| Basic Information | |
|---|---|
| Family ID | F041951 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGAAASAAKA |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.37 % |
| % of genes from short scaffolds (< 2000 bps) | 91.19 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.038 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.623 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF02597 | ThiS | 74.21 |
| PF03795 | YCII | 4.40 |
| PF01327 | Pep_deformylase | 2.52 |
| PF02870 | Methyltransf_1N | 1.89 |
| PF01035 | DNA_binding_1 | 1.89 |
| PF02894 | GFO_IDH_MocA_C | 1.26 |
| PF03992 | ABM | 1.26 |
| PF13520 | AA_permease_2 | 1.26 |
| PF00069 | Pkinase | 1.26 |
| PF01243 | Putative_PNPOx | 1.26 |
| PF08241 | Methyltransf_11 | 0.63 |
| PF07690 | MFS_1 | 0.63 |
| PF02566 | OsmC | 0.63 |
| PF07593 | UnbV_ASPIC | 0.63 |
| PF00759 | Glyco_hydro_9 | 0.63 |
| PF01740 | STAS | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 74.21 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 74.21 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.03 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.40 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 3.77 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 2.52 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 1.89 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.26 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.63 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.04 % |
| Unclassified | root | N/A | 33.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_102739648 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300002562|JGI25382J37095_10124510 | Not Available | 875 | Open in IMG/M |
| 3300002914|JGI25617J43924_10308473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300002916|JGI25389J43894_1061141 | Not Available | 639 | Open in IMG/M |
| 3300005171|Ga0066677_10248595 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300005332|Ga0066388_100591962 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300005434|Ga0070709_10998214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 666 | Open in IMG/M |
| 3300005440|Ga0070705_100508939 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005468|Ga0070707_100928347 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005532|Ga0070739_10294691 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005534|Ga0070735_10437267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 781 | Open in IMG/M |
| 3300005559|Ga0066700_11064572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300005568|Ga0066703_10821504 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005610|Ga0070763_10516938 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005764|Ga0066903_101852519 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300006173|Ga0070716_101230032 | Not Available | 603 | Open in IMG/M |
| 3300006175|Ga0070712_100768721 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300006175|Ga0070712_101502126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
| 3300006176|Ga0070765_101051282 | Not Available | 770 | Open in IMG/M |
| 3300006796|Ga0066665_10922990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300006800|Ga0066660_10971629 | Not Available | 685 | Open in IMG/M |
| 3300006852|Ga0075433_11487424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300006871|Ga0075434_100012463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8063 | Open in IMG/M |
| 3300006903|Ga0075426_10938803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 653 | Open in IMG/M |
| 3300006904|Ga0075424_100106682 | All Organisms → cellular organisms → Bacteria | 2956 | Open in IMG/M |
| 3300009012|Ga0066710_104012073 | Not Available | 551 | Open in IMG/M |
| 3300009088|Ga0099830_10207254 | Not Available | 1537 | Open in IMG/M |
| 3300009088|Ga0099830_10391581 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300009088|Ga0099830_10485816 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300009088|Ga0099830_11641919 | Not Available | 536 | Open in IMG/M |
| 3300009089|Ga0099828_10992916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300009098|Ga0105245_10859274 | Not Available | 948 | Open in IMG/M |
| 3300009162|Ga0075423_11136615 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300009177|Ga0105248_13207251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300010321|Ga0134067_10403311 | Not Available | 549 | Open in IMG/M |
| 3300010341|Ga0074045_10868663 | Not Available | 569 | Open in IMG/M |
| 3300010343|Ga0074044_10909573 | Not Available | 575 | Open in IMG/M |
| 3300010343|Ga0074044_11134195 | Not Available | 511 | Open in IMG/M |
| 3300010358|Ga0126370_10748849 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300010360|Ga0126372_10302341 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300010360|Ga0126372_12437201 | Not Available | 574 | Open in IMG/M |
| 3300010361|Ga0126378_12236812 | Not Available | 624 | Open in IMG/M |
| 3300010366|Ga0126379_13014147 | Not Available | 564 | Open in IMG/M |
| 3300010376|Ga0126381_103539363 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010396|Ga0134126_12488216 | Not Available | 563 | Open in IMG/M |
| 3300010398|Ga0126383_11233555 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300011120|Ga0150983_14640366 | Not Available | 538 | Open in IMG/M |
| 3300011269|Ga0137392_10831066 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 762 | Open in IMG/M |
| 3300011269|Ga0137392_11566845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300011270|Ga0137391_10264137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
| 3300011270|Ga0137391_10485280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1048 | Open in IMG/M |
| 3300011271|Ga0137393_10183636 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300012096|Ga0137389_10752389 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012189|Ga0137388_10047801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3451 | Open in IMG/M |
| 3300012189|Ga0137388_10409842 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300012189|Ga0137388_10525346 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300012189|Ga0137388_10660273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300012189|Ga0137388_11281255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
| 3300012189|Ga0137388_11802127 | Not Available | 544 | Open in IMG/M |
| 3300012199|Ga0137383_11199421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300012202|Ga0137363_10839744 | Not Available | 779 | Open in IMG/M |
| 3300012202|Ga0137363_11106694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300012203|Ga0137399_11273395 | Not Available | 619 | Open in IMG/M |
| 3300012203|Ga0137399_11474712 | Not Available | 567 | Open in IMG/M |
| 3300012206|Ga0137380_10286012 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300012206|Ga0137380_10438513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300012206|Ga0137380_10798432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300012208|Ga0137376_11473503 | Not Available | 572 | Open in IMG/M |
| 3300012211|Ga0137377_10123796 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300012211|Ga0137377_11896775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012349|Ga0137387_10462220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300012349|Ga0137387_10500167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 882 | Open in IMG/M |
| 3300012351|Ga0137386_11069904 | Not Available | 571 | Open in IMG/M |
| 3300012357|Ga0137384_10375961 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300012357|Ga0137384_10679690 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012361|Ga0137360_10787990 | Not Available | 818 | Open in IMG/M |
| 3300012362|Ga0137361_10106662 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
| 3300012363|Ga0137390_11480781 | Not Available | 620 | Open in IMG/M |
| 3300012363|Ga0137390_11947235 | Not Available | 515 | Open in IMG/M |
| 3300012683|Ga0137398_10701433 | Not Available | 703 | Open in IMG/M |
| 3300012918|Ga0137396_10563683 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012923|Ga0137359_10405512 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300012923|Ga0137359_11001641 | Not Available | 717 | Open in IMG/M |
| 3300012924|Ga0137413_10166633 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300012925|Ga0137419_10224362 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300012925|Ga0137419_11172679 | Not Available | 642 | Open in IMG/M |
| 3300012925|Ga0137419_11831643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012927|Ga0137416_10059556 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300012927|Ga0137416_10103636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2144 | Open in IMG/M |
| 3300012927|Ga0137416_10297659 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300012930|Ga0137407_10827797 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300012931|Ga0153915_12698634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012971|Ga0126369_11469261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium | 771 | Open in IMG/M |
| 3300012972|Ga0134077_10423292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012975|Ga0134110_10007816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4010 | Open in IMG/M |
| 3300012988|Ga0164306_11933802 | Not Available | 513 | Open in IMG/M |
| 3300013307|Ga0157372_13190701 | Not Available | 523 | Open in IMG/M |
| 3300014154|Ga0134075_10041765 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300014166|Ga0134079_10060488 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300015052|Ga0137411_1154595 | All Organisms → cellular organisms → Bacteria | 4083 | Open in IMG/M |
| 3300015052|Ga0137411_1360000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300015054|Ga0137420_1111018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300015054|Ga0137420_1214240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300015054|Ga0137420_1307857 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300015245|Ga0137409_11279979 | Not Available | 575 | Open in IMG/M |
| 3300016341|Ga0182035_11137859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300017947|Ga0187785_10166686 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300017959|Ga0187779_10472816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300017994|Ga0187822_10364888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300018431|Ga0066655_10840042 | Not Available | 625 | Open in IMG/M |
| 3300018482|Ga0066669_12299303 | Not Available | 514 | Open in IMG/M |
| 3300020579|Ga0210407_10863233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300020580|Ga0210403_10437306 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300020580|Ga0210403_11344434 | Not Available | 544 | Open in IMG/M |
| 3300020581|Ga0210399_10593381 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300020582|Ga0210395_10172401 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300020583|Ga0210401_10066867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3386 | Open in IMG/M |
| 3300021170|Ga0210400_11555444 | Not Available | 523 | Open in IMG/M |
| 3300021178|Ga0210408_10914163 | Not Available | 682 | Open in IMG/M |
| 3300021180|Ga0210396_11745609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300021432|Ga0210384_10096568 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
| 3300021477|Ga0210398_10998546 | Not Available | 668 | Open in IMG/M |
| 3300021479|Ga0210410_10647429 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300021559|Ga0210409_10568768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1000 | Open in IMG/M |
| 3300022726|Ga0242654_10345865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300022726|Ga0242654_10386647 | Not Available | 534 | Open in IMG/M |
| 3300024245|Ga0247677_1044530 | Not Available | 645 | Open in IMG/M |
| 3300024284|Ga0247671_1016629 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300024288|Ga0179589_10512412 | Not Available | 557 | Open in IMG/M |
| 3300025916|Ga0207663_10680531 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300026089|Ga0207648_10297815 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300026342|Ga0209057_1246811 | Not Available | 508 | Open in IMG/M |
| 3300026482|Ga0257172_1105140 | Not Available | 519 | Open in IMG/M |
| 3300026514|Ga0257168_1123039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300026528|Ga0209378_1292308 | Not Available | 520 | Open in IMG/M |
| 3300026552|Ga0209577_10120459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2101 | Open in IMG/M |
| 3300027326|Ga0209731_1052796 | Not Available | 617 | Open in IMG/M |
| 3300027655|Ga0209388_1071945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 996 | Open in IMG/M |
| 3300027795|Ga0209139_10183257 | Not Available | 741 | Open in IMG/M |
| 3300027867|Ga0209167_10730751 | Not Available | 540 | Open in IMG/M |
| 3300027875|Ga0209283_10917657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300027911|Ga0209698_10113210 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300027986|Ga0209168_10315987 | Not Available | 766 | Open in IMG/M |
| 3300029636|Ga0222749_10168149 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300030058|Ga0302179_10557198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300030906|Ga0302314_10783350 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031057|Ga0170834_100647332 | Not Available | 561 | Open in IMG/M |
| 3300031057|Ga0170834_113527727 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031679|Ga0318561_10448330 | Not Available | 710 | Open in IMG/M |
| 3300031715|Ga0307476_11315503 | Not Available | 527 | Open in IMG/M |
| 3300031718|Ga0307474_11619987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300031720|Ga0307469_10644717 | Not Available | 953 | Open in IMG/M |
| 3300031720|Ga0307469_11672425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300031720|Ga0307469_12424856 | Not Available | 512 | Open in IMG/M |
| 3300031753|Ga0307477_10068514 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
| 3300031823|Ga0307478_10671818 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300032174|Ga0307470_11958078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300032180|Ga0307471_102467673 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300033158|Ga0335077_11716583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.14% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.52% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.63% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1027396481 | 3300001431 | Soil | GLKTTDALVAEFPATEAIAPKLEAFEAYLDAQLAAPAAGKA* |
| JGI25382J37095_101245101 | 3300002562 | Grasslands Soil | TTDAIAAEFPAAEAIAPRLEAFEAYIDAQLGVTASRAKA* |
| JGI25617J43924_103084732 | 3300002914 | Grasslands Soil | TGNGLKTTDAIAAEFPAXEAIAPRLDAFEAYLDAQLGATAASAKA* |
| JGI25389J43894_10611411 | 3300002916 | Grasslands Soil | TGNGLKTTDAIVSEFPATEAIAPRLEAFEAYLDARLGTAAASAKA* |
| Ga0066677_102485953 | 3300005171 | Soil | KTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGVTVAGAKA* |
| Ga0066388_1005919625 | 3300005332 | Tropical Forest Soil | GNGLKTTDAIAAEFPLTEAIAPRLDAFEAYLESAVPAAATANV* |
| Ga0070709_109982143 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NGLKTTDAIAADFPLTEAIAPRLEAFEAYLDAQLGTHAAAAAK* |
| Ga0070705_1005089393 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LKTTDAIAAEFPVTEAIEPRIDAFEAYLENQFTLAAATAGAK* |
| Ga0070707_1009283473 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GLKTTDAIAAEFPVTEAIAPRLEAFEAYLDAQLGATAAGAKA* |
| Ga0070739_102946913 | 3300005532 | Surface Soil | LKTTDAIAAEFPATEAIAPRLDAFEAYLDSQLSTAATA* |
| Ga0070735_104372673 | 3300005534 | Surface Soil | LSITGNGLKTTDAIANEFPLTEAIAPKLEAFEALLDSQLTAAGAAAGAK* |
| Ga0066700_110645721 | 3300005559 | Soil | TTDAIVAEYPLTEAIAPRIEAFEAYLDAQLGAAAEAAKV* |
| Ga0066703_108215043 | 3300005568 | Soil | IVAEYPLTEAIAPRIEAFEAYLDAQLGAAAEAAKV* |
| Ga0070763_105169381 | 3300005610 | Soil | KTTDAVTAEFPLAEAIAPRLDAFEAYLDNQFTAAAAAR* |
| Ga0066903_1018525195 | 3300005764 | Tropical Forest Soil | AIAAEFPAAEAIPPRLDAFEAYLDNQLRTAAAAAR* |
| Ga0070716_1012300322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DAIAADFPLTEAIAPRLEAFEAYLDAQMGTHATAAAK* |
| Ga0070712_1007687213 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GNGLKTTDAIVAEYPSSEAIEPKLAAFEAYLDTQMATSAAAKA* |
| Ga0070712_1015021261 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GLKTTDAIASEFPLTEAIAPKLEAFEAYLDGQLTAASAIAGAK* |
| Ga0070765_1010512823 | 3300006176 | Soil | DAIAAEFPAIEAIAPRLEAFEAYLDNQLATTASTQA* |
| Ga0066665_109229901 | 3300006796 | Soil | DAIAAEFPATEAIAPRLDAFEAYLDAQLGATVAGAKA* |
| Ga0066660_109716291 | 3300006800 | Soil | TDAIADEFRATEAIAPRLEAFEAYLDAQIGATTRAARA* |
| Ga0075433_114874242 | 3300006852 | Populus Rhizosphere | ITGNGLKTTDAISAEYPATQAIAPKLEAFEAYLDSQMAAGATAGKA* |
| Ga0075434_10001246310 | 3300006871 | Populus Rhizosphere | AAEYPASEAIAPKLEAFEAYLDSQLAASAAVGKA* |
| Ga0075426_109388031 | 3300006903 | Populus Rhizosphere | GLKTTDAIAAEFPAAEAIAPRLEAFEAYLDAQLGAATASAKA* |
| Ga0075424_1001066824 | 3300006904 | Populus Rhizosphere | LKTTDAIAAEYPPTEAIAPKLEAFEAYLDSQLAASTAVAGKA* |
| Ga0066710_1040120731 | 3300009012 | Grasslands Soil | GNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR |
| Ga0099830_102072541 | 3300009088 | Vadose Zone Soil | TTDAIAAEFPATEAIAPRLEAFEAYLESQLPATAAARA* |
| Ga0099830_103915811 | 3300009088 | Vadose Zone Soil | AIAAEFPATEATAPRLDAFEAYLDAQLGTTAGSAKA* |
| Ga0099830_104858163 | 3300009088 | Vadose Zone Soil | LKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGAAASAAKA* |
| Ga0099830_116419191 | 3300009088 | Vadose Zone Soil | EFPATEAIAPRLDAFEAYLDAQLGATAACNAVAKV* |
| Ga0099828_109929161 | 3300009089 | Vadose Zone Soil | AIVAEFPATEAIAPRLEAFEAYLDARLGTATANANA* |
| Ga0105245_108592741 | 3300009098 | Miscanthus Rhizosphere | TDAIAADFPLTEAIAPRLEAFEAYLDAQLGTHAAAAAK* |
| Ga0075423_111366153 | 3300009162 | Populus Rhizosphere | VKTTDAIAAEYPATEAIAPKLEAFEAYLDSQLAANAAVAGKT* |
| Ga0105248_132072511 | 3300009177 | Switchgrass Rhizosphere | NGLKTTDAIAAEYPAAEAIAPKLEAFEAYLDSQLAAGAAAGRA* |
| Ga0134067_104033112 | 3300010321 | Grasslands Soil | TDAIVSEFPATEAIAPRLEAFEAYLDARLGTTAASAKA* |
| Ga0074045_108686631 | 3300010341 | Bog Forest Soil | TTDAIASEYPLTEAIAPRLDAFEAYLESQFAVAAAAK* |
| Ga0074044_109095732 | 3300010343 | Bog Forest Soil | KTTDAIAAEFPATEAIAPRLDAFEAYLDNQFTVAAIAAK* |
| Ga0074044_111341951 | 3300010343 | Bog Forest Soil | NGLKTTDAIASEFPVTEAIAPTLDAFEAYLDNQFSAPATAGAK* |
| Ga0126370_107488491 | 3300010358 | Tropical Forest Soil | GNGLKTTDAIAAEYPLTEAIAPKLEAFEAYVETQFAAAAAALVAGTRK* |
| Ga0126372_103023413 | 3300010360 | Tropical Forest Soil | KTTDAIAAEFPAAEAIAPKLEAFEAYLDSQLATGAAAGKA* |
| Ga0126372_124372012 | 3300010360 | Tropical Forest Soil | LKTTDAIAAEFPLTEAIPPRLDAFEAYLEAQLPAAAAAEA* |
| Ga0126378_122368122 | 3300010361 | Tropical Forest Soil | GNGLKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGTTAAKA* |
| Ga0126379_130141472 | 3300010366 | Tropical Forest Soil | LKTTDAIAAEFPATEAIAPRLEAFEAYLDAQIGATAVAKA* |
| Ga0126381_1035393633 | 3300010376 | Tropical Forest Soil | KTTDAIAAEYPAAEAIAPKLEAFEAYLDSQLATGAAAGKA* |
| Ga0134126_124882162 | 3300010396 | Terrestrial Soil | NEFPLTEAIAPKLEAFEALLDSQLTAASAVAGAK* |
| Ga0126383_112335551 | 3300010398 | Tropical Forest Soil | KTTDAIAAEFPATEAIAPRLEAFEAYLDAQIGATASAKA* |
| Ga0150983_146403661 | 3300011120 | Forest Soil | IAAEFPATEAIAPRLEAFEALLDQQFAATAGKGN* |
| Ga0137392_108310661 | 3300011269 | Vadose Zone Soil | IAAEFPAAEAIAPRLDAFEAYLDAQLGTAAASAKA* |
| Ga0137392_115668451 | 3300011269 | Vadose Zone Soil | LKTTDAIAAEFPVTEAIAPRLDAFEAYLESQLPATAAARA* |
| Ga0137391_102641374 | 3300011270 | Vadose Zone Soil | IAAEFPVTEAIAPRLDAFEAYLESQLPATAAARA* |
| Ga0137391_104852803 | 3300011270 | Vadose Zone Soil | TDAIAAEFPATEAIAPRLEAFEAYLDAQLGATASTAKV* |
| Ga0137393_101836361 | 3300011271 | Vadose Zone Soil | AIAAEFPVTEAIAPRLDAFEAYLESQLPATAAARA* |
| Ga0137389_107523891 | 3300012096 | Vadose Zone Soil | NGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTTAASARA* |
| Ga0137388_100478011 | 3300012189 | Vadose Zone Soil | GLKTTDAIAAEFPVTEAIAPRLDAFEAYLESQLRVTAAARA* |
| Ga0137388_104098421 | 3300012189 | Vadose Zone Soil | NGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTAAAGARA* |
| Ga0137388_105253461 | 3300012189 | Vadose Zone Soil | KTTDAIAAEFPAAEAIAPRLEAFETYLDAQLGTATASAKA* |
| Ga0137388_106602731 | 3300012189 | Vadose Zone Soil | GNGLKTPDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGRR* |
| Ga0137388_112812552 | 3300012189 | Vadose Zone Soil | LKTTDAIAAEFPATEAIAPLLDAFEAYLDAQLGATTAAAMA* |
| Ga0137388_118021272 | 3300012189 | Vadose Zone Soil | AAEFPATEAIAPRLDAFEAYLDAQLGTTTAAAKA* |
| Ga0137383_111994211 | 3300012199 | Vadose Zone Soil | TDAITAEFPATEAIAPRLDAFEAYLDAQLGAAAASGKA* |
| Ga0137363_108397442 | 3300012202 | Vadose Zone Soil | KTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGRR* |
| Ga0137363_111066943 | 3300012202 | Vadose Zone Soil | VSEYPLTEAIAPRLEAFEAYLDAQLGAAAEAAKA* |
| Ga0137399_112733951 | 3300012203 | Vadose Zone Soil | GLKTTDAIAAEFPATEAIAPRLEAFEAYLDAQLGTTAAGARP* |
| Ga0137399_114747122 | 3300012203 | Vadose Zone Soil | LKTTDAIAAEFPAPEAIAPRLDAFEAYLESQLPAAATARA* |
| Ga0137380_102860121 | 3300012206 | Vadose Zone Soil | AITAEFPATEAIAPRLEAFEAYLDAQLGAAAASGKA* |
| Ga0137380_104385131 | 3300012206 | Vadose Zone Soil | GNGLKTTDAIAAEFPVTEAIAPRLEAFEAYLDAQLGATAAGAKA* |
| Ga0137380_107984321 | 3300012206 | Vadose Zone Soil | IAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR* |
| Ga0137376_114735032 | 3300012208 | Vadose Zone Soil | TDAIVAEYPATEAIAPKLEVFEAYLDAQLAAAKA* |
| Ga0137377_101237961 | 3300012211 | Vadose Zone Soil | ITAEFPATEAIAPRLDAFEAYLDAQLGAAAASGKA* |
| Ga0137377_118967752 | 3300012211 | Vadose Zone Soil | VAEFPATEAIPPRLEAFAAYLDAQLGTTTASARA* |
| Ga0137387_104622201 | 3300012349 | Vadose Zone Soil | KTTDALAGEFPAEEAIAPRLDAFEAYLEGRLAGAATAT* |
| Ga0137387_105001673 | 3300012349 | Vadose Zone Soil | AIVAEYPLTEAIAPRIEAFEAYLDAQLGAAAEAAKV* |
| Ga0137386_110699042 | 3300012351 | Vadose Zone Soil | TDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR* |
| Ga0137384_103759611 | 3300012357 | Vadose Zone Soil | NGLKTTDAITAEFPATEAIAPRLDAFEAYLDAQLGAAAASGKA* |
| Ga0137384_106796901 | 3300012357 | Vadose Zone Soil | TDAIAAEFPATEAIAPRLDAFEAYLDAQYGTTEESAKR* |
| Ga0137360_107879901 | 3300012361 | Vadose Zone Soil | LKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGRR* |
| Ga0137361_101066625 | 3300012362 | Vadose Zone Soil | LKTTDAIATEFPATEAIAPRLEAFEAYLDAQLGATAAGAKT* |
| Ga0137390_114807811 | 3300012363 | Vadose Zone Soil | TGNGLKTTDAIATEFPATEAIAPRLEAFEAYLDAQLGATAASAKT* |
| Ga0137390_119472352 | 3300012363 | Vadose Zone Soil | DAIAAEFPATEAIAPRLDAFEAYLDAQLGAAASAAAGKR* |
| Ga0137398_107014331 | 3300012683 | Vadose Zone Soil | TTDAIAADFPLSEAIAPRIEAFEAYLDGQLPTTAAARA* |
| Ga0137396_105636833 | 3300012918 | Vadose Zone Soil | AIAAEFPATEAIAPRLDAFEAYLDAQLGTTAAGARA* |
| Ga0137359_104055123 | 3300012923 | Vadose Zone Soil | GLKTTDAIVADYPATEAIAPKLEAFEAYLDGQLAAVKA* |
| Ga0137359_110016411 | 3300012923 | Vadose Zone Soil | KTTDAIAADFPLSEAIAPRIEAFEAYLDSQLPTTAAARA* |
| Ga0137413_101666334 | 3300012924 | Vadose Zone Soil | AIAAEFPATDAIAPRLEAFEAYLDAQLGTATASAKA* |
| Ga0137419_102243621 | 3300012925 | Vadose Zone Soil | TTEAIAAEFPPTEAIAPHLDAFEAYLDAHLSTAAASAKA* |
| Ga0137419_111726791 | 3300012925 | Vadose Zone Soil | DAIAAEFPATDAIAPRLEAFEAYLDAQLGATAGSAKA* |
| Ga0137419_118316431 | 3300012925 | Vadose Zone Soil | NGLKTTDAIAADFPLSEAIAPRIEAFEAYIEAQLPAAAAARA* |
| Ga0137416_100595566 | 3300012927 | Vadose Zone Soil | VCITGNGLKTTEAIAAEFPPTEAIAPHLEAFEAYLDAHLGTAAASAKA* |
| Ga0137416_101036363 | 3300012927 | Vadose Zone Soil | ITGNGLKTTDAIAAEFPAAEVIAPRLDAFEAYLDAQLGATTASAKA* |
| Ga0137416_102976591 | 3300012927 | Vadose Zone Soil | NGLKTTDAIAAEFPSTEAIAPRIEALEALLDSQLAAAAATKGN* |
| Ga0137407_108277971 | 3300012930 | Vadose Zone Soil | AIAAEFPATEAIAPRLDAFEAYLDAQLGTTAASARA* |
| Ga0153915_126986341 | 3300012931 | Freshwater Wetlands | KTTDALTGEFPATEAIAPRLDAFEAYLEGRLAAAVASK* |
| Ga0126369_114692611 | 3300012971 | Tropical Forest Soil | TDAIAPEYPATEAIAPRLEAFEAYLDAQLGTSAVAAKV* |
| Ga0134077_104232921 | 3300012972 | Grasslands Soil | GLKTTDAIVSEYPLTEAIAPRLEAFEAYLDAQLGAAAEAAKA* |
| Ga0134110_100078161 | 3300012975 | Grasslands Soil | GNGLKTTDAIATEFPATEAIAPRLEAFEAYLDAHIGAAAAAKA* |
| Ga0164306_119338021 | 3300012988 | Soil | TDAIAAEFPLAEAIAPRLEAFEAYLDSQLGAHAATAGK* |
| Ga0157372_131907012 | 3300013307 | Corn Rhizosphere | ITGNGLKTTDAIVNEFPLTEAIAPKLEAFEALLDSQLTAASAVAGAK* |
| Ga0134075_100417654 | 3300014154 | Grasslands Soil | ATTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATAAGVRA* |
| Ga0134079_100604884 | 3300014166 | Grasslands Soil | GLKTTDAIAAEFPATEAIAPRLDAFEGYLDAQLGTAAAGAKA* |
| Ga0137411_11545958 | 3300015052 | Vadose Zone Soil | GNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTTAASARA* |
| Ga0137411_13600001 | 3300015052 | Vadose Zone Soil | NGLKTTEAIAAEFPPTEAIAPHLDAFEAYLDAHLSTAAASAKA* |
| Ga0137420_11110182 | 3300015054 | Vadose Zone Soil | GNGLKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGTAAVSAKA* |
| Ga0137420_12142402 | 3300015054 | Vadose Zone Soil | GLKTTDAIAAEFPATEAIAPRLDAFEAYLDAHLGTAAASAKA* |
| Ga0137420_13078571 | 3300015054 | Vadose Zone Soil | PENHRKTTDAIAAEFPATEAIAPRLDAFEAYLDAQLGATAAGVKA* |
| Ga0137409_112799792 | 3300015245 | Vadose Zone Soil | LKTTDAISAEFPLTEAIAPRLDAFEAYLDNQFTATAAAAK* |
| Ga0182035_111378592 | 3300016341 | Soil | KTTDAIVAEYPAKEAIAPKLEAFEAYLDAQLAAGAASGKA |
| Ga0187785_101666863 | 3300017947 | Tropical Peatland | GNGLKTTDAIAADFPAADAIEPRLEAFEALLDLVVAPASGGQAAAQQP |
| Ga0187779_104728161 | 3300017959 | Tropical Peatland | TGNGLKTTDALAAEFPFAEPIAPRLEAFEAALEGRLAAAATLSL |
| Ga0187822_103648881 | 3300017994 | Freshwater Sediment | AIAAEFPATEAIAPRLEAFEAYLDAQIGATAAAKA |
| Ga0066655_108400422 | 3300018431 | Grasslands Soil | TDGIGAEFPASEAIAPRLGAFEAYLDAHLGTAAASAKA |
| Ga0066669_122993032 | 3300018482 | Grasslands Soil | GNGLKTTDAIVSEFPATEAIAPRLEAFEAYLDARLGTAAASAKA |
| Ga0210407_108632333 | 3300020579 | Soil | NGLKTTDAIAAEFPVAEVIAPRLDAFEAYLGAQLPKTAAARA |
| Ga0210403_104373063 | 3300020580 | Soil | LKTTDAIAAEFPAAEAIAPRLDAFEALLDQQFAATAGKGN |
| Ga0210403_113444341 | 3300020580 | Soil | LKTTDAIAAEFPLAEAIAPRLDAFEAYIESQLPATAAARA |
| Ga0210399_105933811 | 3300020581 | Soil | DAIAAEFPATEAIAPRLEAFEALLDQQFAAAAGKGN |
| Ga0210395_101724011 | 3300020582 | Soil | ITGNGLKTLDAISAEFPVSEAIAPRLDAFEAYLDNQFNAAPAAAVAK |
| Ga0210401_100668676 | 3300020583 | Soil | TTDAIASEFPVTEAIAPRLDAFEAYLDNQFTAAAAAK |
| Ga0210400_115554441 | 3300021170 | Soil | AIAAEFPVTEAIAPRLEAFEAYLDAQLGTTAAGAKA |
| Ga0210408_109141633 | 3300021178 | Soil | DAIAAEFPATEAIAPRLEAFEAYLDAQLGTTAASAKA |
| Ga0210396_117456092 | 3300021180 | Soil | DAIAAEFPTIEAIAPRLEAFEAYLDNQLATTASAQR |
| Ga0210384_100965683 | 3300021432 | Soil | TGNGLKTTDAIAADYPATEAIAPRLDAFEAYLDDQLATTAKA |
| Ga0210398_109985461 | 3300021477 | Soil | NGLKTTDAIAAEFPLTEAIAPRLDAFEAYLDNQFSVAATAAK |
| Ga0210410_106474293 | 3300021479 | Soil | TTDAIAAEFPATEAIAPRLDAFEALLDQQFAATAGK |
| Ga0210409_105687683 | 3300021559 | Soil | TTDAIAADYPATEAIAPRLDAFEAYLDDQLATTAKA |
| Ga0242654_103458652 | 3300022726 | Soil | DAIAAEYPLTEAIAPRLEAFEAYLDSQLATAAVAKV |
| Ga0242654_103866472 | 3300022726 | Soil | AIAAEFPVTEAIAPRLDAFEAYLEAQLPVSAAARA |
| Ga0247677_10445301 | 3300024245 | Soil | GLKTTDAIASEFPLTEAIAPKLEAFEAYLDGQLTAASAIAGAK |
| Ga0247671_10166291 | 3300024284 | Soil | GNGLKTTDAIAAEFPVTEAIEPRIDAFEAYLENQFTLAAATAGAK |
| Ga0179589_105124122 | 3300024288 | Vadose Zone Soil | ITGNGLKTTDALIAEYPLSEPIPPRLEAFEALLDQQLAVTAGAKGAVSTCP |
| Ga0207663_106805313 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IVNEFPLTEAIAPKLEAFEALLDSQLTAASAVAGAK |
| Ga0207648_102978151 | 3300026089 | Miscanthus Rhizosphere | TTDAIAAEYPFTEAIAPKLEAFEAYLDSQLAAGAAARA |
| Ga0209057_12468112 | 3300026342 | Soil | IAAEFPATEAIAPRLEAFEAYLDAQLGATAAGAKT |
| Ga0257172_11051402 | 3300026482 | Soil | LKTTEAIAAEFPATEAIAPRLEAFEAYLDAQLGVTAGSAKA |
| Ga0257168_11230391 | 3300026514 | Soil | NGLKTTDAIAAEFPVAEAIAPRLEAFEAYLESQLPAAAAARA |
| Ga0209378_12923082 | 3300026528 | Soil | TTDPIAAEFPATEAIAPRLDAFEAYLDAQLGATASAAAGKR |
| Ga0209577_101204591 | 3300026552 | Soil | NGLKTTDAIAAEFPSSEAIAPRLEAFEAYLDAQLGAAAAKA |
| Ga0209731_10527963 | 3300027326 | Forest Soil | GLKTTDAIAAEFPAAEAIAPRLDAFEAYLDAQLGATAAGAKA |
| Ga0209388_10719453 | 3300027655 | Vadose Zone Soil | GNGLKTTDAIAAEFPLSEAIAPRLDAFEAYIESQLPATAAARA |
| Ga0209139_101832571 | 3300027795 | Bog Forest Soil | CITGNGLKTTDALVAEFPLPEAIAPRLDAFEALLDSQLAATAAQGN |
| Ga0209167_107307511 | 3300027867 | Surface Soil | KTTDAIAGEFPLTEAIAPKLEAFEALLDSQLTTASAVAAAK |
| Ga0209283_109176573 | 3300027875 | Vadose Zone Soil | DAIAAEFPATEAIAPRLDAFEAYLDAQLGAATAGAKA |
| Ga0209698_101132105 | 3300027911 | Watersheds | AAEFPATEAIAPRIEAFEAYLDAQIGIAKAAASSA |
| Ga0209168_103159872 | 3300027986 | Surface Soil | LSITGNGLKTTDAIANEFPLTEAIAPKLEAFEALLDSQLTAAGAAAGAK |
| Ga0222749_101681491 | 3300029636 | Soil | TTDAIAAEFPLAEAIAPRLDAFEAYLDSQFTAAAAAK |
| Ga0302179_105571981 | 3300030058 | Palsa | YPVTEAIAPRLDAFEAYLDRQLGTPAATAAVASRS |
| Ga0302314_107833501 | 3300030906 | Palsa | AIVAEYPVTEAIAPRLDAFEAYLDRQLGTPAATAAVASRS |
| Ga0170834_1006473322 | 3300031057 | Forest Soil | LKTTDAIAAEFPVTEAIAPRLDAFKAYLEAQLPASAAARA |
| Ga0170834_1135277271 | 3300031057 | Forest Soil | GNGLKTTDAIAAEFPVTEAIAPRLDAFEAYLDNQFSVAASAAK |
| Ga0318561_104483303 | 3300031679 | Soil | GNGLKTTDAIAAEFPATEAIAPRLEAFEAYLDTQMGAAAAAKA |
| Ga0307476_113155031 | 3300031715 | Hardwood Forest Soil | GNGLKTTDAIASEFPVTEAIAPRLDAFEAYLDSQFTAAAAAK |
| Ga0307474_116199872 | 3300031718 | Hardwood Forest Soil | TTDAIAAEFPVTEAIAPRLDAFEAYLEAQLPATAAARA |
| Ga0307469_106447171 | 3300031720 | Hardwood Forest Soil | LKTTDAIAAEYPATEAIAPRLDAFEAYLDAQLGTTAASAKA |
| Ga0307469_116724251 | 3300031720 | Hardwood Forest Soil | DAIAAEFPQAEAIAPRLEAFEAYLDAELGAATASAAAK |
| Ga0307469_124248561 | 3300031720 | Hardwood Forest Soil | AIVSEFPATEAIAPRLEAFEAYLDAQLGTAAASAKG |
| Ga0307477_100685141 | 3300031753 | Hardwood Forest Soil | AIAAEFPATEAIAPRLEAFEAYLDAQLGAHATAAK |
| Ga0307478_106718183 | 3300031823 | Hardwood Forest Soil | AIAADFPATEVIAPRLDAFEAYLDNQFNTVPAVAGAQ |
| Ga0307470_119580782 | 3300032174 | Hardwood Forest Soil | KTTDAIAAEFPVADAIPPRLDAFEAYLEARLPAVAVARA |
| Ga0307471_1024676731 | 3300032180 | Hardwood Forest Soil | IAAEFPATEAIAPRLDAFEAYLDAQLGTTAAGARA |
| Ga0335077_117165831 | 3300033158 | Soil | KTTDAIVSEYPLTEAIAPRLEAFEAYLDTQLTTTAAVAKA |
| ⦗Top⦘ |