NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F041952

Metagenome Family F041952

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041952
Family Type Metagenome
Number of Sequences 159
Average Sequence Length 45 residues
Representative Sequence EYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV
Number of Associated Samples 133
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.65 %
% of genes near scaffold ends (potentially truncated) 95.60 %
% of genes from short scaffolds (< 2000 bps) 89.31 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.453 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(8.176 % of family members)
Environment Ontology (ENVO) Unclassified
(41.509 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.314 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.36%    β-sheet: 0.00%    Coil/Unstructured: 61.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF13103TonB_2 63.52
PF02472ExbD 1.89
PF01022HTH_5 1.26
PF01618MotA_ExbB 1.26
PF07589PEP-CTERM 1.26
PF13650Asp_protease_2 1.26
PF05834Lycopene_cycl 1.26
PF12727PBP_like 1.26
PF05496RuvB_N 1.26
PF02525Flavodoxin_2 1.26
PF13473Cupredoxin_1 0.63
PF030614HBT 0.63
PF13531SBP_bac_11 0.63
PF12840HTH_20 0.63
PF07499RuvA_C 0.63
PF00303Thymidylat_synt 0.63
PF04932Wzy_C 0.63
PF12146Hydrolase_4 0.63
PF01494FAD_binding_3 0.63
PF02441Flavoprotein 0.63
PF04343DUF488 0.63
PF12695Abhydrolase_5 0.63
PF13561adh_short_C2 0.63
PF07603DUF1566 0.63
PF12831FAD_oxidored 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 1.89
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.26
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 1.26
COG0207Thymidylate synthaseNucleotide transport and metabolism [F] 0.63
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.63
COG0632Holliday junction resolvasome RuvABC DNA-binding subunitReplication, recombination and repair [L] 0.63
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.63
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.63
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.63
COG3307O-antigen ligaseCell wall/membrane/envelope biogenesis [M] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.45 %
UnclassifiedrootN/A7.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS402JMMO7All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium504Open in IMG/M
3300000890|JGI11643J12802_11696079All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria642Open in IMG/M
3300001213|JGIcombinedJ13530_109502766All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria501Open in IMG/M
3300004048|Ga0055494_10134960All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium560Open in IMG/M
3300004463|Ga0063356_105145966Not Available562Open in IMG/M
3300005205|Ga0068999_10063317All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium678Open in IMG/M
3300005290|Ga0065712_10620855All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria581Open in IMG/M
3300005337|Ga0070682_101047437All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005338|Ga0068868_101695119All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria595Open in IMG/M
3300005339|Ga0070660_101138313All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria661Open in IMG/M
3300005354|Ga0070675_100780624Not Available873Open in IMG/M
3300005354|Ga0070675_101793096All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria566Open in IMG/M
3300005356|Ga0070674_100648449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.897Open in IMG/M
3300005441|Ga0070700_100182952All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1460Open in IMG/M
3300005445|Ga0070708_102191953All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria510Open in IMG/M
3300005530|Ga0070679_100851225All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria855Open in IMG/M
3300005539|Ga0068853_100238607All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1665Open in IMG/M
3300005539|Ga0068853_101558304All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria640Open in IMG/M
3300005547|Ga0070693_101458627All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria534Open in IMG/M
3300005548|Ga0070665_101229718Not Available759Open in IMG/M
3300005548|Ga0070665_101871247All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria606Open in IMG/M
3300005578|Ga0068854_101120477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria702Open in IMG/M
3300005587|Ga0066654_10763018All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria546Open in IMG/M
3300005615|Ga0070702_100343208All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300005615|Ga0070702_100867602All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria704Open in IMG/M
3300005719|Ga0068861_102163076All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.557Open in IMG/M
3300005840|Ga0068870_10457802All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria842Open in IMG/M
3300005841|Ga0068863_101960115All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria596Open in IMG/M
3300005842|Ga0068858_100404400All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1312Open in IMG/M
3300006047|Ga0075024_100568313All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium605Open in IMG/M
3300006173|Ga0070716_101117681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria629Open in IMG/M
3300006173|Ga0070716_101674778All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria524Open in IMG/M
3300006224|Ga0079037_101872242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria599Open in IMG/M
3300006358|Ga0068871_101564220All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria624Open in IMG/M
3300006876|Ga0079217_10302842All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria887Open in IMG/M
3300009167|Ga0113563_11777528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria733Open in IMG/M
3300009171|Ga0105101_10695292All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria506Open in IMG/M
3300009176|Ga0105242_11613151All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria683Open in IMG/M
3300009455|Ga0114939_10165095All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria937Open in IMG/M
3300009789|Ga0126307_10966435All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria688Open in IMG/M
3300009870|Ga0131092_10158091All Organisms → cellular organisms → Bacteria2743Open in IMG/M
3300010047|Ga0126382_12482832All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.505Open in IMG/M
3300010373|Ga0134128_10347050All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1659Open in IMG/M
3300010373|Ga0134128_12059728All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria628Open in IMG/M
3300010403|Ga0134123_13577997All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria504Open in IMG/M
3300012513|Ga0157326_1052391All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria603Open in IMG/M
3300012514|Ga0157330_1031199All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium669Open in IMG/M
3300012684|Ga0136614_11203240All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria512Open in IMG/M
3300012957|Ga0164303_11519624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
3300012961|Ga0164302_11177011All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium611Open in IMG/M
3300012985|Ga0164308_10864335All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria794Open in IMG/M
3300012985|Ga0164308_11860754All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria561Open in IMG/M
3300013100|Ga0157373_10007619All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria8044Open in IMG/M
3300013296|Ga0157374_10334424All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1503Open in IMG/M
3300013306|Ga0163162_12167467All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300014322|Ga0075355_1224849All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.532Open in IMG/M
3300014325|Ga0163163_11190167All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria825Open in IMG/M
3300014326|Ga0157380_10414519All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1282Open in IMG/M
3300014968|Ga0157379_12550380All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300014969|Ga0157376_10441156All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1268Open in IMG/M
3300014969|Ga0157376_11637637All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria678Open in IMG/M
3300015200|Ga0173480_10385672Not Available809Open in IMG/M
3300015262|Ga0182007_10420982All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.511Open in IMG/M
3300015372|Ga0132256_101755219All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria729Open in IMG/M
3300015374|Ga0132255_104339061All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria601Open in IMG/M
3300017959|Ga0187779_10446236All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria850Open in IMG/M
3300018084|Ga0184629_10576780All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria576Open in IMG/M
3300018432|Ga0190275_11756402All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria699Open in IMG/M
3300018469|Ga0190270_12838148All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300018476|Ga0190274_11128362All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria865Open in IMG/M
3300018476|Ga0190274_11206699All Organisms → cellular organisms → Bacteria → Proteobacteria840Open in IMG/M
3300018476|Ga0190274_12568119All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria606Open in IMG/M
(restricted) 3300021517|Ga0224723_1233691All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria528Open in IMG/M
3300025878|Ga0209584_10239294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria694Open in IMG/M
3300025893|Ga0207682_10255400All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300025901|Ga0207688_10457935All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria796Open in IMG/M
3300025901|Ga0207688_10991566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria531Open in IMG/M
3300025906|Ga0207699_10603964All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria799Open in IMG/M
3300025909|Ga0207705_10450242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria998Open in IMG/M
3300025909|Ga0207705_10590849All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria863Open in IMG/M
3300025911|Ga0207654_11261474All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria539Open in IMG/M
3300025919|Ga0207657_11099132All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria608Open in IMG/M
3300025921|Ga0207652_10613913All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria974Open in IMG/M
3300025921|Ga0207652_10769019All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria856Open in IMG/M
3300025929|Ga0207664_10555582All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1030Open in IMG/M
3300025929|Ga0207664_11952549All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria510Open in IMG/M
3300025932|Ga0207690_10368149All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1140Open in IMG/M
3300025937|Ga0207669_11881011All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria511Open in IMG/M
3300025938|Ga0207704_10365693All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300025939|Ga0207665_10609612All Organisms → cellular organisms → Bacteria → Proteobacteria853Open in IMG/M
3300025940|Ga0207691_10086510All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2812Open in IMG/M
3300025940|Ga0207691_11443088All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300025941|Ga0207711_12111549All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.506Open in IMG/M
3300025960|Ga0207651_10313587All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1309Open in IMG/M
3300025960|Ga0207651_10657192All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300025972|Ga0207668_10315430All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1295Open in IMG/M
3300025973|Ga0210145_1012409All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.919Open in IMG/M
3300025981|Ga0207640_11629631All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria582Open in IMG/M
3300026023|Ga0207677_11859085All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria559Open in IMG/M
3300026069|Ga0208539_1022660All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria626Open in IMG/M
3300026075|Ga0207708_11213445All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria660Open in IMG/M
3300026078|Ga0207702_10000248All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria62667Open in IMG/M
3300026095|Ga0207676_12512326All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300026121|Ga0207683_11054026All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria754Open in IMG/M
3300026142|Ga0207698_12522221All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria524Open in IMG/M
3300027735|Ga0209261_10118369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium694Open in IMG/M
3300027765|Ga0209073_10523389Not Available503Open in IMG/M
3300027876|Ga0209974_10363489All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300027877|Ga0209293_10152027All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1102Open in IMG/M
3300027885|Ga0209450_10570666All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria827Open in IMG/M
3300027897|Ga0209254_10048826All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3701Open in IMG/M
3300027897|Ga0209254_10354601All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1102Open in IMG/M
3300027899|Ga0209668_10084890All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1805Open in IMG/M
3300027902|Ga0209048_10630081All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria712Open in IMG/M
3300028379|Ga0268266_11476336All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria655Open in IMG/M
3300028587|Ga0247828_10582240All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium679Open in IMG/M
3300028597|Ga0247820_10443314All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp.876Open in IMG/M
3300028777|Ga0302290_10076764Not Available848Open in IMG/M
3300029980|Ga0302298_10173657All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria699Open in IMG/M
3300029987|Ga0311334_10946668All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300030014|Ga0302175_10181046All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
3300030114|Ga0311333_10084139All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2343Open in IMG/M
3300030294|Ga0311349_11092118All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria746Open in IMG/M
3300030294|Ga0311349_12036982All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria528Open in IMG/M
3300031232|Ga0302323_102933185All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria544Open in IMG/M
3300031548|Ga0307408_100339623All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1271Open in IMG/M
3300031726|Ga0302321_102276320All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria631Open in IMG/M
3300031854|Ga0310904_10068496All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1843Open in IMG/M
3300031901|Ga0307406_10412645All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1073Open in IMG/M
3300031901|Ga0307406_11297541All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria635Open in IMG/M
3300031902|Ga0302322_100007926All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria9522Open in IMG/M
3300031902|Ga0302322_100131236All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2655Open in IMG/M
3300031902|Ga0302322_100288677All Organisms → cellular organisms → Bacteria → Proteobacteria1838Open in IMG/M
3300031902|Ga0302322_103209190All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria561Open in IMG/M
3300031938|Ga0308175_100267230All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1726Open in IMG/M
3300031996|Ga0308176_10033058All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4060Open in IMG/M
3300032008|Ga0318562_10011120All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales4466Open in IMG/M
3300032013|Ga0310906_10155091All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1340Open in IMG/M
3300032017|Ga0310899_10543796All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria575Open in IMG/M
3300032035|Ga0310911_10694573All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria589Open in IMG/M
3300032074|Ga0308173_11154485All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria723Open in IMG/M
3300032126|Ga0307415_100934573All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria802Open in IMG/M
3300032397|Ga0315287_11794387All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria683Open in IMG/M
3300032421|Ga0310812_10416728All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria604Open in IMG/M
3300033408|Ga0316605_12507949All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium501Open in IMG/M
3300033412|Ga0310810_10093741All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3591Open in IMG/M
3300033413|Ga0316603_11530050All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria632Open in IMG/M
3300033419|Ga0316601_101612642All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria654Open in IMG/M
3300033419|Ga0316601_102011532All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria582Open in IMG/M
3300033482|Ga0316627_101788423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria631Open in IMG/M
3300033483|Ga0316629_10069780All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1858Open in IMG/M
3300033488|Ga0316621_11165907All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria581Open in IMG/M
3300033807|Ga0314866_059381All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria639Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.18%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.18%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere5.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.77%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.14%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.26%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.26%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.26%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.26%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.26%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.63%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.63%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.63%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.63%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.63%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.63%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.63%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.63%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.63%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.63%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.63%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004048Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009455Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal SpringEnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021517 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaGEnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025973Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026069Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028777Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3EnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FG2_084210202189573004Grass SoilTLIIPTQEYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWSAIQIVEKKSRN
JGI11643J12802_1169607923300000890SoilVILMTDRSVYTVALRQLVEQRVDWSWAAIQIVEKHARG*
JGIcombinedJ13530_10950276623300001213WetlandEGRNVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV*
Ga0055494_1013496013300004048Natural And Restored WetlandsEYADGRQVILTTDRSVYTVALKNLVEQRSEWSWTAIQIVEKRMRE*
Ga0062590_10194102123300004157SoilTSEYADGRNLILTTGKSIYTIALRHLVEQRADWSWAAFQIIDKKPTDY*
Ga0063356_10514596623300004463Arabidopsis Thaliana RhizosphereGRNVILTTGRSVYTVALRSLVEQRAEWSWAAAQILEKKARE*
Ga0068999_1006331713300005205Natural And Restored WetlandsYVEGRNVILTTGRSVYTVALRQLVEQRAEWSWAAFQIVEKKAKAV*
Ga0065712_1062085513300005290Miscanthus RhizosphereLIVPTQEYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV*
Ga0070682_10104743723300005337Corn RhizosphereVPTQEYSEGRHIILATGRSIYTVALRHLVEQRAEWSWAAIQIIEKRPRG*
Ga0068868_10169511913300005338Miscanthus RhizosphereDGRQIMLTTGRSLYTVALRTLIEQRADWTWCAIQIVEKKARAL*
Ga0070660_10113831313300005339Corn RhizosphereKTLIVPTHEYAEGRKVILMTGRSIYTVALRQLVEQRADWSWAAIQVIDKQSRAGTDT*
Ga0070675_10078062413300005354Miscanthus RhizosphereRQAILMTDRSVYTVALRQLVEQHVDWSWAALQIVEKHPRG*
Ga0070675_10179309613300005354Miscanthus RhizosphereTVIVPTQEYAEGRKVILMTGRSIYTVALRQLVEQRADWSWVAIQVVEKLGRA*
Ga0070674_10054912113300005356Miscanthus RhizosphereADGRNVTLTTGRSVYTIVLRHLIEQRAEWSWCAIQISEKKSRT*
Ga0070674_10064844923300005356Miscanthus RhizosphereYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV*
Ga0070700_10018295213300005441Corn, Switchgrass And Miscanthus RhizosphereSEGRSVMLTTGRSVYTVALRHLVEQRADWSWAAVQIVEKKSRV*
Ga0070708_10219195323300005445Corn, Switchgrass And Miscanthus RhizosphereKTMIVPTAEYAEGRNVLLTTGRSVYTMVLRHLIEQRADWSWTAVQIAEKKPRT*
Ga0070679_10085122523300005530Corn RhizosphereTQEYAEGRQVLLTTGRSVYTMVLRHLIEQRADWTWAAVQVIEKKSRD*
Ga0068853_10023860713300005539Corn RhizosphereSVMLTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKSRV*
Ga0068853_10155830413300005539Corn RhizosphereEYAEGRKIILTTGRSIYTVAMRQLVEQRADWSWTAISIIEKLARC*
Ga0070693_10145862713300005547Corn, Switchgrass And Miscanthus RhizosphereLIIPTHEYAEGRKIILTTGRSLYTVAMRQLVEQRADWSWIAISIVEKLTRC*
Ga0070665_10122971813300005548Switchgrass RhizosphereVMLTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKSRV*
Ga0070665_10187124713300005548Switchgrass RhizosphereYAEGRKVILMTGRSIYTVALRQLVEQRADWSWVAIQVVEKLGRA*
Ga0068854_10112047723300005578Corn RhizosphereMTGRSIYTVALRQLVEQRADWSWVAIQVVEKLGRG*
Ga0066654_1076301813300005587SoilPTPEYQEGRNVILTTGRSIYTIVLRHLIEQRADWSWTAVQITEKKART*
Ga0070702_10034320823300005615Corn, Switchgrass And Miscanthus RhizosphereTLIIPTQEYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWSAIQIVEKKSRV*
Ga0070702_10086760213300005615Corn, Switchgrass And Miscanthus RhizosphereTAEYADGRQVVLTTGRSVYTIALRHLIEQRADWSWCAIQISEKKPRS*
Ga0068861_10216307623300005719Switchgrass RhizosphereRSVMLTTGRSVYTVALRHLVEQRAEWSWAAIQILEKKSRE*
Ga0068870_1045780213300005840Miscanthus RhizosphereAVKTLIVPTQEYSEGRSVMLTTGRSVYTVALRHLVEQRADWSWAAIQILEKKSRT*
Ga0068863_10196011513300005841Switchgrass RhizosphereTLIVPTQEYAEGRQIHLTTGRSLYTIVLRHLVEQRADWSWAAIQIIEKKARE*
Ga0068858_10040440023300005842Switchgrass RhizosphereSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV*
Ga0068858_10126804813300005842Switchgrass RhizospherePTSEYADGRNLILTTGKSIYTIALRHLVEQRADWSWAAFQIIDKKPTDY*
Ga0075024_10056831313300006047WatershedsGRSVYTVALRQLVEQRAEWSWAAVQIVEKKPKDI*
Ga0070716_10111768123300006173Corn, Switchgrass And Miscanthus RhizosphereSLIVPTTEYVDGRQIMLTTGRSLYTVALRTLIEQRADWTWCAIQIVDKKPRAL*
Ga0070716_10167477813300006173Corn, Switchgrass And Miscanthus RhizospherePTQEYAEGRQVMLTTGRSFYTIVLRHLVEQRADWSWAAIQIVEKKARE*
Ga0079037_10187224213300006224Freshwater WetlandsTDRSVYTVALKNLVEQRSEWSWAAIQIVEKQVRE*
Ga0068871_10156422023300006358Miscanthus RhizosphereYVEGRKVILITGRSIYTVALRQLVEQRADWSWAAIQIVEKQIRSAE*
Ga0079221_1118263823300006804Agricultural SoilIYTVALRQLVEQRADWSWATIQIVEKQGRAPESAPH*
Ga0079217_1030284223300006876Agricultural SoilAVKTLIVPTAEYTEGRQLVLQTGRSVYTVALRQLVEQRSEWSWAAIQIVEKRPR*
Ga0113563_1177752823300009167Freshwater WetlandsRQVILTTDRSVYTVALKNLVEQRSEWSWAAIQIVGKQVRE*
Ga0105101_1069529213300009171Freshwater SedimentQVILTTDRSVYTVALKNLVEQRSEWSWAAIQIVEKQVRE*
Ga0105242_1058753313300009176Miscanthus RhizospherePTSEYADGRNLVLTTGRSTYTIVLRHLVEQRAEWSWSAFQIIEKKPTEVH*
Ga0105242_1161315123300009176Miscanthus RhizosphereVKTVIVPTQEYAEGRKVILMTGRSIYTVALRQLVEQRADWSWVAIQIVEKLGRE*
Ga0114939_1016509513300009455GroundwaterQVILTTGRSIYTVALRQLVEQRSEWSWVAIQIVDKRSRE*
Ga0126307_1096643513300009789Serpentine SoilEGRSVMLTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKARE*
Ga0131092_1015809113300009870Activated SludgeMTGRSIYTVAMRHLVEQRAEWSWTTIQILEKKARV*
Ga0126382_1248283223300010047Tropical Forest SoilYSEGRSVILTTGRSVYTVALRHLVEQRADCSWAAIQILEKKSRV*
Ga0134128_1034705033300010373Terrestrial SoilEYAEGRKVILATSRSVYTVALRQLVEQRADWSWVAIQIVEKQARGE*
Ga0134128_1205972813300010373Terrestrial SoilHEYAEGRKIILTTGRSLYTVAMRQLVEQRADWSWIAISIVEKLTRC*
Ga0134123_1357799713300010403Terrestrial SoilKTLIVPTQEYQGGRSVILTAGRSVYTVALRHLVEQRADWSWAAIQIVDKKSRV*
Ga0157326_105239113300012513Arabidopsis RhizosphereIPTHEYAEGRKIILTTGRSIYIVAMRQLVEQRAGWSWTAIQIVEKLARC*
Ga0157330_103119923300012514SoilILTTGRSVYTVALRHLVEQRAEWSWSAIQIVEKKPKEG*
Ga0136614_1120324013300012684Polar Desert SandEYGDGRIVTLTTGRSLYSVALRHLVEQRADWSWTTIQIVEKKSRTQA*
Ga0164303_1151962423300012957SoilIIPTHEYAEGRKIILTTGRSIYIVAMRQLVEQRADWSWTAIQIVEKLARC*
Ga0164302_1117701123300012961SoilYAEGRKVILTTGRSIYTVALRQLVEQRADWCWVAIQIIDKQVRSADH*
Ga0164308_1086433523300012985SoilGRHVILTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKPRG*
Ga0164308_1186075413300012985SoilVKTLIVPTQEYADGRQIHLVTGRSIYTVVLRHLVEQRSDWSWAAIQIVEKKARE*
Ga0157373_10007619123300013100Corn RhizosphereYAEGRRVILMTDRSVYTVALRQLVEQRVDWSWAAIQIVEKHPRG*
Ga0157374_1033442413300013296Miscanthus RhizospherePLPVPTEAEANGLQIHPVTGRSIATVVLRNLIEQGSDWSWAAIQIIEKLARC*
Ga0163162_1216746713300013306Switchgrass RhizosphereLIVPTSEYSEGRSVILTTGRSVYTVAFRSLVEQRAEWSWAAIQILEKKARE*
Ga0075355_122484913300014322Natural And Restored WetlandsLIVPTQEYTEGRNVMLTTGRSVYTVALRHLVEQRADWSWAAIQIVDKNARSG*
Ga0163163_1119016723300014325Switchgrass RhizosphereQEYQEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKSRV*
Ga0157380_1041451913300014326Switchgrass RhizosphereVKTLIVPTQEYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV*
Ga0157379_1255038023300014968Switchgrass RhizosphereTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV*
Ga0157376_1044115613300014969Miscanthus RhizosphereVPTQEYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV*
Ga0157376_1163763723300014969Miscanthus RhizosphereRSVILTTGRSIYTVALRQLVEQRADWSWAAIQIIEKKARN*
Ga0173480_1038567213300015200SoilEGRSVMLTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKSRV*
Ga0182007_1042098213300015262RhizosphereVPTQEYMEGRQIMLTTGRSLYTILLRHLVEQRADWSWAAIQILEKKPRE*
Ga0132256_10175521913300015372Arabidopsis RhizosphereYSDGRQVILLTGRSVYTFALRNLIEQRADWSWAAIQVIEKKSKT*
Ga0132255_10433906113300015374Arabidopsis RhizosphereTMIVPTSEYSDGRQVILLTGRSVYTFALRHLIEQRADWSWAAIQVIEKKSKT*
Ga0187779_1044623623300017959Tropical PeatlandILTTGRSVYTVELKHLVEQRAEWTWCAIQIVEKKSRE
Ga0184629_1057678013300018084Groundwater SedimentTQEYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWSAIQIVEKKSRI
Ga0190275_1175640213300018432SoilEARQLMLTTGRSIYTIALRHLVEQRSEWSWCAIQIVDKKPRAD
Ga0190270_1283814813300018469SoilSVMLTTGRSVYTVALRHLVEQRADWSWAAIQILEKKSRE
Ga0190274_1112836223300018476SoilTQEYSEGRSVMLTTGRSVYTVALRHLVEQRADWSWAAIQILEKKSRT
Ga0190274_1120669923300018476SoilTGEYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKSRV
Ga0190274_1256811913300018476SoilEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV
(restricted) Ga0224723_123369113300021517Freshwater SedimentTQEYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKARI
Ga0209584_1023929423300025878Arctic Peat SoilVILTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKSRL
Ga0207682_1025540013300025893Miscanthus RhizosphereQEYAEGRSVILTTGRSVYTVALRQLVEQRADWSWAAIQIVEKKPKG
Ga0207688_1045793523300025901Corn, Switchgrass And Miscanthus RhizosphereAEYADGRNVTLTTGRSVYTIVLRHLIEQRAEWSWCAIQISEKKSRT
Ga0207688_1099156613300025901Corn, Switchgrass And Miscanthus RhizosphereKTLIVPTQEYAEGRQIHLTTGRSLYTIVLRHLVEQRADWSWAAIQIIEKKARE
Ga0207699_1060396423300025906Corn, Switchgrass And Miscanthus RhizosphereRKVILATSRSVYTVALRQLVEQRADWSWVAIQIVEKQARGE
Ga0207705_1045024213300025909Corn RhizosphereHEYAEGRKIILTTGRSIYIVAMRQLVEQRADWSWTAISIVEKLARC
Ga0207705_1059084913300025909Corn RhizosphereAEGRKVILMTGRSIYTVALRQLVEQRADWSWAAIQIVEKQSRAGTDT
Ga0207654_1126147423300025911Corn RhizosphereVVIPTYEYAEGRQAILMTDRSVYTVALRQLVEQHVDWSWAALQIVEKHPRG
Ga0207657_1109913213300025919Corn RhizosphereGRKVILTTGRSIYTVALRQLVEQRADWSWVAIQIIDKQVRSADH
Ga0207652_1061391313300025921Corn RhizosphereEGRKVILMTTRSIYTIALRQLVEQRADWCWTAIQIVEKQPRMGD
Ga0207652_1076901923300025921Corn RhizosphereTQEYAEGRQVLLTTGRSVYTMVLRHLIEQRADWTWAAVQVIEKKSRD
Ga0207664_1055558223300025929Agricultural SoilILITGRSIYTVALRQLVEQRADWSWAAIQIVEKQVRGAE
Ga0207664_1195254923300025929Agricultural SoilAEGRKIILTTGRSIYTVALRQLVEQRADWSWVAIQIIEKQVRSADH
Ga0207690_1036814923300025932Corn RhizosphereRKVILMTGRSIYTVALRQLVEQRADWSWVAIQVVEKLGRA
Ga0207686_1070479423300025934Miscanthus RhizosphereVKTLIVPTSEYADGRNLVLTTGRSTYTIVLRHLVEQRAEWSWSAFQIIEKKPTEVH
Ga0207669_1188101113300025937Miscanthus RhizospherePTAEYADGRNVTLTTGRSVYTIVLRHLIEQRAEWSWCAIQISEKKSRT
Ga0207704_1036569313300025938Miscanthus RhizosphereIVPTQEYAEGRSVILTTGRSVYTVALRQLVEQRADWSWAAIQIIEKKPKG
Ga0207665_1060961223300025939Corn, Switchgrass And Miscanthus RhizospherePTQEYADGRQIHLVTGRSIYTIVLRHLVEQRSDWSWAAIQIVEKKARE
Ga0207691_1008651013300025940Miscanthus RhizosphereTLIVPTQEYSEGRSVMLTTGRSVYTVALRHLVEQRADWSWAAIQILEKKSRT
Ga0207691_1144308813300025940Miscanthus RhizosphereVILTTGRSVYTVAFRSLVEQRAEWSWAAIQILEKKARE
Ga0207711_1211154923300025941Switchgrass RhizosphereTQEYSEGRSVMLTTGRSVYTVALRHLVEQRAEWSWAAIQILEKKSRE
Ga0207651_1031358713300025960Switchgrass RhizosphereEYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV
Ga0207651_1065719223300025960Switchgrass RhizosphereGRSVILTTGRSVYTVAFRSLVEQRAEWSWAAIQILEKKARE
Ga0207668_1031543013300025972Switchgrass RhizosphereVKTLIVPTQEYSEGRSVMLTTGRSVYTVALRHLVEQRAEWSWAAIQILEKKSRE
Ga0210145_101240913300025973Natural And Restored WetlandsEYADGRHVILTTGRSRYTIVLRHLVEQRADWSWATFQILDKKPMEI
Ga0207640_1162963123300025981Corn RhizosphereVIVPTQEYAEGRKVILMTGRSIYTVALRQLVEQRADWSWVAIQVVEKLGRG
Ga0207677_1185908523300026023Miscanthus RhizosphereTLIIPTHEYAEGRKIILTTGRSLYTVAMRQLVEQRADWSWIAISIVEKLTRC
Ga0208539_102266023300026069Natural And Restored WetlandsIVPTSEYADGRQVILATDRSVYTVALKNLVEQRSEWSWAAIQIVEKQVRE
Ga0207708_1121344523300026075Corn, Switchgrass And Miscanthus RhizosphereSEYSEGRNVILTTGRSVYTVALRSLVEQRAEWSWAAAQILEKKARE
Ga0207702_1000024813300026078Corn RhizosphereILMTDRSVYTVALRQLVEQHVDWSWAALQIVEKHPRG
Ga0207676_1251232613300026095Switchgrass RhizosphereQEYTEGRNVILTTVRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV
Ga0207683_1105402613300026121Miscanthus RhizosphereHLMTGRSVYTVVLRHLVEQRADWSWAAIQISEKKPRE
Ga0207698_1252222113300026142Corn RhizosphereDGRQIHLVTGRSIYTVVLRHLIEQRSDWSWAAIQIVEKKARE
Ga0209261_1011836913300027735Wetland SedimentTGRSVYTVALRHLVEQRAEWSWAAIQIVDKNARSG
Ga0209073_1052338923300027765Agricultural SoilLITGRSIYTLVLRQLVEQRGDWSWTAIQIVDKQPRTGGE
Ga0209974_1036348923300027876Arabidopsis Thaliana RhizosphereMIDEYVDGRHVILTTGRSVYTVALRHVIEQRLDWTWCAVQIV
Ga0209293_1015202723300027877WetlandADGRQVILTTDRSVYTVALKNLVEQRSEWSWAAIQIVEKQVRE
Ga0209450_1057066623300027885Freshwater Lake SedimentKTLIVPTAEYSEGRKLILTTGRSVYTVALRQLVEQRAEWSWSAIQIVGKSARPA
Ga0209254_1004882613300027897Freshwater Lake SedimentYSDGRQLVLTTGRSIYTVALRHLIEQRSEWSWAAIQIIEKRAREG
Ga0209254_1035460123300027897Freshwater Lake SedimentYSDGRQLVLTTGRSIYTVALRHLIEQRSEWSWAAIQIIEKRSRDG
Ga0209668_1008489013300027899Freshwater Lake SedimentVMLTTGRSVYTVALRHLVEQRADWSWCAIQILEKKSRI
Ga0209048_1063008113300027902Freshwater Lake SedimentTTGRSVYTVALKHLVEQRADWSWAAIQIVEKKSRV
Ga0268266_1147633613300028379Switchgrass RhizosphereYAEGRKVILMTGRSIYTVALRQLVEQRADWSWVAIQVVEKLGRA
Ga0247828_1058224013300028587SoilILTTGRSVYTVALRSLVEQRAEWSWAAAQILEKKARE
Ga0247820_1044331423300028597SoilQEYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV
Ga0302290_1007676423300028777FenVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV
Ga0302298_1017365713300029980FenQEYSEGRLVMLTTGRSVYTVALRQLVEQRAEWSWAAIQIVEKKSRV
Ga0311334_1094666813300029987FenTQEYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV
Ga0302175_1018104623300030014FenPTQEYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKRSRV
Ga0311333_1008413913300030114FenSEGRNIILTTGRSVYTVALRHLVEQRAEWTWAAIQIVEKKSRV
Ga0311349_1109211823300030294FenILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV
Ga0311349_1203698223300030294FenEYSEGRLVMLTTGRSVYTVALRQLVEQRAEWSWAAIQIVEKKARV
Ga0302323_10293318513300031232FenVKTLIIPTQEYSEGRNVILTTGRSVYTVALRQLVEQRAEWSWAAIQIVEKKSRV
Ga0307408_10033962313300031548RhizosphereVVLHTGRSIYTVAFRQLVEQRSEWSWASIQIVEKRAK
Ga0302321_10227632013300031726FenTLIIPTQEYSEGRNVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV
Ga0310904_1006849643300031854SoilRNVILTTGRSVYTVALRSLVEQRAEWSWAAAQILEKKARE
Ga0307406_1041264523300031901RhizosphereEGRHLMLTTGRSVYTVALRQLVEQRSEWSWAAIQIVEKKPR
Ga0307406_1129754113300031901RhizosphereILHTGRSIYTVALRQLVEQRSEWSWAAIQIVEKKPK
Ga0302322_10000792613300031902FenGRNVILTTGRSVYTVALRHLVEQRAEWSWAAIQIVEKKSRV
Ga0302322_10013123653300031902FenRNIILTTGRSVYTVALRHLVEQRAEWTWAAIQIVEKKSRV
Ga0302322_10028867713300031902FenNVILTTGRSVYTVALRQLVEQRAEWSWAAIQIVEKKPKEL
Ga0302322_10320919013300031902FenTLIVPTQEYSEGRNVILTTGRSVYTVALRHLVEQRADWSWAAIQIVEKKSRL
Ga0308175_10026723043300031938SoilRKLILITGRSIYTVALRQLVEQRGDWSWTAIQIVEKQPRGNGE
Ga0308176_1003305813300031996SoilPTQEYSEGRQVLLTTGRSVYTMVLRHLVEQRADWTWAAVQIVDKKSRI
Ga0318562_1001112013300032008SoilPTSEYADGRNLFLTTGRSVYTIVLRHLVEQRAEWSWAAIQIVDKKTMDY
Ga0310906_1015509113300032013SoilIVPTQEYSEGRSVILTTGRSVYTVALRHLVEQRADWSWAAIQIIEKKSRV
Ga0310899_1054379613300032017SoilKTLIIPTHEYAEGRKIILTTGRSLYTVAMRQLVEQRADWSWIAISIVEKLTRC
Ga0310911_1069457323300032035SoilVILTTGRSVYTVALKHLVEQRADWTWCAIQIVEKKSKE
Ga0308173_1115448513300032074SoilPTHEYAEGRKLILMTGRSMYTVALRQLVEQRADWSWAAIQIVEKQARGAASEM
Ga0307415_10093457323300032126RhizosphereAVKTLIIPTAEYADGRQLILHTGRSIYTVALRQLVEQRSEWSWAAIQIVEKKPK
Ga0315287_1179438723300032397SedimentTGRSVYTVALRHLVEQRADWSWVAIQIVEKRAREF
Ga0310812_1041672823300032421SoilHEYVEGRKVILITGRSIYTVALRQLVEQRADWSWAAIQIVEKQIRSAE
Ga0316605_1250794923300033408SoilAVKTLIVPTQEYSEGRSVMLTTGRSVYTVALRHLVEQRADWSWCAIQIVEKKSRI
Ga0310810_1009374163300033412SoilVPTHEYAEGRKVILTTGRSIYTVALRQLVEQRADWSWVAIQIIDKQVRSADH
Ga0316603_1153005013300033413SoilLATERSVYTVALKHLVEQRSEWSWAAIQIVEKQARE
Ga0316601_10161264223300033419SoilVPTQEYSEGRNVILTTGRSVYTVALRHLVEQRADWSWVAIQIVEKKAREF
Ga0316601_10201153213300033419SoilEYSEGRSVMLTTGRSVYTVALRHLVEQRADWSWCAIQIVEKKSRI
Ga0316627_10178842323300033482SoilPTAEYADGRQVILTTDRSVYTVALKNLVEQRSEWSWAAIQIVEKQVRE
Ga0316629_1006978043300033483SoilLTTGRSVYTVALRHLVEQRAEWSWAAIQIVDKHARAP
Ga0316621_1116590713300033488SoilNVILTTGRSVYTVALRHLVEQRADWSWVAIQIVEKKAREF
Ga0314866_059381_3_1643300033807PeatlandKTLVVPTQEYAEGRQVILTTGRSVYTVALKHLVEQRAEWTWCAIQIMEKKSRE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.