Ga0062594_10319214213300005093SoilMAMTANEKRRALKAMMQQPTCHLAPSCNDGIQARLVEWLKFPLVHISGSGQHRSLGFADAGL
Ga0066679_1090632623300005176SoilMESTAAEKRQALRKMLGEPTCHVAPSCNDGIQARLVEWLGFPLVHISGSG
Ga0066388_10590933123300005332Tropical Forest SoilMEMTSAEKRKALRKMLQEPQCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLTLT
Ga0070691_1006369913300005341Corn, Switchgrass And Miscanthus RhizosphereMESTAAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWLGLPLVHISGSGQHRSLG
Ga0070669_10091374013300005353Switchgrass RhizosphereMEMTAGEKRKALKTLMQESVCHLAPSCNDGIQARLVEWLGFPLVHISGS
Ga0070706_10198386713300005467Corn, Switchgrass And Miscanthus RhizosphereMELTAGDKRKSLRTMLNEPVCHIAPSCNDGIQARLVEWLGFPL
Ga0070686_10189622123300005544Switchgrass RhizosphereMESTAAEKRQSLKKMLDEPACHTAPSCNDGIQARLVEWLGFPLVHISGSGQHR*
Ga0070704_10118529413300005549Corn, Switchgrass And Miscanthus RhizosphereMEKTANEKRKVLSGLLKEPACHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADA
Ga0070704_10226140213300005549Corn, Switchgrass And Miscanthus RhizosphereMQSTTAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGYADA
Ga0066661_1019941513300005554SoilMESTTTDKRKALRKMLEGPGCQIAPSCNDGIQARLVEWLGFPVVHI
Ga0066698_1105008413300005558SoilMELTAGDKRKSLRTMLNEPVCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADAGLLTL
Ga0068856_10190825013300005614Corn RhizosphereMELSAAEKRQSLKKMLDEPACHIAPSCSDGIQARLVEWLGFPLVHISGSG
Ga0068861_10018955713300005719Switchgrass RhizosphereMESTAAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEW
Ga0066903_10799784323300005764Tropical Forest SoilMEATTTDKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVH
Ga0074479_1037383823300005829Sediment (Intertidal)MAMTANEKRKALKAMMQQPTCHLAPSCNDGIQARLVEWLKFPLVHIS
Ga0068851_1034471723300005834Corn RhizosphereMQSTTAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEW
Ga0074470_1094502013300005836Sediment (Intertidal)MAMTASDKRKKLKSMMQQPTCHLAPSCNDGIQARLVEWMGLPLVHISGSGQHRSLGFADAGLLTL
Ga0075295_101991123300005879Rice Paddy SoilMEPTAAEKRQALKTMLAEPLCHIAPSCNDGIQARLVEWLGF
Ga0075292_100870613300005887Rice Paddy SoilMEPTAAEKRQALKTMLAEPLCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGF
Ga0081455_1016402533300005937Tabebuia Heterophylla RhizosphereMEATTMEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADA
Ga0075417_1066977713300006049Populus RhizosphereMEATAAEKRKALRSMLNEPVCHIAPSCNDGIQARLVEWLGFPLVHIS
Ga0070716_10055211023300006173Corn, Switchgrass And Miscanthus RhizosphereMEPTIAERRKSLRAMLKGPGCHIAPSCNDGIQARLVEWL
Ga0075428_10006987413300006844Populus RhizosphereMESTAAEKRQALRKMLGEPTCHIAPSCNDGIQARLVEWLGFP
Ga0075428_10266812223300006844Populus RhizosphereMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHIS
Ga0075420_10066162623300006853Populus RhizosphereMELTASEKRKALKAMMQQSVCHLAPSCNDGIQARLVEWL
Ga0075425_10055229713300006854Populus RhizosphereMESTAAEKRQALRKMLGKPTCHVAPSCNDGIQARLVEWLGFPLVHISGS
Ga0075425_10217797223300006854Populus RhizosphereMESTVAEKRKSLRAMMQGSTCQIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADA
Ga0068865_10021485433300006881Miscanthus RhizosphereMESTAAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGYADA
Ga0075424_10097959513300006904Populus RhizosphereMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSG
Ga0075424_10248613323300006904Populus RhizosphereMESTAAEKRQALRKMLGKPTCHVAPSCNDGIQARLVEWLGFPLVHISGSGQHRSL
Ga0079216_1007571933300006918Agricultural SoilMELTATEKRKALRAMLQESVCHLAPSCNDGIQARLVEWLGFPLVHISGSGQHR
Ga0079216_1201431013300006918Agricultural SoilMEKTATEKRKSLREMLQGPGCSIAPSCNDGIQARLVEWLG
Ga0075435_10145761723300007076Populus RhizosphereMELSAAEKRQSLKKMLDEPACHIAPSCSDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLTLT
Ga0105106_1090911223300009078Freshwater SedimentMTANEKRKALKAMMQQPTCHLAPSCNDGIQARLVEWQGF
Ga0105240_1031021233300009093Corn RhizosphereMESTAAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWL
Ga0111539_1110466713300009094Populus RhizosphereMESTAAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWLGLPLLHLSGSGQHRSL
Ga0111539_1317403723300009094Populus RhizosphereMESTAAEKRQALRKMLGEPTCHIAPSCNDGIQARLVEWLGFPLVHISGS
Ga0075423_1250836813300009162Populus RhizosphereMESTAAEKRQALRKMLGEPTCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFAD
Ga0105242_1267471913300009176Miscanthus RhizosphereMATAADKRKTLKQLVQQPTCHIAPSCNDGIQARLVEWLKFPLVHISGSGQHRSLGFADA
Ga0105347_135824723300009609SoilMEMTASEKRKALKAMMQQSVCHLAPSCNDGIQARLVEWLGFPLVHISGS
Ga0126374_1094650913300009792Tropical Forest SoilMEWTTTDKRKALRKMMQGPGCHIAPSCNDGIQARLVEWL
Ga0105088_107072923300009810Groundwater SandMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARL
Ga0105085_106445113300009820Groundwater SandMEMTASEKRKTLKALMQQPTCHLAPSCNDGIQARLVEWLGFSLVHISGSGQHRSQG
Ga0126380_1187351713300010043Tropical Forest SoilMEATTTDKRKALRKMMQGPGCHIAPSCNDGIQARLVE
Ga0126370_1226582213300010358Tropical Forest SoilMEATTTDKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLG
Ga0126376_1029620613300010359Tropical Forest SoilMEATTTDKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADA
Ga0126376_1181613223300010359Tropical Forest SoilMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFP
Ga0126378_1009812743300010361Tropical Forest SoilMEATITEKRKSLRAMLREPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFA
Ga0126377_1145321713300010362Tropical Forest SoilMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLV
Ga0126377_1172879313300010362Tropical Forest SoilMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRS
Ga0134126_1118578913300010396Terrestrial SoilMELSAAEKRQSLKKMLDEPACHTAPSCNDGIQARLVEWLGFPLVHI
Ga0126383_1133207523300010398Tropical Forest SoilMEATTTEKRKALRKMIQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSG
Ga0134123_1289737723300010403Terrestrial SoilMESTAAEKRQALRKMLGEPTCHIAPSCNDGIQARLVEWLGFPLVHISG
Ga0134123_1319604813300010403Terrestrial SoilMESTAAEKRQTLRKMLTEPTCHVAPSCNDGIQARLVEWLGFPL
Ga0137323_103400533300011409SoilMTASEKRKALKALMQQPTCHLAPSCNDGIQARLVEWLGFP
Ga0137439_110728323300011424SoilMEMTTSEKRKALKAMMQQPMCHLAPSCNDGIQARLVEWLGFPLVHISG
Ga0137423_109370513300011430SoilMTANEKRKALKAMMQQPTCHLAPSCNDGIQARLVEWQGFP
Ga0137464_102514513300011434SoilMAMTANEKRKALKAMMQQPTCHLAPSCNDGIQSRLVEWLGFPLVHISGSGQHRSLG
Ga0137426_100732443300011435SoilMAMTANEKRKALKAMMQQPTCHLAPSCNDGIQSRLVEWLGFPLVHISGSGQ
Ga0137429_104883733300011437SoilMTASEKRKALKALMQQPTCHLAPSCNDGIQARLVEW
Ga0137427_1033840613300011445SoilMDKTAAEKRQALRKMMQGPGCQIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLT
Ga0137381_1097861713300012207Vadose Zone SoilMELTAGDKRKSLRTMLNEPVCHIAPSCNDGIQARLVEWLGFPLV
Ga0137449_114083113300012227SoilMTANEKRKALKAMMQQPTCHLAPSCNDGIQARLVEWQGFPLVHISGSGQHRSLGFADAG
Ga0137384_1010369213300012357Vadose Zone SoilMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLTLTDMINRAREI
Ga0157331_100062213300012486SoilMESTAAEKRKALRKMLAEPTCHIAPSCNDGIQARLVEWLGFPLVHISGSGQH
Ga0157331_101774623300012486SoilMELSAAEKRQSLKKMLDEPACHTAPSCNDGIQARLVEWLGFPLVHISG
Ga0157351_101096423300012501Unplanted SoilMELSAAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWLG
Ga0157332_109361223300012511SoilMELSAAEKRQSLKKMLDEPACHIAPSCSDGIQARLVEWLGF
Ga0157330_107485823300012514SoilMESTAAEKRQALRKMLGEPTCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHR
Ga0137394_1036011623300012922Vadose Zone SoilMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGF
Ga0137394_1134411223300012922Vadose Zone SoilMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFA
Ga0137359_1004887713300012923Vadose Zone SoilMESTTTDKRKALRKMLQGPGCQIAPSCNDGIQARLVEWLGFPVVHISGSGQHRALGFADAGL
Ga0153915_1345391623300012931Freshwater WetlandsLEAAATTKRKSLRTMMLEPGCHLAPSCNDGIQARLVKWLGFPLVHISGSGQHRALGFADVEAKYRY*
Ga0137410_1178712323300012944Vadose Zone SoilMESTAAEKRQALRKMLTEPTCHVAPSCNDGIQARLVEWLGFPLVHISGSGQH
Ga0126375_1132489823300012948Tropical Forest SoilMEATTTDKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGF
Ga0126369_1003966313300012971Tropical Forest SoilMEATITEKRKSLRAMLREPGCHIAPSCNDGIQARLVEWLGFPLVHISGSG
Ga0126369_1031269723300012971Tropical Forest SoilMEATIAEKRKSLRKMLQEPQCHIAPSCNDGIQARLVEWLGFP
Ga0126369_1220620723300012971Tropical Forest SoilMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLL
Ga0164308_1061838013300012985SoilMELSAAEKRQSLKKMLDEPACHIAPSCSDGIQARLVEWLGFPLVHISGSGQHRSLGFAAG
Ga0157372_1013554013300013307Corn RhizosphereMQSTTAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGL
Ga0075327_114460423300014272Natural And Restored WetlandsMELNATEKRKALRAMMQEAVCHIAPSCNDGIQARLVEWLGFPLVHISGSGQ
Ga0075321_101533013300014300Natural And Restored WetlandsMEFTATEKRKALKKMLAEPSCHLAPSCNDGIQARLVEWLGF
Ga0075310_100246613300014302Natural And Restored WetlandsMELTAAEKRQSLRKMLSEPKCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADA
Ga0075348_109497323300014319Natural And Restored WetlandsMAMTANEKRKALKAMMQQPNCHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLTL
Ga0180062_108287913300014879SoilMDKTAAEKRQALRKMMQGPGCQIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADA
Ga0180082_116637913300014880SoilMTANEKRKALKAMMQQPTCHLAPSCNDGIQARLVEWQGFPLVHISGSGQHRSLGFADA
Ga0180069_108077123300014882SoilMEATAAEKRTALRKMLEEPTCHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADA
Ga0180086_108126913300014883SoilMEATATEKRQALRKMLAEPVCHIAPSCNDGIQARLVEWLGFPLIHISGSGQHRALGFA
Ga0182037_1164479323300016404SoilMEPTAAEKRQALNKMLDEPTCHIAPSCNDGIQARLIEWLGFPLVHISGSGQHRSLGFADAGLLTLT
Ga0187821_1002288343300017936Freshwater SedimentMELTATEKRKTLRKMLAESACHLAPSCNDGIQARLVEWLGF
Ga0184604_1000124643300018000Groundwater SedimentMESTAAEKRLALKKMLAEPSCHIAPSCNDGIQARL
Ga0184604_1024416123300018000Groundwater SedimentMESTAAEKRQALRKMLAEPVCHVAPSCNDGIQARLVEWLGFPLVHISGSG
Ga0184634_1043039613300018031Groundwater SedimentMEKTATEKRKVLGALIKAPVCHIARSCNDGIQARLVDWLGFPLVHISGSGQHRSLGFADAVDIP
Ga0184621_1032530323300018054Groundwater SedimentMEATTTEKRKALRKMMQGLGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLG
Ga0184623_1034627213300018056Groundwater SedimentMELNATEKRKALRAMLQESVCHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFAD
Ga0184623_1040937813300018056Groundwater SedimentMEATAAEKRTALRKMLEEPTCHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLL
Ga0184640_1019279323300018074Groundwater SedimentMEMTASEKRKALKTMMQQPTCHLAPSCNDGIQARLVEWLGFPLVHISG
Ga0184612_1047691523300018078Groundwater SedimentMEKTASEKRKALGALIKEPICHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADAGLL
Ga0184627_1004807943300018079Groundwater SedimentMEKTASEKRKVLGALIKEPVCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLTL
Ga0190265_1212819123300018422SoilMELNATEKRKALRAMLQESVCHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADAGLLTLT
Ga0066667_1136338413300018433Grasslands SoilMEPTATEKRKALRVMLQGPECQLAPSCNDGIQARLV
Ga0190273_1079866623300018920SoilMAMTANEKRKALKAMMQQPLCHLAPSCNDGIQSRLVEWLGFPLVHISG
Ga0190264_1185775413300019377SoilMGEKRKTLRALLQAPGCSIAPSCNDGIQARLVEWLGFPLV
Ga0193707_102302443300019881SoilMESTAAEKRQALKKMLAEPSCHIAPSCNDGIQARLVEWLGFPLVHISG
Ga0206227_102162323300021063Deep Subsurface SedimentMEMTASEKRKALKAMMQQPTCHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRSQGFAD
Ga0224452_113054423300022534Groundwater SedimentMETTAAEKRKSLRAMLNEPVCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGF
Ga0209640_1012216413300025324SoilVILETAATAKRKSLRAMMLEPVCHLAPSCNDGIQARLVEWLGFPLVHISGNGQHRS
Ga0209640_1131992813300025324SoilVILETAATAKRKSLRAMMLEPVSHLAPSCNDGIQARLVEWLGFPLVHISG
Ga0210115_103631013300025791Natural And Restored WetlandsMDTTATEKRKSLRKMMEGPGCHIAPSCNDGIQARLVEWLGFPL
Ga0207662_1023265523300025918Switchgrass RhizosphereMQSTTAEKRQSLKKMLDEPACHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLTL
Ga0207669_1075754723300025937Miscanthus RhizosphereMQSTTAEKRQSLKKMLDEPACHIAPSCNDGIQARLV
Ga0207665_1029484513300025939Corn, Switchgrass And Miscanthus RhizosphereMEPTIAERRKSLRAMLKGPGCHIAPSCNDGIQARLVEWLGFPLVHI
Ga0209058_114557913300026536SoilMELTAGDKRKSLRTMLNEPVCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADAGLL
Ga0209996_105797613300027395Arabidopsis Thaliana RhizosphereMESTAAEKRQALKKMLAQPVCHMAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADA
Ga0214468_118770823300027647SoilMEKSATEKRETLHSLLQGPGCSIAPSCNDGIQARLVEWLGFPLVHIS
Ga0209819_1012735223300027722Freshwater SedimentMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLVHISG
Ga0209514_1035507213300027819GroundwaterMEAAATTKRKTLRAMMLEPECHLAPSCNDGIQARLVEWLGFPL
Ga0209814_1051005613300027873Populus RhizosphereMEATAAEKRKALRSMLNEPVCHIAPSCNDGIQARLVEWLGFPLVHISG
Ga0209486_1098648923300027886Agricultural SoilMELNATEKRKALRAMLQESVCHLAPSCNDGIQARLVEWLGF
Ga0207428_1095591513300027907Populus RhizosphereMESTASEKSQSLKKMLDEPICHIAPSCNDGIQARLV
Ga0209853_111907223300027961Groundwater SandMEATTTEKRKALRKMMQGPGCHIAPSCNDGIQARLVEWLGFPLV
Ga0247663_100736113300028145SoilMEMTAGEKRKALKAMMQQSTCQLAPSCNDGIQARLVEWLGFPLVHISGSG
Ga0307503_1094949113300028802SoilMESTAAEKRQALRKMLGEPTCHIAPSCNDGIQARLV
Ga0307308_1060614423300028884SoilMESTAAEKRQALRKMLGEPTCHVAPSCNDGIQARLVEWLGFPLVHISG
Ga0299907_1033198033300030006SoilMESTASEKRQALRNMLQESKAHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLL
Ga0307497_1054786823300031226SoilMESTAAEKRQALRKMLGEPTCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSL
Ga0299914_1115697513300031228SoilMDLTAAEKRKALRAILNEARCHIAPSCNDGIQARLVEWLGFPLAHISGSGQHRALG
Ga0307408_10005675513300031548RhizosphereMEKTAEEKRRTLRALLQGPGCSIAPSCNDGIQARLVEWLGFPLVHISGSGQH
Ga0307408_10012252443300031548RhizosphereMNMTANQKRKALKAMMQQPTCHLAPSCNDAIQARLVEWMDFPLVHISGSGQHRSLGFADAGLLTL
Ga0307408_10169882023300031548RhizosphereMEKTTNEKRKTLRALLQGPGCSIAPSCNDGIQARLVEWLGF
Ga0310886_1064461613300031562SoilMTANEKRKALKVMMQQPTCHLAPSCNDAIQARLVEWMDFPLVHISGSGQHR
Ga0307475_1081473923300031754Hardwood Forest SoilMEATIAERRKSLRAMLKGPGCHIAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADA
Ga0307410_1212814223300031852RhizosphereMEKTTNEKRKTLRALLQGPGCSIAPSCNDGIQARLVEWLGFPLVHISGS
Ga0306925_1126242823300031890SoilMESTAMDKRKALRKMLQGPGCQIAPSCNDGIQARLVEWLGFPLVHISGSGQHRALGFADA
Ga0310900_1159548823300031908SoilMELNATEKRKALRAMLQESICHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRSL
Ga0310884_1088301713300031944SoilMAMTANEKRKALKVMMQQPTCHLAPSCNDAIQARLVEWMDFPLVHISGSGQHRSLGFA
Ga0214473_1217272223300031949SoilMEATAAEKRTALRKMLEEPICHLAPSCNDGIQARLVEWLGFPLVHI
Ga0326597_1125162113300031965SoilMEMTASEKRKALKALMQQPTCHLAPSCNDGIQARLVEWLGF
Ga0335070_1006124113300032829SoilMESTAAEKRQALKKMLAEPSCHVAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFAD
Ga0310914_1123287213300033289SoilMESTAMDKRKALRKMLQGPGCQIAPSCNDGIQARLVEWL
Ga0214472_1046734913300033407SoilMEATATEKRKTLRRLLQEPKAHIAPSCNDGIQARLVEWLGFPLVHI
Ga0214472_1050047123300033407SoilVILETAATAKRKSLRAMMLEPVCHLAPSCNDGIQARLVEWLGFPLVHISGNGQHRSLGLPTPGCSP
Ga0316603_1102018823300033413SoilMAMTANEKRKALKAMMQQPTCHLAPSCNDGIQSRLVEWLGFPLVHISGSGQHR
Ga0316600_1041583323300033481SoilMAMTANEKRKALKAMMQQPTCHLAPSCNDGIQSRLA
Ga0364928_0040945_797_9943300033813SedimentMMEAPATTKRKSLRATMLEPACHLAPSCNDGIQARLVEWLGFPLVHISGSGQHRSLGFADAGLLTL
Ga0364927_0215349_438_5693300034148SedimentMDKTAAEKRQALRKMMQGPGCQIAPSCNDGIQARLVEWLGFPLV
Ga0364929_0025217_1592_17353300034149SedimentMESTAAEKRLALKKMLAEPSCHVAPSCNDGIQARLVEWLGFPLVHISG
Ga0364929_0053060_1_1833300034149SedimentMAMTANEKRKALKAMMQQPTCQLAPSCNDGIQARLVEWQGFPLVHISGSGQHRSLGFADA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.