| Basic Information | |
|---|---|
| Family ID | F041895 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 41 residues |
| Representative Sequence | KDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.050 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.755 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.220 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.862 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF01408 | GFO_IDH_MocA | 47.17 |
| PF02894 | GFO_IDH_MocA_C | 37.11 |
| PF13520 | AA_permease_2 | 3.77 |
| PF00532 | Peripla_BP_1 | 3.14 |
| PF08240 | ADH_N | 1.26 |
| PF00324 | AA_permease | 1.26 |
| PF07969 | Amidohydro_3 | 1.26 |
| PF13432 | TPR_16 | 0.63 |
| PF13181 | TPR_8 | 0.63 |
| PF02775 | TPP_enzyme_C | 0.63 |
| PF13377 | Peripla_BP_3 | 0.63 |
| PF00356 | LacI | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 37.11 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 1.26 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 1.26 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 1.26 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 1.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.05 % |
| Unclassified | root | N/A | 11.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10003947 | All Organisms → cellular organisms → Bacteria | 4316 | Open in IMG/M |
| 3300004080|Ga0062385_10197808 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300004633|Ga0066395_10886310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300004635|Ga0062388_100063109 | All Organisms → cellular organisms → Bacteria | 2485 | Open in IMG/M |
| 3300004635|Ga0062388_100368465 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300005471|Ga0070698_101975521 | Not Available | 536 | Open in IMG/M |
| 3300005533|Ga0070734_10389696 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005536|Ga0070697_100265844 | Not Available | 1469 | Open in IMG/M |
| 3300005537|Ga0070730_10379223 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300005541|Ga0070733_10017672 | All Organisms → cellular organisms → Bacteria | 4453 | Open in IMG/M |
| 3300005564|Ga0070664_102148897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300005610|Ga0070763_10423663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300005921|Ga0070766_10159858 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300005921|Ga0070766_10678216 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005921|Ga0070766_10988001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300006050|Ga0075028_100084471 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300006059|Ga0075017_101027549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300006176|Ga0070765_100205039 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300006903|Ga0075426_10395048 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006914|Ga0075436_101185013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300009088|Ga0099830_10858448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300009089|Ga0099828_10348239 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300009162|Ga0075423_12600946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300009624|Ga0116105_1175071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300009638|Ga0116113_1074714 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300009792|Ga0126374_11695899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300010043|Ga0126380_12243411 | Not Available | 506 | Open in IMG/M |
| 3300010048|Ga0126373_12595573 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010048|Ga0126373_13128890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300010360|Ga0126372_11651027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300010361|Ga0126378_13445212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300010376|Ga0126381_104005063 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010376|Ga0126381_104629861 | Not Available | 530 | Open in IMG/M |
| 3300010398|Ga0126383_10621930 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300010401|Ga0134121_11981320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300011085|Ga0138581_1075545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300011269|Ga0137392_11050617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300011269|Ga0137392_11520619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012917|Ga0137395_10899942 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012918|Ga0137396_10520633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300013297|Ga0157378_10933312 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300014201|Ga0181537_10973803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300014501|Ga0182024_12745126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300014655|Ga0181516_10764632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300014657|Ga0181522_10237358 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300016270|Ga0182036_10357206 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300016319|Ga0182033_10164186 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300016319|Ga0182033_11384081 | Not Available | 633 | Open in IMG/M |
| 3300016319|Ga0182033_11706291 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300016371|Ga0182034_10182260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1609 | Open in IMG/M |
| 3300017948|Ga0187847_10032345 | All Organisms → cellular organisms → Bacteria | 3102 | Open in IMG/M |
| 3300017955|Ga0187817_11092283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300017972|Ga0187781_10276240 | Not Available | 1191 | Open in IMG/M |
| 3300017972|Ga0187781_10361841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300017973|Ga0187780_10617456 | Not Available | 779 | Open in IMG/M |
| 3300017975|Ga0187782_10426959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300017975|Ga0187782_10795245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300018006|Ga0187804_10031571 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300018007|Ga0187805_10623747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300018009|Ga0187884_10099584 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300018058|Ga0187766_10957162 | Not Available | 607 | Open in IMG/M |
| 3300018062|Ga0187784_11619408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300020579|Ga0210407_10578290 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300020579|Ga0210407_11010384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300020580|Ga0210403_11140362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300020583|Ga0210401_10366609 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300020583|Ga0210401_10658420 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300021046|Ga0215015_11018540 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300021170|Ga0210400_10103019 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300021171|Ga0210405_10960098 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021178|Ga0210408_11342380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300021403|Ga0210397_10445446 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300021405|Ga0210387_11828755 | Not Available | 511 | Open in IMG/M |
| 3300021407|Ga0210383_10259539 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300021420|Ga0210394_11210039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300021432|Ga0210384_10216927 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300021432|Ga0210384_10384522 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300021474|Ga0210390_11372534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300021475|Ga0210392_10452220 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300021477|Ga0210398_11489311 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021479|Ga0210410_10247510 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300021559|Ga0210409_10077495 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300021559|Ga0210409_10634061 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300021559|Ga0210409_11498271 | Not Available | 550 | Open in IMG/M |
| 3300021560|Ga0126371_11908571 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300024225|Ga0224572_1021680 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300024227|Ga0228598_1031572 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300024249|Ga0247676_1004957 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300025906|Ga0207699_10375187 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300025939|Ga0207665_10418524 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300026467|Ga0257154_1000662 | All Organisms → cellular organisms → Bacteria | 3560 | Open in IMG/M |
| 3300026538|Ga0209056_10704443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300027045|Ga0207726_1005783 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2232 | Open in IMG/M |
| 3300027516|Ga0207761_1082652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300027548|Ga0209523_1017065 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300027605|Ga0209329_1113545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300027667|Ga0209009_1159319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300027703|Ga0207862_1198397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300027727|Ga0209328_10167426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300027765|Ga0209073_10352771 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027795|Ga0209139_10020016 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300027824|Ga0209040_10377475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300027853|Ga0209274_10063570 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300027855|Ga0209693_10000619 | All Organisms → cellular organisms → Bacteria | 14562 | Open in IMG/M |
| 3300027855|Ga0209693_10612662 | Not Available | 513 | Open in IMG/M |
| 3300027867|Ga0209167_10146241 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300027875|Ga0209283_10709745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300027884|Ga0209275_10681189 | Not Available | 592 | Open in IMG/M |
| 3300028806|Ga0302221_10450123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300028863|Ga0302218_10243199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300028906|Ga0308309_11257361 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300029922|Ga0311363_10255861 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300030007|Ga0311338_10661781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1063 | Open in IMG/M |
| 3300030020|Ga0311344_10745951 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300030041|Ga0302274_10126046 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300030043|Ga0302306_10073689 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300031028|Ga0302180_10354528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300031525|Ga0302326_11750652 | Not Available | 817 | Open in IMG/M |
| 3300031543|Ga0318516_10341081 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031708|Ga0310686_109721463 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300031720|Ga0307469_10396920 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300031720|Ga0307469_10425017 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300031720|Ga0307469_10990846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300031740|Ga0307468_100760742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300031753|Ga0307477_10943158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300031754|Ga0307475_10065047 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300031754|Ga0307475_10413863 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300031763|Ga0318537_10333071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300031769|Ga0318526_10468168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300031778|Ga0318498_10346362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300031781|Ga0318547_10250462 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300031820|Ga0307473_10408144 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300031823|Ga0307478_10190867 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300031823|Ga0307478_10764394 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300031846|Ga0318512_10650616 | Not Available | 539 | Open in IMG/M |
| 3300031879|Ga0306919_10683224 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031890|Ga0306925_10963526 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031897|Ga0318520_10660643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300031910|Ga0306923_10929520 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031910|Ga0306923_11002347 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300031946|Ga0310910_11460456 | Not Available | 525 | Open in IMG/M |
| 3300031959|Ga0318530_10111446 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300031962|Ga0307479_10238608 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300031962|Ga0307479_11476066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300031962|Ga0307479_11784036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300032001|Ga0306922_10862671 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300032174|Ga0307470_11522846 | Not Available | 557 | Open in IMG/M |
| 3300032180|Ga0307471_100482509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1385 | Open in IMG/M |
| 3300032180|Ga0307471_103352959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300032261|Ga0306920_101879583 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300032261|Ga0306920_103593733 | Not Available | 571 | Open in IMG/M |
| 3300032783|Ga0335079_10584853 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300032805|Ga0335078_11732842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300032898|Ga0335072_11795276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300033134|Ga0335073_10043092 | All Organisms → cellular organisms → Bacteria | 6089 | Open in IMG/M |
| 3300033158|Ga0335077_11936795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300034124|Ga0370483_0077873 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.14% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.26% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.26% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.63% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.63% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_100039475 | 3300003505 | Forest Soil | VGSIADVNSIADAIEKVLGASEELRGLDHKAIRNQRLGRADRES* |
| Ga0062385_101978081 | 3300004080 | Bog Forest Soil | NIDSIADGIFKVLENIEELRGLEHRAIKAQGMSRADRES* |
| Ga0062389_1014262532 | 3300004092 | Bog Forest Soil | QLFLGSTLDVDAIADAMQKVLDNLEELRGLDHKAIRNQKLGRADRES* |
| Ga0066395_108863101 | 3300004633 | Tropical Forest Soil | LFLSERKEIDTILEAIFKALDNIDELRGLEHQAIRNQGLSRADRES* |
| Ga0062388_1000631091 | 3300004635 | Bog Forest Soil | QDIDAIADAIHKVLENLEELRGLDHKAIRNQKLGRADRES* |
| Ga0062388_1003684652 | 3300004635 | Bog Forest Soil | GTTSDVDAIADAIDKVLANIEELRGLDHKAIRNQKLGRADRES* |
| Ga0070698_1019755212 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LFLGSKEDIDTIVEAIFKTLENIEELRGLEHSAIRNQGLSRADRES* |
| Ga0070734_103896961 | 3300005533 | Surface Soil | AIANAIHKVLENIEELRGLEHKAIRNQGLSRADRES* |
| Ga0070697_1002658441 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SKEDIDTIVEAIFKTLENIEELRGLEHSAIRNQGLSRADRES* |
| Ga0070730_103792232 | 3300005537 | Surface Soil | HEAIWFPHYLFLGDKKEIDTIIDAIFKTLDNIEELRGLEHPAVRAQGQSRADRES* |
| Ga0070733_100176721 | 3300005541 | Surface Soil | VDSIADAIFKVLENIEELRGLEHRAIKAQTQSRADRES* |
| Ga0070664_1021488972 | 3300005564 | Corn Rhizosphere | DSMAAAVFKVFENAGELRGLEHPAIRSQQLSRADRES* |
| Ga0070763_104236632 | 3300005610 | Soil | TKDVDDIADAIHKVLENVEELRELDHKAIRNQRLGRADRES* |
| Ga0070766_101598583 | 3300005921 | Soil | ADALEKVLGASEELRGLDHKAIRNQRLGRADRES* |
| Ga0070766_106782162 | 3300005921 | Soil | ADAIEKVLANIEDLRGLDHAAIRNQRLSRADRES* |
| Ga0070766_109880011 | 3300005921 | Soil | HFLGSSADVDAIAEAIHKVLTNIEELRALDHKAIRNQRLGRADRES* |
| Ga0075028_1000844713 | 3300006050 | Watersheds | TKDVDDIADAIEKILANIEELRGLDHKAIRNQKLGRADRES* |
| Ga0075017_1010275491 | 3300006059 | Watersheds | IADAIHKVLANIEELRSLDHKAIRNQRLSRADRES* |
| Ga0070765_1002050393 | 3300006176 | Soil | VDDIADAIEKVLANIEELRGLDHKAIRNQKLGRADRES* |
| Ga0075426_103950481 | 3300006903 | Populus Rhizosphere | IWFPHYLFLGDKKEIDTIIDAILKTLKNIEELSGLEHPAIRAQGQSRADRES* |
| Ga0075436_1011850132 | 3300006914 | Populus Rhizosphere | HYLFLSDRKDIDTIIDAILKTFESIEELRGLDHPAIRAQKLSRADRES* |
| Ga0099830_108584482 | 3300009088 | Vadose Zone Soil | DVDAMANAIHKILENIEELRGLDHKAIRNQKLGRADRES* |
| Ga0099828_103482391 | 3300009089 | Vadose Zone Soil | EEDIDTIADAILKALENIEELRSLEHPAIRSQGQSRADRES* |
| Ga0075423_126009462 | 3300009162 | Populus Rhizosphere | EAIWFPHYLFLGDKKEIDTIADAILKVLRNIEELRGLEHPAIRAQGQSRADRES* |
| Ga0116105_11750711 | 3300009624 | Peatland | IVEAMHKVLKNIESLRDLDHKAIRNQRLSRADRES* |
| Ga0116113_10747142 | 3300009638 | Peatland | LVSSADVDAIVDAISKVLANIEELRGLDHKAIRNQKLGRADRES* |
| Ga0126374_116958992 | 3300009792 | Tropical Forest Soil | VSDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES* |
| Ga0126380_122434112 | 3300010043 | Tropical Forest Soil | ITQDTDAIADAVHKVLENLEELRNLDHKAIRNQKLSRADRES* |
| Ga0126373_125955731 | 3300010048 | Tropical Forest Soil | DIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES* |
| Ga0126373_131288901 | 3300010048 | Tropical Forest Soil | EDTDTIADAIEKVLANIEELRGLDHKAIQNQRLGRADRES* |
| Ga0126372_116510272 | 3300010360 | Tropical Forest Soil | SAKDIDDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES* |
| Ga0126378_134452122 | 3300010361 | Tropical Forest Soil | GIDSIADAIHKVLENIDELRGLEHRAIKNQNLSRADRES* |
| Ga0126381_1040050631 | 3300010376 | Tropical Forest Soil | TTKDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES* |
| Ga0126381_1046298611 | 3300010376 | Tropical Forest Soil | GPSKDVDDIAEAIHKVLENIKELRLLDHKAIRNQRLGRADRES* |
| Ga0126383_106219301 | 3300010398 | Tropical Forest Soil | LFLSDRKNIDTITDAIFKIFENIEELRGLEHPAIRAQRLSRADRES* |
| Ga0134121_119813202 | 3300010401 | Terrestrial Soil | PHYLFLGDKKEIDTIADAIFKVLKNIEELRGLEHPAIRAQGQSRADRES* |
| Ga0138581_10755451 | 3300011085 | Peatlands Soil | IDSIVEAIFKALEHIEDLRGLEHQAIKNQGLSRADRES* |
| Ga0137392_110506171 | 3300011269 | Vadose Zone Soil | IDTIIDAIFKTLDNIEELRGLEHPAVRSQGMSRADRES* |
| Ga0137392_115206191 | 3300011269 | Vadose Zone Soil | LGDKKSIDSIAEAIFKVLENIEELRGLEHRAIKAQGLSRADRES* |
| Ga0137395_108999421 | 3300012917 | Vadose Zone Soil | GTAQDVDAIAVAIQKVLSNIEELRGLDHKAIRNQRLGRADRES* |
| Ga0137396_105206332 | 3300012918 | Vadose Zone Soil | LFLGGKANIDSIAEAIFKVLENIEELRGLEHRAIKSQGLSRADRES* |
| Ga0157378_109333122 | 3300013297 | Miscanthus Rhizosphere | IVDAIFKTLDNIEELRGLEHPAIRSQGLSRADRES* |
| Ga0181537_109738031 | 3300014201 | Bog | IVNAIHKVIENIEELRGLDHKAIRNQKLGRADRES* |
| Ga0182024_127451262 | 3300014501 | Permafrost | PRSDIDAIVEAMHKVLKNIESLRDLDHKAIRNQRLSRADRES* |
| Ga0181516_107646322 | 3300014655 | Bog | DAIANAIHKVLENIEELRGLDHKAIRNQKLGRADRES* |
| Ga0181522_102373582 | 3300014657 | Bog | VDDIANAIHKVLANLDELRGLDHKAIRNQKLGRADRES* |
| Ga0182036_103572062 | 3300016270 | Soil | DSIVDAIHKVLENFEEVRGLEHKAIKAQGQSRADRES |
| Ga0182033_101641861 | 3300016319 | Soil | GTTKDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0182033_113840811 | 3300016319 | Soil | HFLGPKKDVDDIVDAIHKVLENIEDLRNIDHKAIRNQRLGRADRES |
| Ga0182033_117062912 | 3300016319 | Soil | FLGTAKDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0182034_101822603 | 3300016371 | Soil | GTAKDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0187847_100323451 | 3300017948 | Peatland | KDVDAIADGIHKVLEHIEELRNLDHKAIRNQRLSRADRES |
| Ga0187817_110922831 | 3300017955 | Freshwater Sediment | DAIADAIHKVLENIEELCNLDHKAIRNQRLSRADRES |
| Ga0187781_102762401 | 3300017972 | Tropical Peatland | VDAIANGIHKVLENIEELRGLDHKSIRNQRLSRADRES |
| Ga0187781_103618412 | 3300017972 | Tropical Peatland | RDVDSIADAIHKVLENREELRGLDHKAIRNQRLSRADRES |
| Ga0187780_106174561 | 3300017973 | Tropical Peatland | IVEAIFKALDNIEELRGLEHQAIKNQGLSRADRES |
| Ga0187782_104269592 | 3300017975 | Tropical Peatland | SIADAIHKVLENREELRGLDHKAIRNQRLSRADRES |
| Ga0187782_107952452 | 3300017975 | Tropical Peatland | GGAEDAESIANAIHKVLENCEELRGLDHKAIRNQRLGRADRES |
| Ga0187804_100315713 | 3300018006 | Freshwater Sediment | RKDVDAIADAIHKVLENIEELRSLDHKAIRNQRLSRADRES |
| Ga0187805_106237471 | 3300018007 | Freshwater Sediment | HYLFLGGPEDAESVANAIHKVLDNCEELRGLDHKAIRNQKLGRADRES |
| Ga0187884_100995842 | 3300018009 | Peatland | SSADVDAIVDAISKVLANIEELRGLDHKAIRNQKLGRADRES |
| Ga0187766_109571622 | 3300018058 | Tropical Peatland | ADIDSIVEAIFKALDNIEELRGLEHQAIKNQGLSRADRES |
| Ga0187784_116194081 | 3300018062 | Tropical Peatland | DAIANAIHKVLDNIEELRGLEHKAIRNQGLSRADRES |
| Ga0210407_105782901 | 3300020579 | Soil | VEAIADAIHKVLTNIEELGGLDHKAIRNQKLGRADRES |
| Ga0210407_110103842 | 3300020579 | Soil | ANIDSIADGIFKVLENLEELRGLEHRAIKAQGMSRADRES |
| Ga0210403_111403621 | 3300020580 | Soil | FLGSKANIDSIVDGIFKVLENIEEVRGLEHRAIKAQGMSRADRES |
| Ga0210401_103666091 | 3300020583 | Soil | AVWFPHQLFLGGKENVDSVADAIAKVLENIEELRGLEHRAIKAQGMSRADRES |
| Ga0210401_106584202 | 3300020583 | Soil | TKDVDDITDAIEKVLTNIEELRGLDHKAIRNQKLGRADRES |
| Ga0215015_110185401 | 3300021046 | Soil | HLFLGGKANIDSIAEAIFKVLENIEELRGLEHRAIKSQGLSRADRES |
| Ga0210400_101030193 | 3300021170 | Soil | FLGGKANIDSIANGIFKVLENIEELRGLEHRAIKAQGMSRADRES |
| Ga0210405_109600982 | 3300021171 | Soil | KDVDDIADAIHKVLENVEELRGLDHKAIRNQRLGRADRES |
| Ga0210408_113423802 | 3300021178 | Soil | AYHEAVWFPHYLFLGDKKEIDTIVEAIFKTLDNIEELRGLEHPAIRSQGLSRADRES |
| Ga0210397_104454462 | 3300021403 | Soil | SSEDTDAIVNGIHKVLENLEELRGLDHKAIRNQKLGRADRES |
| Ga0210387_118287551 | 3300021405 | Soil | VDSIADAIEKVLGASEELRGLDHKAIRNQRLGRADRES |
| Ga0210383_102595393 | 3300021407 | Soil | VDAIADGIHKVLENIEEVRTVDHKAIRNQRLSRADRES |
| Ga0210394_112100391 | 3300021420 | Soil | VDAIADAIHKVLANIEELRGLDHKTIRNQKLGRADRES |
| Ga0210384_102169271 | 3300021432 | Soil | GSSADVDAIADAIHKVLANIEELRGLDHKTIRNQKLGRADRES |
| Ga0210384_103845222 | 3300021432 | Soil | DAIAEAIHKVLTNIEELRALDHKAIRNQRLGRADRES |
| Ga0210390_113725342 | 3300021474 | Soil | DVDSIVDAISKVIENIEELRGLEHTAIKNQGLSRADRES |
| Ga0210392_104522202 | 3300021475 | Soil | AIADAIHKVLENVEELRALDHKAIRNQKLGRADRES |
| Ga0210398_114893111 | 3300021477 | Soil | AIADAIGKVLANIEELRGLDHKAIRNQKLGRADRES |
| Ga0210410_102475103 | 3300021479 | Soil | RDVDAIADAIHKVLGGIEELRGLDHKAIRNQRLGRADRES |
| Ga0210409_100774951 | 3300021559 | Soil | GTTKDVDDIADAIHKVLENVEELRGLDHKAIRNQRLGRADRES |
| Ga0210409_106340612 | 3300021559 | Soil | KEDVDSIVNAIVKVLENIEEVRGLEHRAIKAQGLSRADRES |
| Ga0210409_114982712 | 3300021559 | Soil | IADAIHKVLENVEELRGLDHKAIRNQRLGRADRES |
| Ga0126371_119085711 | 3300021560 | Tropical Forest Soil | DIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0224572_10216801 | 3300024225 | Rhizosphere | DVDWIADAIEKVLGASEELRGLDHKAIRNQRLGRADRES |
| Ga0228598_10315721 | 3300024227 | Rhizosphere | ADVDSIADAIEKVLSASEELRGLDHKAIRNQRLGRADRES |
| Ga0247676_10049573 | 3300024249 | Soil | AAYHEAIWFPHYLFLGDKKEIDTIIDAIFKTLDNIEELRGLEHSAIRAQGQSRADRES |
| Ga0207699_103751872 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ADVDSIVNAMCKVMENIEELRGLEHPAVKAQGQSRADRES |
| Ga0207665_104185241 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | WFPHYLFLGDKKEIDSIIDAIFKAMENIEELRGLDHPAIRSQSLSRADRES |
| Ga0257154_10006625 | 3300026467 | Soil | IADAIEKVLGAIEELRDLDHKAIRNQKLGRADRES |
| Ga0209056_107044432 | 3300026538 | Soil | DTIVDAILKTLKNIEELSGLEHPAIRAQGQSRADRES |
| Ga0207726_10057831 | 3300027045 | Tropical Forest Soil | KDVNDIADAIHKVLENIEELRDLDHKAIRNQRLGRADRES |
| Ga0207761_10826522 | 3300027516 | Tropical Forest Soil | TEKDVDDIVSAIDKVTAGIEQLRGLDHKAIRNQRLSRADRES |
| Ga0209523_10170651 | 3300027548 | Forest Soil | TQDVDAIADAIHKVLGGIEELRGLDHKAIRNQRLGRADRES |
| Ga0209329_11135451 | 3300027605 | Forest Soil | RDVDVIADAIHKVLGGIEELRGLDHKAIRNQRLGRADRES |
| Ga0209009_11593192 | 3300027667 | Forest Soil | FLGGKENVDSIVDAIKKVLENIEELRGLDHRAIKDQGLSRADRES |
| Ga0207862_11983972 | 3300027703 | Tropical Forest Soil | AFLGTEKDVDDIVSAIDKVTAGIEQLRGLDHKAIRNQRLSRADRES |
| Ga0209328_101674261 | 3300027727 | Forest Soil | DKKSIDSIADAIHKVLENIEELRGLEHRAIKNQGLSRADRES |
| Ga0209073_103527712 | 3300027765 | Agricultural Soil | IADAIHKVLENIDELAGLDHKAIRNQKLSRADRES |
| Ga0209139_100200163 | 3300027795 | Bog Forest Soil | IADVDSIADAIEKVLGASEELRGLDHKAIRNQKLGRADRES |
| Ga0209040_103774752 | 3300027824 | Bog Forest Soil | FLGSVKDVDAIADAIHKVLANIEGLRSLDHKAIRNQRLSRADRES |
| Ga0209274_100635703 | 3300027853 | Soil | AIADAIHKVLTNIEELRGVDHKAIRNQKLGRADRES |
| Ga0209693_1000061911 | 3300027855 | Soil | KANIDSIADGICKVLENIEELRGLEHRAIKAQGMSRADRES |
| Ga0209693_106126622 | 3300027855 | Soil | SAADVDSIADAIEKVLGASKESRGLDHKAIRNQRLGRADRES |
| Ga0209167_101462412 | 3300027867 | Surface Soil | VDSIADAIFKVLENIEELRGLEHRAIKAQTQSRADRES |
| Ga0209283_107097451 | 3300027875 | Vadose Zone Soil | HEAIWFPHYLFLGDKKEIDTIADAIFKVLNNIEELRGLEHPAIRSQGQSRADRES |
| Ga0209275_106811891 | 3300027884 | Soil | IFLGPRSDIDSIVEAMQKVLKNIENLRGLDHKAIRNQRLSRADRES |
| Ga0302221_104501232 | 3300028806 | Palsa | IADAIHKVLAASEELRGLDHKAIRNQKLGRADRES |
| Ga0302218_102431991 | 3300028863 | Palsa | TADVEAIADAIHKVLAASEELRGLDHKAIRNQKLGRADRES |
| Ga0308309_112573611 | 3300028906 | Soil | IDTIVEAMHKVLGNIESLRDLDHKAIRNQRLSRADRES |
| Ga0311363_102558613 | 3300029922 | Fen | KENVDSIVDAIRKVLENVEELRGLEHRAIKDQGLSRADRES |
| Ga0311338_106617811 | 3300030007 | Palsa | IDAIVEAIQKVLKNIESLRDLDHKAIRNQRLSRADRES |
| Ga0311344_107459512 | 3300030020 | Bog | AIANAIHKVLENIEELRGLDHKAIRNQKLGRADRES |
| Ga0302274_101260462 | 3300030041 | Bog | ENVDSIVDAIGKVLENVEELRGLEHRAIKDQGLSRADRES |
| Ga0302306_100736891 | 3300030043 | Palsa | FVGSTADVEAIADAIHKVLAASEELRGLDHKAIRNQKLGRADRES |
| Ga0302180_103545282 | 3300031028 | Palsa | IFLGPRADIDAIVEAIHKVLKNIESLRDLDHKAIRNQRLSRADRES |
| Ga0302326_117506521 | 3300031525 | Palsa | DAIVEAMHKVLKNIECLRDLDHKAIRNQRLSRADRES |
| Ga0318516_103410811 | 3300031543 | Soil | QHFLGTTKDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0310686_1097214631 | 3300031708 | Soil | IADVDSIADAIEKVLGASEELRGLDHKAIRNQRLGRADRES |
| Ga0307469_103969201 | 3300031720 | Hardwood Forest Soil | DVDSIVNAMCKVMENIEELRGLEHPAVKAQGQSRADRES |
| Ga0307469_104250171 | 3300031720 | Hardwood Forest Soil | LGTTKDVDDIADAIHKVLENVEELRGLDHKAIRNQKLGRADRES |
| Ga0307469_109908461 | 3300031720 | Hardwood Forest Soil | LFLGDKKEIDTIIDAIFKTLKNIEELRGLDHPAVRSQGMSRADRES |
| Ga0307468_1007607422 | 3300031740 | Hardwood Forest Soil | LGSTNDVDAIADAIHKVLGGIEELRGLDHKAIRNQRLGRADRES |
| Ga0307477_109431581 | 3300031753 | Hardwood Forest Soil | FLGPRSDIDAIVEAMHKVLKNIESLRDLDHKAIRNQRLSRADRES |
| Ga0307475_100650471 | 3300031754 | Hardwood Forest Soil | REDVDSIVNAICKAMENIEELRGLEHPAIKAQGQSRADRES |
| Ga0307475_104138632 | 3300031754 | Hardwood Forest Soil | DAIADAIHKVLGGIEELRQLDHKAIRNQRLGRADRES |
| Ga0318537_103330711 | 3300031763 | Soil | TKKDVDSIVDAMLKVLENIEELRGLEHPAIKAQTQSRADRES |
| Ga0318526_104681681 | 3300031769 | Soil | KDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0318498_103463622 | 3300031778 | Soil | TTKDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0318547_102504621 | 3300031781 | Soil | FLGTKKDVDSIVDAMLKVLENIEELRGLEHPAIKAQTQSRADRES |
| Ga0307473_104081442 | 3300031820 | Hardwood Forest Soil | NFLGSTEDTDAIVNAIHKVLENLEELRGLDHKAIRNQKLGRADRES |
| Ga0307478_101908673 | 3300031823 | Hardwood Forest Soil | DAIADAIHKVLDEIEELRGLDHQAIRNQRLGRADRES |
| Ga0307478_107643942 | 3300031823 | Hardwood Forest Soil | IADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0318512_106506162 | 3300031846 | Soil | LGTTKDVNDIADAIHKVLENIEELRGLDHKAIRNQRLGRADRES |
| Ga0318527_102055081 | 3300031859 | Soil | QSFLGSSEDTDTIADAIEKVLANIEELRGLDHKAIQNQRLGRADRES |
| Ga0306919_106832241 | 3300031879 | Soil | VNDIADAIHKVLENIEELRDLDHKAIRNQRLGRADRES |
| Ga0306925_109635262 | 3300031890 | Soil | AIANAIHKVLENVEDLRGLDHKAIRNQKLGRADRES |
| Ga0318520_106606431 | 3300031897 | Soil | ENVDSIADAIFKVLENIEEVRGLDHKAIKTQGMSRAERES |
| Ga0306923_109295202 | 3300031910 | Soil | TIADAIEKVLAIIEELRGLDHKAIQNQRLGRADRES |
| Ga0306923_110023471 | 3300031910 | Soil | VDDIAEAIHKVLENIEELRGLDHKAVRNQRLGRADRES |
| Ga0310910_114604561 | 3300031946 | Soil | TNFLGSSEDTDTIAGAIEKVLAIIEELRGLDHKAIQNQRLGRADRES |
| Ga0318530_101114461 | 3300031959 | Soil | KKDVDSIVDAMLKVLENIEELRGLEHPAIKAQTQSRADRES |
| Ga0307479_102386083 | 3300031962 | Hardwood Forest Soil | NVDSIVNAISKVLENIEELRGLEHRAIRDQGLSRADRES |
| Ga0307479_114760661 | 3300031962 | Hardwood Forest Soil | ADVDAIAEAIHKVLTNVEELRGLDHKAIRNQRLGRADRES |
| Ga0307479_117840361 | 3300031962 | Hardwood Forest Soil | EAIWFPHYLFLGDKKEIDTIIDAIFKTLDNIEELRGLEHAAIRAQGQSRADRES |
| Ga0306922_108626711 | 3300032001 | Soil | GPQKDVDDIVDTIHKVLENIEDLRNLDHKAIRNQRLGRADRES |
| Ga0307470_115228462 | 3300032174 | Hardwood Forest Soil | LGTTKDVDDIADAIHKVLASIEELRGLDHKAIRNQRLGRADRES |
| Ga0307471_1004825093 | 3300032180 | Hardwood Forest Soil | KEIDTIIDAIFKAMENIEELRGLDHPAIRSQSLSRADRES |
| Ga0307471_1033529592 | 3300032180 | Hardwood Forest Soil | FLGGKENVDSIADAIFKVLENIEELRGLEHRAIKAQGQSRADRES |
| Ga0306920_1018795831 | 3300032261 | Soil | QNFLGSSEDTDTIADAIEKVLANIEELRGLEHKAIQNQRLGRADRES |
| Ga0306920_1035937332 | 3300032261 | Soil | KDVDDIVDAIHKVLENIEDLRNLDHKAIRNQRLGRADRES |
| Ga0335079_105848532 | 3300032783 | Soil | WFPHYLFLGNKEDIDSIVEAIFKTLDNIEELRGLEHPAIKNQGLSRADRES |
| Ga0335078_117328422 | 3300032805 | Soil | SIVEAIFKTLENIEELRGLEHPAIRNQGLSRADRES |
| Ga0335072_117952761 | 3300032898 | Soil | QHFLGPGKDVDDIADAIHKILENVEELRGLDHKAIRNQRLGRADRES |
| Ga0335073_100430926 | 3300033134 | Soil | DAISEAIFKVMKNIEELRGLDHKAIRNQKLGRADRES |
| Ga0335077_119367952 | 3300033158 | Soil | DDIADAIHKVLDNIEELRGLDHKAIRNQKLGRADRES |
| Ga0370483_0077873_960_1067 | 3300034124 | Untreated Peat Soil | MVEAMQKVLKNIENLRGLDHKAIRNQRLSRADRES |
| ⦗Top⦘ |