NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041933

Metagenome / Metatranscriptome Family F041933

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041933
Family Type Metagenome / Metatranscriptome
Number of Sequences 159
Average Sequence Length 119 residues
Representative Sequence MMVRFMRSVARLVVDHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGSRDPQWRAASQIGKELGYGNQLFVLIEAPEGATDTTGEMEEMADRLTADMLSSGLFKQARCGLQEEELLN
Number of Associated Samples 139
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.20 %
% of genes near scaffold ends (potentially truncated) 96.86 %
% of genes from short scaffolds (< 2000 bps) 88.68 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.371 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(13.207 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.912 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.42%    β-sheet: 0.00%    Coil/Unstructured: 45.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF13649Methyltransf_25 25.16
PF07977FabA 15.72
PF08241Methyltransf_11 3.14
PF00891Methyltransf_2 1.26
PF12847Methyltransf_18 0.63
PF01522Polysacc_deac_1 0.63
PF00535Glycos_transf_2 0.63
PF13489Methyltransf_23 0.63
PF04055Radical_SAM 0.63
PF02310B12-binding 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG07643-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydrataseLipid transport and metabolism [I] 15.72
COG4706Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domainLipid transport and metabolism [I] 15.72
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.37 %
UnclassifiedrootN/A0.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10108636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1177Open in IMG/M
3300001686|C688J18823_10601592All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300002916|JGI25389J43894_1010693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1531Open in IMG/M
3300004092|Ga0062389_104957508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300004152|Ga0062386_101746086All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300005177|Ga0066690_10408669All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300005435|Ga0070714_100253815All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300005576|Ga0066708_10486211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium795Open in IMG/M
3300005712|Ga0070764_10085047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1670Open in IMG/M
3300005921|Ga0070766_10406991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium892Open in IMG/M
3300006028|Ga0070717_11671939All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300006059|Ga0075017_100535595All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium891Open in IMG/M
3300006086|Ga0075019_10275752All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300006086|Ga0075019_11103811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300006174|Ga0075014_100428683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300006176|Ga0070765_101259163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300009093|Ga0105240_11051963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300009623|Ga0116133_1133891All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300009624|Ga0116105_1189804All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300009636|Ga0116112_1082736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300009643|Ga0116110_1160243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300009672|Ga0116215_1471471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300011120|Ga0150983_10998479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300011271|Ga0137393_11051404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300012208|Ga0137376_10682910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium886Open in IMG/M
3300012469|Ga0150984_101690463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300014156|Ga0181518_10390982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300014158|Ga0181521_10022181All Organisms → cellular organisms → Bacteria5217Open in IMG/M
3300014158|Ga0181521_10071841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2244Open in IMG/M
3300014161|Ga0181529_10204515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300014167|Ga0181528_10551717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300014169|Ga0181531_10035322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2891Open in IMG/M
3300014200|Ga0181526_10928056All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300014489|Ga0182018_10306240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium863Open in IMG/M
3300014496|Ga0182011_10888217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300014502|Ga0182021_13606278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300014658|Ga0181519_10040555All Organisms → cellular organisms → Bacteria3150Open in IMG/M
3300014658|Ga0181519_10247626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1113Open in IMG/M
3300014658|Ga0181519_10278258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1042Open in IMG/M
3300014838|Ga0182030_11409520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300017933|Ga0187801_10365172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300017934|Ga0187803_10426612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300017940|Ga0187853_10075213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1690Open in IMG/M
3300017946|Ga0187879_10807321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300017948|Ga0187847_10087001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1731Open in IMG/M
3300017972|Ga0187781_10347661All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1055Open in IMG/M
3300017972|Ga0187781_11227393All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300018006|Ga0187804_10074707All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1362Open in IMG/M
3300018022|Ga0187864_10033732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3006Open in IMG/M
3300018024|Ga0187881_10259207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300018025|Ga0187885_10537126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300018034|Ga0187863_10102462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1604Open in IMG/M
3300018034|Ga0187863_10408353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300018037|Ga0187883_10147546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1212Open in IMG/M
3300018040|Ga0187862_10001015All Organisms → cellular organisms → Bacteria30631Open in IMG/M
3300018043|Ga0187887_10010371All Organisms → cellular organisms → Bacteria → Proteobacteria6336Open in IMG/M
3300018057|Ga0187858_10655136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300018085|Ga0187772_10088474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1976Open in IMG/M
3300018090|Ga0187770_11643916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300018433|Ga0066667_10879034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300019082|Ga0187852_1188886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300019788|Ga0182028_1492516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1963Open in IMG/M
3300020580|Ga0210403_10262581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1416Open in IMG/M
3300020581|Ga0210399_11326788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300020582|Ga0210395_10003390All Organisms → cellular organisms → Bacteria12266Open in IMG/M
3300021170|Ga0210400_10607121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300021171|Ga0210405_10481144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium974Open in IMG/M
3300021401|Ga0210393_11074194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300021405|Ga0210387_10835337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300021420|Ga0210394_11742666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300021433|Ga0210391_10796107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300021474|Ga0210390_11552092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300021479|Ga0210410_11820421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300022861|Ga0224528_1054481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300022872|Ga0224526_1057323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300022872|Ga0224526_1090565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300023088|Ga0224555_1159491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300023088|Ga0224555_1187745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300023091|Ga0224559_1045690All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1744Open in IMG/M
3300025929|Ga0207664_11785064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300025939|Ga0207665_10722117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300026271|Ga0209880_1088586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300026325|Ga0209152_10485370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300027568|Ga0208042_1115676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300027634|Ga0209905_1036134All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Schekmanbacteria → Candidatus Schekmanbacteria bacterium RBG_13_48_7749Open in IMG/M
3300027768|Ga0209772_10239120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300027825|Ga0209039_10072030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1526Open in IMG/M
3300027879|Ga0209169_10053483All Organisms → cellular organisms → Bacteria2097Open in IMG/M
3300027879|Ga0209169_10106448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1452Open in IMG/M
3300027905|Ga0209415_10743463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300028016|Ga0265354_1028309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300028082|Ga0255352_1004973All Organisms → cellular organisms → Bacteria4274Open in IMG/M
3300028084|Ga0255356_1010943All Organisms → cellular organisms → Bacteria3106Open in IMG/M
3300028084|Ga0255356_1038732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium923Open in IMG/M
3300028268|Ga0255348_1090609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300028745|Ga0302267_10177659All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium963Open in IMG/M
3300028776|Ga0302303_10142898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium851Open in IMG/M
3300028785|Ga0302201_10274899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300028788|Ga0302189_10408522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300028795|Ga0302227_10206787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300028859|Ga0302265_1096168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium957Open in IMG/M
3300028873|Ga0302197_10066169All Organisms → cellular organisms → Bacteria1930Open in IMG/M
3300028906|Ga0308309_10204490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1629Open in IMG/M
3300028909|Ga0302200_10284529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300029882|Ga0311368_10662204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300029883|Ga0311327_10401331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300029910|Ga0311369_11134733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300029911|Ga0311361_10327099All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300029911|Ga0311361_11334019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300029915|Ga0311358_10816771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300029952|Ga0311346_10804397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium792Open in IMG/M
3300029953|Ga0311343_10690714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300029955|Ga0311342_10624273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300029956|Ga0302150_10055864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1539Open in IMG/M
3300029982|Ga0302277_1171271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium871Open in IMG/M
3300029982|Ga0302277_1324710All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300029985|Ga0302280_1073003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1371Open in IMG/M
3300029992|Ga0302276_10034559All Organisms → cellular organisms → Bacteria3281Open in IMG/M
3300029993|Ga0302304_10221851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300030007|Ga0311338_10238007All Organisms → cellular organisms → Bacteria → Proteobacteria2058Open in IMG/M
3300030007|Ga0311338_10435034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1396Open in IMG/M
3300030053|Ga0302177_10606243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300030494|Ga0310037_10064236All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300030503|Ga0311370_10204654All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2651Open in IMG/M
3300030503|Ga0311370_10929724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300030503|Ga0311370_11774531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300030503|Ga0311370_12062718All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300030506|Ga0302194_10439561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300030520|Ga0311372_10375272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2176Open in IMG/M
3300030520|Ga0311372_11956773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300030617|Ga0311356_10606283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1059Open in IMG/M
3300030618|Ga0311354_10233926All Organisms → cellular organisms → Bacteria → Proteobacteria1940Open in IMG/M
3300030737|Ga0302310_10717547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300030759|Ga0265745_1005043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium847Open in IMG/M
3300030879|Ga0265765_1000512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3083Open in IMG/M
3300031040|Ga0265754_1008084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300031231|Ga0170824_104218003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300031261|Ga0302140_11098539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300031524|Ga0302320_11546810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300031524|Ga0302320_11614887All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300031708|Ga0310686_103574722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300031718|Ga0307474_10821180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300031753|Ga0307477_10178263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1481Open in IMG/M
3300031754|Ga0307475_10815611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300031823|Ga0307478_10225006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1517Open in IMG/M
3300031823|Ga0307478_11608243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031837|Ga0302315_10259214All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1016Open in IMG/M
3300031837|Ga0302315_10698381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300032770|Ga0335085_11587647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300032783|Ga0335079_11185522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300032892|Ga0335081_10441849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1657Open in IMG/M
3300033405|Ga0326727_11174688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300033561|Ga0371490_1021799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2151Open in IMG/M
3300033755|Ga0371489_0162748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1199Open in IMG/M
3300033823|Ga0334837_115824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300033827|Ga0334848_060004All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300033982|Ga0371487_0380796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300033983|Ga0371488_0105465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1553Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog13.21%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa11.95%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.55%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil7.55%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.14%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.14%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.14%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.89%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.26%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.26%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.63%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.63%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.63%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.63%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.63%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022861Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25EnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028082Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T0EnvironmentalOpen in IMG/M
3300028084Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T100EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028859Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029985Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1EnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030759Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031040Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033827Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1010863623300000567Peatlands SoilMIVQSTMVRFMRVLGRVVVDHPGLVTALSLVLTLFLFSNIHNLRTGTDLTDLFGERDPQWRAASQIGKELGYGNQLFVLIEAPEGANDATGEMEEMADRFTADMLASGLFKQARCGLQEEELLNM
C688J18823_1060159213300001686SoilMARCMRLIGRLVVGHPGLVVLLSAVVTLFLYSNIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIQAPSGAMDATDQMEELADRLTADMQASGLFVDAR
JGI25389J43894_101069333300002916Grasslands SoilMARCMRLIGRLVVGHPGLVVLLSAVVTVFLYANIHNLRTGTDLTDLFGNGDPQWRAASQIGKELGYGNQLFVVIEAPAGGTDTTDQMENLAGRLTSEMQASGLFVDARCGLQDEELLNVVRYFT
Ga0062389_10495750813300004092Bog Forest SoilMMRGFMRLVGRAVVGHPGLVVALSLVVSLFFFANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEGGALEKATSEKDASEKETDATSEMEETADRLTADMMSSGL
Ga0062386_10174608613300004152Bog Forest SoilMMVRFMRSVARLVVDHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGSRDPQWRAASQIGKELGYGNQLFVLIEAPEGGADATGEMEEMADRLTADMLSSGLFKQARCGLQ
Ga0066690_1040866923300005177SoilMMVRFMRLVGGVVVNHPWLVTAVSLVVTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEVPNGETDTTGPMEDAADRLTADMLNSGLFRHARCGLQEEELLNIVRYFTW
Ga0070714_10025381513300005435Agricultural SoilMMARCMRLVGGLVVRHPGLVVLLSLVVTVWLNANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPASGTDSTDQMEGLADRLTADMQASGLFVDARCGLNDEELLNMVRFFTW
Ga0066708_1048621113300005576SoilMARCMRLIGRLVVGHPGLVVLLSAVVTVFLYANIHNLRTGTDLTDLFGNGDPQWRAASQIGKELGYGNQLFVVIEAPAGGTDTTDQMENLAGRLTS
Ga0070764_1008504713300005712SoilMMVRFMRMVGRVVVGHPGLVTALSLVVTLLLYANIHKLRTGTDLTDLFGNRDPQWRTASQIGKELGYGNQLFVLIEAPNGGTSGGADSTGQMEEMADRLTADMLTSGLFLHARCGLQDEELLNMVRFFTWNFP
Ga0070766_1040699123300005921SoilMIRGVMVRCMRLVGRVVVGHPGLVVAASLVVSLFFYANIHNLRTGTDLTDLFGNRDPQWKAASQIGKELGYGNQLFVLVEAPEVAAPEVEVPEKEGKDATSTMEDAADRLTADMTNSGLFLHARSGLQEDELLNMVRYFTWNFPS
Ga0070717_1167193923300006028Corn, Switchgrass And Miscanthus RhizosphereMMVRCMRLVGRVVVGHPGLVTALSLVLTFLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIETPDSGADATEDMEETADRLTADMMSSGLFRHARCGLQEDEL
Ga0075017_10053559523300006059WatershedsMMVRFMRLLGRLVVDHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGDRDPQWRAASQIGKELGYGNQLFVLIEAPEGGTDTTGEMEEMGDRLTADMLTSGLFKQARCGLQEEELLNMVRFFTWNFQSFVLPEQTEDLKRR
Ga0075019_1027575213300006086WatershedsMMARCMRWVGGLVVGHPGLVTALSLVVTLLLYANIHNLRTGTDLTDLFGNHDPQWRAVSQIGKELGYGNQLFLVIEAPSGATDTTDQMEEMADRLTSDMQASG
Ga0075019_1110381113300006086WatershedsMMVRFMRLVGGLVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLTDLFGDRDPQWRAASQIGKELGYGNQLFVLIEVPDGEPDTTGPMEEAADRLTADMLTSGLFLHA
Ga0075014_10042868313300006174WatershedsMMVRFMRLVGGLVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLTDLFGDRDPQWRAASQIGKELGYGNQLFVLIEVPDGETDTTGPMEEAADRLTADMLTSGLFLHARCGLQEEELLN
Ga0070765_10125916313300006176SoilMMVRFMRLLGGLVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLTDLFGDRDPQWRAASQIGKELGYGNQLFVLIEVPDGEKDTTAQMEEAADRLTADMLTSGL
Ga0105240_1105196313300009093Corn RhizosphereMRLVGGLVVRHPGLVVLLSLVVTVWLNANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIEAPPDGTDSTDQMEELADRLTADMQASGLFVDARGGLSDEELLNMVRFFTWN
Ga0116133_113389123300009623PeatlandMMVRFMRLVGWLVVGHPGLITALTLVLTLFLCTNIHNLRTSTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPDGGMDTTGEMEEMADRLTA
Ga0116105_118980423300009624PeatlandMMARCMRWVGSLVVGHPGLVTAFSLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEAPQSPEEQSAAGTDSTGQMEELADRLTAD
Ga0116112_108273613300009636PeatlandMLRFMRWLGRLVIGHPGLVAGTALLLTLFLLANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEGEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNL
Ga0116110_116024313300009643PeatlandMVRFMRGLARLVINHPGLVAGVSLVLTLFLFANIHNLRTGTELTDMFGSRDPQWQAASQIGKELGYGNQLYVLVQAPEGEADSSEAMEAAADRLTGEMSASGLFKQARCGLREEELINLVRLFS
Ga0116215_147147123300009672Peatlands SoilMMVRFMRLVGRLVVDHPLLVAALSLVLTVFWYANIHNLRTGTDLTDLFGNRDPQWRAASHIGKELGYGNQLFVLIEAPVGGTDTTGEMEEMADRLTADMLTSGLFKQARCGLQEEELL
Ga0150983_1099847913300011120Forest SoilMMARLMRWVGGLVVDHPGLVTALSLVGTVLLFANIHNLRTGTDLTDLFGNHDPQWQAASQIGKDLGYGNQLFVLIEAPDGTDTTNEMEEMADRLTTDMASSGLFVHARSGL
Ga0137393_1105140413300011271Vadose Zone SoilMRWVGGLVVGHPGLVTALSLIVTSLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIDAPAGGTDVTGQMEEMADRLTADMQASGLFLDARCGLQDEELLNLVRFFT
Ga0137376_1068291023300012208Vadose Zone SoilMMVRFMRRVGGVVVNHPWLVTAVSLVVTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEVPNGETDTTGPMEDAADRLTADMLNSGLFRHARCGLQEEELLN
Ga0150984_10169046323300012469Avena Fatua RhizosphereMGWSRSIMARCMRLIGRLVVGHPGLVVLLSAIVTLFLYSNIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIQAPAGGTDTTEQMEELADRLTADMQASGLFVDA
Ga0181518_1039098223300014156BogMVRFMRGLGRLVIGHPGWVAGVALALTLFLFANIHNLRTGTELTDMFGKDDPQWQAASQIGKELGYGNQLFVLVQAPRGDADSSDAMEAAADRLTAEMASSGLFKQARSGL
Ga0181521_1002218113300014158BogMMVRFMRLLGRLVIDHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGSKDPQWRAASQIGKELGYGNQLFVLIEAPTGETDTTAEMEEMADRLTADMLSSGLFKQARC
Ga0181521_1007184143300014158BogMMVRFMRLVARLVVGHPGLVTALSLVLTLLLYANIHNLRTGTDLTDLFGSRDPQWRAASQIGKELGYGNQLFVLIEAPEGGTDTTGEMEEMADRLTADMLSSGLFKQARCGLQEEELLNIVRFFTW
Ga0181529_1020451513300014161BogMLRFMRGLGRLVIGHPGLVVGVVFAITLFLFANIHNLRTGTELTDMFGKGDPQWQAASEIGKELGYGNQLFVLVQAPRGDADSSEAMEATADRLTAEMAASGL
Ga0181528_1055171723300014167BogMLRFMRWLGRLVIGHPGLVAGTALLLTLFLLANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEGEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNLARLFSWHFPSYALPGQT
Ga0181531_1003532213300014169BogMMARCMRWVGSLVVGHPGLVTAFSLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEAPQSPEEQSAAGTDSTGQMEELADRLARGSITMNLWVQIAN
Ga0181526_1092805613300014200BogMVRFMRLVGRLVVSHPGLVTALSLVGTLLWYANIHNLRTATDLTDLFGNRDPQWRAASQIGEELGYGNQLFVLIETPDTGTADTGTDSTDEMEEKADRLTADMLASGLFVHARCGLQEEELLNLVR
Ga0182018_1030624013300014489PalsaMMVRGMRLVGGLVVGHPGLVTALSLVITLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIDAPAGGTDITGQMEEIADRLTADM
Ga0182011_1088821713300014496FenMMVRFMRGLGRLVIGHPGLVVGVVFVMTLFLFTNIHNLRTGTDLTDMFGRGDPQWQAASQIGKELGYGNQLFVLVQAPRGNADSSEAMEAAADRLTAEMAASGLFKQARSGLQEEELLNLVRLFSWHFPSYA
Ga0182021_1360627813300014502FenMMLRFMRGLGRLVIGHPGLVVGVVFAMTLFLFANIHNLRTGTELTDMFGKGDPQWQAASQIGKELGYGNQLFVLVQVPRGDADSSEAMEAAADRLTAEMAASGLFKQARSGLQEEELLNLVRLFSWHFPSYALPGQ
Ga0181519_1004055553300014658BogMMARFMRLVGRLVIGHPGMVTGVSLVLTIFLYANIHNLRTGTDLTDMFGNRDPQWQAASKLGKELGYGNQLFVLIEAQESGADATGAMEEMADRLTAEMRASGQFKQARCGLQ*
Ga0181519_1024762613300014658BogMLRFMRWLGRLVIGHPGLVAGTALLLTLFLLANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEGEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNLARLF
Ga0181519_1027825813300014658BogMMVRFMRLVGRLVIGHPGMVTGLTLAMTLFLYANIHNLRTGTDLTDMFGNHDPQWQAASQLGKELGYGNQLFVLVEAPENGADSTDEMEEMADRLTADMHSSGLFKQARCGLQEEELLNFVRFFTWNFPAFAQPGQSEE
Ga0182030_1140952013300014838BogMMIRFMRLLASLVVRHPGLVIAITLVLTFFLYANIHNLRAGTDLTDLFGKRDPQWQAASQIGKELGYGNQLFVLIEAPQGGMDTTGEMEEMADRLTSDMLTSGLFKHARCSLQEEELLNMVRFFTWNFPAFVRSEQA
Ga0187801_1036517213300017933Freshwater SedimentVIVESMMMRFMRVLGRVVVDHPWTVTALSLVLTLFLFSNIHNLRTGTDLTDLFGERDPQWRAASQIGKELGYGNQLFVLIEAPEGGNDTTGEMEEMADRLTADMMSSGLFKQARCGLQEEELLNMVRFFTWN
Ga0187803_1042661223300017934Freshwater SedimentMMVRLMRLVSRLVVDHPGLVTALSLLLTLFLYANIHNLRTGTDLTDLFGERDPQWRAASQIGNELGYGNQLFVLIEAPEGGTDTTGEMEEMADRLNADMLSSGLFKHARGGLQEDE
Ga0187853_1007521313300017940PeatlandMMARFMRLVGRLVIGHPGMVTGVSLVLTIFLYANIHNLRTGTDLTDMFGNRDPQWQAASKLGKELGYGNQLFVLIEAQESGADATGAMEEMADRLTAQMQASGQFKQARCGLKEEELLNIVRFYSWNF
Ga0187879_1080732113300017946PeatlandMMVRFMRWVGGLVVSHPGLVTALSLVVTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIDAPPGATDTTGQMEEMADRLTSDMQASGLFLDARSG
Ga0187847_1008700133300017948PeatlandMMLRFMRWLGRLVIGHPGLVAGTALLLTLFLLANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEGEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNL
Ga0187781_1034766133300017972Tropical PeatlandMMARCLRWAGSLVVRRPGLVTALSFVVTLWLYANIHNLRTGTDLADLFGTRDPQWRAASQIGKELGYGNQLFVLIEAPTGGTDDPAQMEDMAERLTGGMQSSGLFMDARCGLQDEE
Ga0187781_1122739323300017972Tropical PeatlandMARCMRLLGRLVVNHPGLVTALSLIGTLWLYSNIHKLRTGTDLADLFGNRDPQWRAVSRIGKELGYGNQLFVLIEAPAGGSDTTGPMEEMADRLTA
Ga0187804_1007470713300018006Freshwater SedimentVIVESMMMRFMRVLGRVVVDHPWTVTALSLVLTLFLFSNIHNLRTGTDLTDLFGERDPQWRAASQIGKELGYGNQLFVLIEAPDGGTDATGEMEEMADRLTADMMSSGLFKQARCGLQ
Ga0187864_1003373253300018022PeatlandMMLRFMRWLGRLVIGHPGLVAGTALLLTLFLLANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEGEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNLARLFSWHFPSYALPGQT
Ga0187881_1025920713300018024PeatlandMMVRFMRGLGRLVIGHPGFVAGTALVLTLFLYANIHNLRTGTDLTGMFGSRDPQWRTVSQIGKELGYGNQLFVLVEAPQGDEGSSEAMEAAADRLTAEMSASGQFKQARCGLREEELLNLVRLYSMH
Ga0187885_1053712613300018025PeatlandMMVRFMRLVSRLVVGHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLVEAPENGADSTDEMEEMADRLTADMHSSGLFKQARCGLQEEELLNFVRFFTWNFPAFAQPGQSEE
Ga0187863_1010246213300018034PeatlandMMLRFMRWLGRLVIGHPGLVAGTALLLTLFLLANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEGEADSSEAMEAMADRLTTEMS
Ga0187863_1040835313300018034PeatlandMMVRFMRLVGWLVVGHPGLITALTLVLTLFLCTNIHNLRTSTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIETPEGGTDTTGEMEEMADRLTADMLTS
Ga0187883_1014754623300018037PeatlandMMVRFMRLVSRLVVGHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEGEKDTTGEMEEMADRLTA
Ga0187862_10001015273300018040PeatlandMMARFMRLVGRLVIGHPGMVTGVSLVLTIFLYANIHNLRTGTDLTDMFGNRDPQWQAASKLGKELGYGNQLFVLIEAQESGADATGAMEEMADRLTAEMRASGQFKQARCGLQE
Ga0187887_1001037193300018043PeatlandMMVRFMRLVGRLVVGHPGLVATFSLFLTLFLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPAGETDATGEMEEMADRLTADMMSSGLF
Ga0187858_1065513623300018057PeatlandMMIRFMRGLGRLVIAHPGLVVGLVFAMTLFLFANIHNLRTGTELTDMFGKGDPQWRAASQIGKELGYGNQLFVLVQAPKGDADSSEAMEAAADRLTAEMSASGLFKQERGGLREEELLNMARLFSWHFP
Ga0187772_1008847443300018085Tropical PeatlandMARCMRWAGSLVVRRPGLVTALSFVVTLWLYANIHNLRTGTDLADLFGTRDPQWRAASQIGKELGYGNQLFVLIEAPAGGTDDPAQMEDMADRLTDGMQASGLFMDARCGLQDEELL
Ga0187770_1164391623300018090Tropical PeatlandMMPRLLRGLGRMVIAYPGWVTVVSLALTVFFYANIHRLRTGTELTDLFGSHDPQWQKTSEIGKELGYGNQLFVVIEAPRGGDESSDAMEAMADRLIAEMNSSGLFKQARCGLSEEELLNLVRLCSWNY
Ga0066667_1087903423300018433Grasslands SoilMARCMRLIGRLVVGHPGLVVLLSAVVTLFLYSNIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIQAPAAGTDTTEQMEELADRLTADMQANGLIVDARC
Ga0187852_118888613300019082PeatlandMMIRFMRLLARLVVRHPGLVIAITLGLTFFLYSNVHNLRTGTDLTDLFGKRDPQWQAASQIGKELGYGNQLFVVIEAPQGEVDTTGEMEEMADRLTSDMLTSGLFKHARCGLQEEELLNMVRFFTWNFPAFVRPEQAEDLKRR
Ga0182028_149251633300019788FenMMIRFMRWLGRLVIGHPGLVRDGASADPVLFANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEDEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNLARLYSGTFPPTLCPAKRMRWSSG
Ga0210403_1026258113300020580SoilMMVRGVMVRFMRGVGSVVVGHPGLVVALSLVGTLLLCANIHNLRTSTDLTDLFGNRDPQWRAASQIGKDLGYGNQLFVLIEAPEVAAPEKEGTDATSEMEEMADRLTAEMTSSGSFLHARCGLQE
Ga0210399_1132678813300020581SoilMMVRFMRLLGRLVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLTDLFGDRDPQWRAASHIGKQLGYGNQLFVLIEVPDVETDTTGPMEEAADRLTAD
Ga0210395_1000339013300020582SoilMVRFMRLVGRLVVGHPGLVVALSLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAVSQIGEELGYGNQLFVLIEAPDKGPDATDEMEEKADRLTTEMLSSGLFLHARCGLQEEEL
Ga0210404_1016300423300021088SoilMMARLMRWVGGLVVDHPGLVTALSLVGTVLLFANIHNLRTGTDLTDLFGNHDPQWQAASQIGKDLGYGNQLFVLIEAPDGVDTTSEMEEMADHLTADMEASGLFLHARSGLQEDELLNMVRYFTWDFPSFVVPEQKEDLKRRLDPKQIHQTVRRAAV
Ga0210400_1060712113300021170SoilMMARLMRWVGGLVVDHPGLVTALSLVGTVLLFANIHNLRTGTDLTDLFGNHDPQWQAASQIGTDLGYGNQLFVLIEAPDGVDTTSEMEEMADHLTADMEASGLFLHARSGLQEEELL
Ga0210405_1048114423300021171SoilMVTAVSLVLTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIESPDSGTDATGEMEEIADRLTADMTTSGLFLHARCGLQEDELLNMVRLFTWSFPSFAQPDEMEALER
Ga0210393_1107419413300021401SoilMVRFMRLVGRLVVGHPGLVVALSLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAVSQIGEELGYGNQLFVLIEAPDKGPDATDEMEEKADRLTTEMLSS
Ga0210387_1083533713300021405SoilMMVRMMTVRMGVRLMRLVGRVVVGHPGLVIALSLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPAGEKDATGEMEETADRLTADMTNSGLFLH
Ga0210394_1174266613300021420SoilMMARLMRWVGGLVVDHPGLVTALSLVGTVLLFANIHNLRTGTDLTDLFGNHDPQWQAASQIGKDLGYGNQLFVLIEAPDRADTTSEMEEMADHLTADMASSGLFLHARCGLQEDELLNMVRYFTWNFP
Ga0210391_1079610713300021433SoilMMVRLMRLVGRLVVGHPGLVVALSVVGSLLLYANIHKLRTGTDLTDLFGNRDPQWRAVSQIGEELGYGNQLFVLIEAPDNGADATQEMEETADRLTADMLSSGLFLHARCG
Ga0210390_1155209213300021474SoilMARCMRWVGGLVVGHPGLVAALSLVITLLFYANIHNLRTGTDLTDLFGSRDPQWRAASQIGKELGYGNQLFVVIDASSIDASAISAPAEGTDITGQMEEMADRLTTDM
Ga0210410_1182042113300021479SoilMIRGVMVRCMRLVGRVVVGHPGLVVAASLVVSLFFYANIHNLRTGTDLTDLFGNRDPQWKAASQIGKELGYGNQLFVLVEAPEKEGTDATSEMEEMADRLTAD
Ga0224528_105448123300022861SoilMMVRFMRGLGRLVIGHPGLVAGLAFILTLFLYANIHNLRTGTELTDMFGARDPQWRAASQIGKELGYGNQLFVMVQAPEGEQDSSEAMEAMADRLTAEMSASGLFKQ
Ga0224526_105732313300022872SoilMMIRFMRWLGRLVIGHPGLVAGTALLLTLFLFANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEDEGDSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNMARLYSWHFPSY
Ga0224526_109056513300022872SoilMMTRFMRGMGRLVIGHPGLVAGLAFLMTLFLYANIHNLRTGTELTDMFGAHDPQWQAASQIGKELGYGNQLFVMVQAPAGEQDSSEAMEAMADRLTAE
Ga0224555_115949123300023088SoilMMARLMRAWGRLVIGHPGLLVGLSLAVTLFLYANIHNLRTETELTDMFGSHDPQWQAASQIGKELGYGNQLFIMVQAPQGDAGSSEADSSDAMEAMADRLTAQMAASGLFKQARCGLSQEELLNLV
Ga0224555_118774513300023088SoilMMIRFMRLLARLVVRHPGLVIAITLGLTFFLYSNIHNLRTGTDLTDLFGKRDPQWQAASQIGKELGYGNQLFVVIEAPQGEVDTTGEMEEMADRLTSDMLTSGLFKHARCGLQEEELLNMVRFFTWNFP
Ga0224559_104569033300023091SoilMMARLMRAWGRLVIGHPGLLAGLSLLLTVFLYANIHNLRTGTDLTDLFGSHDPQWQAASQIGKELGYGNQLFVMVEAPTGDADATAAMEETADRLTAQMASSGLFKQERSGLSQ
Ga0207664_1178506413300025929Agricultural SoilMMARCMRAVGGLVVRHPGLVVLLSLVVTVWLNANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFIVIDAPAGATDATDQMEEMADRLTADMKSSGLFVDARCGLSDEELLNMVRFFTWNFPS
Ga0207665_1072211723300025939Corn, Switchgrass And Miscanthus RhizosphereMMARCMRLVGGLVVRHPGLVVLLSLVVTVWLNANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIEAPPDGTDTTDQVEELADRLTADMHANHTTVTMRACRGER
Ga0209880_108858623300026271SoilMIVESTIVRFTRVLGRVVVDHPGLVTALSLLLTLFLFSNIHNLRTGTDLTDLFGERDPQWRAASQIGKELGYGNQLFVLIEAPETGSDTTGEMEEMAD
Ga0209152_1048537023300026325SoilMARCMRLIGRLVVGHPGLVVLLSAVVTVFLYANIHNLRTGTDLTDLFGNGDPQWRAASQIGKELGYGNQLFVVIEAPAGGTDPTDQMENLAGRLTSDMQASGLFVD
Ga0208042_111567613300027568Peatlands SoilMVRCMRWVGGLVVGHPGLVTALSLVVTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIEAPAAGTDVTGQMEEMADRLTADMQASG
Ga0209905_103613413300027634Thawing PermafrostMMVRFMRGLGRLVIGHPGLVAGLAFILTLFLYANIHNLRTGTELTDMFGARDPQWRAASQIGKELGYGNQLFVMVQAPEGEQDSSEAMEAMADRLTAEMSASGLFKQERSGLQ
Ga0209772_1023912023300027768Bog Forest SoilMMVRFMRLVGRLVVGHPGLVTAFSLIVSLFFSANIHKLRTATDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEIAAPEKAPEKEKEGPDANSTMEETA
Ga0209039_1007203023300027825Bog Forest SoilMMVRFMRGLGRLVIRHPGFVAGTALVLTLFLYANIHNLRAGTDLTGMFGSRDPQWRTVSQIGKELGYGNQLFVLVEAPQGDEGSSEAMEAAADRLTAEMSASGQFKQARCGLREKELLNLVRLYSMHFPSYALPGR
Ga0209169_1005348333300027879SoilMMVRFMRMVGRVVVGHPGLVTALSLVVTLLLYANIHKLRTGTDLTDLFGNRDPQWRTASQIGKDLGYGNQLFVLIEAPNGGTSGGADSTGQMEEMADRLTADMLT
Ga0209169_1010644833300027879SoilMMARGMRLLGGLVINHPGLVAALSLFITLGLYANIHNLRTGTDLTDLFGDRDPQLRAASQIGKELGYGNQLFVVIEAPEGTDTTDQMEEMADRLTADMQAGGLFVDARCGLQDEELLSLVRFFTWNFPAFARPDETEDLKHR
Ga0209415_1074346323300027905Peatlands SoilMMRRFMRGLGLLVINHPGLVVGVVLAITLFLCANVHNLRTGTDLTDMFGKGDAQWQAASQIGKELGYGNQLFIMVQAPDNGADSSEAMEAMADRLTAEISASGLF
Ga0265354_102830923300028016RhizosphereMMARFMRLVGGLVIGHPGLVTGLSLVVTLFFYSNIHNLRKGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIEAPAGEADVSGQMEDMADRLTSDMQASDLFVDARCGLQDEELLSMVR
Ga0255352_100497313300028082SoilMMVRFMRRLGQIVIGHPGMVAGTVLILTLFLYANIHNLRTETELTDMFGSRDPQWRAASQIGKELGYGNQLFVLVQAPEGDGDSSEAMEAMADRLTAEMSSSGLFKQERSGLQQEELLNLVRL
Ga0255356_101094353300028084SoilMMVRFMRGLGRMVIGHPGLVTGLMFLMTLFLYANIHNLRTGTELTDMFGAGDPQWRAASQIGKELGYGNQLFVMVQAPEGAEDSSEAMEAMADRLTAEMSASG
Ga0255356_103873213300028084SoilMMVRFMRGLGRMVIGHPGLVTGLMFLMTLFLYANIHNLRTGTELTDMFGGRDPQWRAASQIGKELGYGNQLFVMVQAPEGAEDSSEAMEAMADRLTAEMSASG
Ga0255348_109060913300028268SoilMMTRFMRGMGRLVIGHPGLVAGLAFLMTLFLYANIHNLRTGTELTDMFGAHDPQWQAASQIGKELGYGNQLFVMVQAPAGEQDSSEAMEAMADRLTAEMSASGLFKQERSGLQESELL
Ga0302267_1017765923300028745BogMMVRFMRGLGRLVIGHPGLVVGVVFVMTLFLFANIHNLRTGTDLTDMFGRGDPQWQAASQIGKELGYGNQLFVLVQAPRGDADSSEAMEAAADRLTTEMAASGLFKQTRSGLQ
Ga0302303_1014289813300028776PalsaMVRLMRRIGHLVVEHPGMVAGVSLCLTLFLYANIHNLRTGTDLTDMFGNRDPQWRAASQIGKELGYGNQLFVLIEAPQGNADNAAGMEDMADRLTSEMAASGLFKQERSGLQQEE
Ga0302201_1027489913300028785BogMMLRFLRGWGRIVIGHPGLVACLMLLLTLFLYANIHNLRTGTELTDLFGNRDPQWQAVSQIGKELGYGDQLFVVVQAPAGEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNMARLY
Ga0302189_1040852223300028788BogMMARLMRAWGRLVIGHPGLLAGLSLLLTVFLYANIHNLRTGTDLTDLFGSHDPQWQAASQIGKELGYGNQLFVMVEAPTGDADATAAMEETADRLTAQMASSGLFKQERSGLSQEELLNFVRLF
Ga0302227_1020678713300028795PalsaMMVRFMRLVGRLVVDHPGLVTAVSLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEREKGDADSTSEMEETADHLTADMLRSGLFLHARCG
Ga0302265_109616823300028859BogMMVRFMRGLGRMVIGHPGLVTGLMFLMTLFLYANIHNLRTGTELTDMFGARDPQWRAASQIGKELGYGNQLFVMVQAPEGEQDSSEAMEAMADRLTAEMSASGLFKQERSGLQASELLNLVR
Ga0302197_1006616933300028873BogMMVRFMRRLGGLVIGHPGLVAGVSLACTIFFFANIHRLRTGTELTDMFGKNDPQWRAASEIGKELGYGNQFFIMVQAPKGEADSSEAMEMMADRLTVEMSSSGLFKQARCGLQEEELLNLMRLFTWHFPSYTTP
Ga0308309_1020449043300028906SoilMDGSHSMMARFMRRVGGLVVNHPGLVVALSFVVTLGLYANIHNLRTGTDLTDLFGNQDPQWRAASQIGKELGYGNQLFVVIEAPTGETDATDQMEEMADRLTADMKASGLFVDARCGLQDDELLNIVRFFTWNFPAFVR
Ga0302200_1028452923300028909BogMMIRFMRWLGRLVIGHPGLVAGTALLLTLFLFANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFMVVQAPEDEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNM
Ga0311368_1066220413300029882PalsaVMVRLMRRLGHLVIEHPGMVAGLSLCLTLFLYVNIHNLRTGTDLTDMFGKHDPQWQAASQIGKELGYGNQLFVLIEAPKGDADNSGDMEDMADRLTSEMAASGLFKQARSGLQEDELLNFVRFYSWN
Ga0311327_1040133123300029883BogMMLRFMRGLGRLVIGHPGLVVGVVFAITLFLFANIHNLRTGTELTDMFGKGDPQWQAASQIGKELGYGNQLFVLVQAPRGDADSSEAMEATADRLTAEMAASGLFKQARSGLQEEELLNLVRLFSWHFSAYASPGQS
Ga0311369_1113473323300029910PalsaMMARFMRSVGRLIIAHPGIVAGFSLCMTLLLYANIHNLRTGTDLTDMFGKHDTQWQAVSQIGKELGYGNQLYILIEAPRGDADQSAAMEDMADRLSVE
Ga0311361_1032709933300029911BogMMARLMRAWGRLVIGHPGLLVGLSLAVTLFLYANIHNLRTETELTDMFGSHDPQWQAASQIGKELGYGNQLFIMVQAPQGDAGSSEADSSDAMEAMADRLTAQMAASGLFKQARCGLSQEELLNLVRL
Ga0311361_1133401913300029911BogMMRRMMYWVGRLVVDYPGLVVAASLGISLFLYSHIHNLRTDTDLTEMFGGNDPQWKAASEIGKELGYGNQLFVIVQAPSGAGDKSAEMEQLADRLTD
Ga0311358_1081677113300029915BogMMVRFMRGLGRLVIGHPGLVAGLAFILTLFLYANIHNLRTGTELTDMFGARDPQWRAASQIGKELGYGNQLFVMVQAPEGEQDSSEAMEAMADRLTAEMSASGLFKQERSGLQASELLNLVRLFTWNFPSYALP
Ga0311346_1080439713300029952BogMMVRFMRGLGRLVIGHPGLVAGVALALTVFLYANIHNLRTGTELTDMFGRDDPQWRAASQIGKELGYGNQLFVLVQAPRGDADTSEAMEAAADRLTAEMAASGLFKQARSGLQEEELLNLVRLFS
Ga0311343_1069071413300029953BogMMARLMRAWGRLVIGHPGLLAGLSLLLTVFLYANIHNLRTGTDLTDLFGSHDPQWQAASQIGKELGYGNQLFVMVEAPTGDADATAAMEETADRLTAQMASSGLFKQERSGLSQEELLNFVRLFSWN
Ga0311342_1062427323300029955BogMMIRFMRWLGRLVIGHPGLVAGTALLLTLFLFANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFMVVQAPEDEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLNMARLYSWHFPSY
Ga0302150_1005586413300029956BogMMVRFMRRLGQIVIGHPGMVAGTVLILTLFLYANIHNLRTETELTDMFGSRDPQWRAASQIGKELGYGNQLFVLVQAPEGDGDSSEAMEAMADQLTAEMSSSGLFKQERS
Ga0302277_117127123300029982BogMMVRFMRGLGRMVIGHPGLVTGLMFLMTLFLYANIHNLRTGTELTDMFGAGDPQWRAASQIGKELGYGNQLFVMVQAPEGAEDSSEAMEAMADRLTAE
Ga0302277_132471013300029982BogMMARLMRAWGRLVIGHPGLLAGLSLLLTVFLYANIHNLRTGTDLTDLFGSHDPQWQAASQIGKELGYGNQLFVMVEAPTGDADATAAMEETADRLTAQ
Ga0302280_107300313300029985FenMMVRFMRRLGQIVIGHPGMVAGTVLILTLFLYANIHNLRTETELTDMFGSRDPQWRAASQIGKELGYGNQLFVLVQAPEGDGDSSEAMEAMADRLTAEMSSSGLFKQERSGLQQEELLNLVRLFSWHFPSYTSRG
Ga0302276_1003455913300029992BogMMVRFMRGLGRLVIGHPGLVVGVVFVMTLFLFANIHNLRTGTDLTDMFGRGDPQWQAASQIGKELGYGNQLFVLVQAPRGDADTSEAMEAAADRLTTEMAASGLFKQTRSGLQEEELLNLVRLFS
Ga0302304_1022185113300029993PalsaMMVRFMRLVGRLVVDHPGLVTAVSLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEREKGDADSTSEMEETADHLTADMLRSGLFLHARCGLQEDEL
Ga0311338_1023800713300030007PalsaMMVRFMRMVGRVVVGHPGLVTALSLAGTLLLFANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPNAGTSGETDSAGQMEELADR
Ga0311338_1043503423300030007PalsaMMVRFMRLVGRVVVGHPGLVTAISLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPNAGTSEGADSTGQMEEMADRLTADMLAGGLFLHARSGLQDEELLNMVRFFTWNFP
Ga0302177_1060624313300030053PalsaMVRLMRRIGHLVIERPGMVAGISLCLTLFLYANIHNLRTGTDLTEMFGNRDPQWRAASQIGKELGYGNQLFVLIEAPQGNADNAAGMEDMADRLTSEMAASGL
Ga0310037_1006423633300030494Peatlands SoilMMVRFMRWVGGLVVGHPGLVTALSLVGTLLLYANIHNLRTGTDLTDLFGNHDPQWQAASQIGKELGYGNQLFVLIEAPEGTDTTGEMEEMADRLTADMASSGLFLHARSGL
Ga0311370_1020465443300030503PalsaVMVRLMRRLGHLVIEHPGMVAGFSLCLTLFLYANIHNLRTGTDLTDMFGKHDPQWSAASQIGKELGYGNQLFVLIEAPKGDADSSADMEGMADRLTAEMAASGLFKQERSGLQEDELLNFVRFYSWN
Ga0311370_1092972423300030503PalsaMVRFMRRIGHLVIEYPGIVAGFSLCLTLFLYANIHNLRTGTDLTDMFGNRDPQWRAASQIGKELGYGNQLFVLIEAPKGDADNSADMEGMADRLT
Ga0311370_1177453123300030503PalsaMVRLMRGVGRLVIHHPGIVVGLSLLLTLFFYANAHNLRTGTDLTDMFGSHDPQWQAASQIGKELGYGNQLFVMVEAPKGDDDKSAAMEEMADRLTADMTASGLFKQARCGVQEEELLNIVRFYTWNFPAFALPEQVDALKQRLDPQQIR
Ga0311370_1206271813300030503PalsaMVRLMRRIGHLVIEHPGMVAGLSLCLTLFLYLNIHNLRTGTDLTDMFGKHDPHWQAASQIGKELGYGNQLFVLIEAPKGDADSSGDMEGVADRLTSEMASSGLFKQA
Ga0302194_1043956113300030506BogMMVRFMRRLGGLVIGHPGLVAGVSLACTIFFFANIHRLRTGTELTDMFGKNDPQWRAASEIGKELGYGNQFFIMVQAPKGEADSSEAMEMMADRLTVEMSSSGLFKQARCGLQEEELLNLMRLFTW
Ga0311372_1037527243300030520PalsaMVRLMRRLGHLVIEHPGMVAGFSLCLTLFLYANIHNLRTGTDLTDMFGKHDPQWSAASQIGKELGYGNQLFVLIEAPKGDADSSADMEGMADRLTAEMAASGL
Ga0311372_1195677323300030520PalsaMVSMMRRIGRLVIDHPGLVAGISLCLTLFLYFNIHNLRTGTDLTDMFGNGDPQWQAASQIGKELGYGNQLFILIEAPKDDADSSSDMEAVADRLTGEMAASGLFKQERSG
Ga0311356_1060628323300030617PalsaMVRLMRRLGHLVIEHPGMVAGFSLCLTLFLYANIHNLRTGTDLTDMFGKHDPQWSAASQIGKELGYGNQLFVLIEAPKGDADSSADMEGMADRLTAEMAASGLFKQERSGLQEDE
Ga0311354_1023392613300030618PalsaMMVRFMRLVGRVVVGHPGLVTAISLVGTLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPNAGTSEGADSTGQMEEMADRLTADMLAGGLFLHA
Ga0302310_1071754713300030737PalsaMVRLMRGVGRLVIHHPGIVVGLSLLLTLFFYANAHNLRTGTDLTDMFGGHDPQWQAASQIGKELGYGNQLFVMVEAPKGDGDNSAAMEEMADRLTADMNASGLFKQARCGVQEEELLNIVRFYTWNFPAFAQPEQVEELK
Ga0265745_100504313300030759SoilMMVRGMRGVGRVVVGHPGLVTALSLVVSVLLYANIHNLRTGTDLADLFGNRDPQWRAASQIGKELGYGNQLFVLIDAPAAGTDVTGQMEEMADRLTADMQASGLFLDARCGLQDEELLNLVRF
Ga0265765_100051243300030879SoilMMVRCMRWVGGLVVGHPGLVTALSLVVTLLLYANIHNLRTGTDLADLFGNRDPQWRAASQIGKELGYGNQLFVLIDAPAAGTDVTGQMEEMADRLTADMQASGLFLDARCGLQDEELLNLVRFF
Ga0265754_100808423300031040SoilMMVRCMRGVGRVVVGHPGLVTALSLVVSLLLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVLIEAPEASEAAEGPEGRSAAETDSTGQMEEFADRLTADMLTSGLFLHARCGFEDEEL
Ga0170824_10421800313300031231Forest SoilMMVRFMRLVGGLVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLTDLFGDRDPQWRAASQIGKELGYGNQLFVLIEVPDAETDTTGPMEEAADRLTADMLTSGLFLHARCGLQEEELLNILR
Ga0302140_1109853913300031261BogMMHRFMRGLGRMVINHPGLVAGAVLLMTLFLYANIHNLRTGTELTDLFGSHDPQWQAASQIGKELGYGNQLFVMLQAPENAADSTETMEEAADRITAEMTASGLFKQARCGLQEEELLNLVRL
Ga0302320_1154681023300031524BogMMIRFMRLLASLVVRHPGLVIAITLVLTFFLYANIHNLRAGTDLTDLFGKRDPQWQAASQIGKELGYGNQLFVLIEAPQGGMDTTGEMEEMADRLTSDMLTSGLF
Ga0302320_1161488723300031524BogMMARLMRAWGRLVIGHPGLLAGLSLLLTVFLYANIHNLRTGTDLTDLFGSHDPQWQAASQIGKELGYGNQLFVMVEAPTGDADATAAMEETADRLTAQMASSGLFKQERSGLSQEELLNF
Ga0310686_10357472223300031708SoilMARCMRRVGGLVVNHPGLVVALSFVVTLGLYANIHNLRTGTDLTDLFGNQDPQWRTAGQIGKELGYGNQLFVVIETPAQETDATDQMEEMADHLTADMQASGLFVDARCGLQDEELLNIVRFFTWNFPAFARPDQTEDFKRRQIGRASCRERVLLGV
Ga0307474_1082118023300031718Hardwood Forest SoilMMARCMRLVGGLVVNHPGLVVALSLVGTLCLYANIHNLRTGTDLTDLFGNRDPQWRAASQIGKELGYGNQLFVVIEASTSKAPVSEAPAGGADATDQMEEMADRLTAEMKGSGLFVDARCGLQDEELLNIVRFFTWNFPAFVRPDQTEDLKRRLDPKQIHQNV
Ga0307477_1017826323300031753Hardwood Forest SoilMMVRFMRLVGGLVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLIDLFGDRDPQWRAASQIGKELGYGNQLFVLIEVPDGETDTTGPMEDAADRLTADMLNSGLFRHARCGLQEEELLNIVRYF
Ga0307475_1081561123300031754Hardwood Forest SoilMMVRFMRLVGGVVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLTDLFGDRDPQWRAASQIGKELGYGNQLFVLIEVPNGETDATGPMEDAADRLTADMLNSGLFRHARCGLQEEELLNIVRYFTWNF
Ga0307478_1022500623300031823Hardwood Forest SoilMMVRFMRLVGGLVVNHPWLVTAISLVVTLLLYANIHNLRTGTDLIDLFGDRDPQWRAASQIGKELGYGNQLFVLIEVPDGETDTTGPMEDAADRLTADMLNSGLFRHA
Ga0307478_1160824313300031823Hardwood Forest SoilMMTRLMRHVGQLVVGHPGLVTALSLVGTLLLYANIHNLRTGTDLTDLFGSRDPQWRAVSQIGEELGYGNQLFVLIEAPDNGVDATQEMEETADRLSSDMVSSGLFLHA
Ga0302315_1025921423300031837PalsaMVRLMRRIGHLVIERPGMVAGISLCLTLFLYANIHNLRTGTDLTEMFGNRDPQWRAASQIGKELGYGNQLFVLIEAPQGNADNAAGMEDMADRLTSEMAASGLFKQERSGLQQEELLNFVRLY
Ga0302315_1069838113300031837PalsaMVRLMRGVGRLVIHHPGIVVGLSLLLTLFFYANAHNLRTGTDLTDMFGSHDPQWQAASQIGKELGYGNQLFVMVEAPKGDDDKSAAMEEMADRLTADMTASGLFKQARCGVQEEELLNIVRFYTWNLAAFAQPEQVDELKQRLDPQ
Ga0335085_1158764723300032770SoilMMARCMRFVGGLVVNHPGFVVALSLVVTLGLYANIHNLRTGTDLTDLFGNSDPQWRAASQIGKELGYGNQLFLVIEAPSGGADATDQMEEVADRLTAEMQASGLFVDARSGLRDEELLNLVRFFTWNFPSLATPDQTEELKRR
Ga0335079_1118552213300032783SoilMRVRSMRLVGGLVVGHPWMVTAVSLLVTLFLYANIHNLRTATDLTDLFGDRDPQWRVASQIGKELGYGNQLFVLIKAPDGETDMTGHMEEAADRLTTEMQA
Ga0335081_1044184943300032892SoilMARGMRLVGRVVVGHPGLVTALSAVVTLLLYANIHNLRTGTNLADLFGNRDPQWRAASQIGKELGYGNQLFVMIEAPAAAPAIETPTAETDITSQMEDVADRLTADMKASGLFVDARSG
Ga0326727_1117468823300033405Peat SoilMMARFMRLVGRLVIGHPGMVTGLALVLTLFLYANIHNLRASSDLTDLFGSRDPQWQAASQIGNELGYGNQHFVLIEAPEDGADATSEMEEMADRLTAEMQASGLFKQARCGLQEDELLNIVRYFTWNFPAFALP
Ga0371490_102179913300033561Peat SoilMMVRFMRSVARLVVDHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGSRDPQWRAASQIGKELGYGNQLFVLIEAPEGATDTTGEMEEMADRLTADMLSSGLFKQARCGLQEEELLNMVRFFTWNFPAFVLPEQTEDLRRRLNPQQ
Ga0371489_0162748_841_11973300033755Peat SoilMMVRFMRSVARLVVDHPGLVTALSLVLTLFLYANIHNLRTGTDLTDLFGSRDPQWRAASQIGKELGYGNQLFVLIEAPEGATDTTGEMEEMADRLTADMLSSGLFKQARCGLQEEELLN
Ga0334837_115824_3_3593300033823SoilMMIRFMRWLGRLVIGHPGLVAGTALLLTLFLFANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFMVVQAPEDEADSSEAMEAMADRLTTEMSSSGLFKQERSGLQEEELLN
Ga0334848_060004_2_3673300033827SoilMMVRFMRWLGQIVIGHPGLVAGVVLVLTLFLYANIHNLRTETELTDMFGSRDPQWRAASQIGKELGYGNQLFVLVQAPEGDADSSEAMEAMADRLTAEMSSSGLFKQERSGLQQEELLNLVR
Ga0371487_0380796_285_6143300033982Peat SoilMMLRFMRWLGRLVIGHPGLVAGTALLLTLFLLANIHNLRTGTELTDLFGSRDPQWQAASQIGKELGYGDQLFVVVQAPEGEADSSEAMEAMADRLTTEMSSSGLFKQERS
Ga0371488_0105465_2_3103300033983Peat SoilMMVRFMRGLGRLVIGHPGLVAGSMFVMTLFLFANIHNLRTGTDLTDMFGRGDPQWQAASQIGKELGYGNQLFVLVQAPRGDADSSDAMEAAADRLTAEMSASG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.