| Basic Information | |
|---|---|
| Family ID | F041886 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 39 residues |
| Representative Sequence | APMAVVDVARIGARHVHDRLPAEIRERLPEELRLKITGS |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 91.19 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.472 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.063 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.899 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.428 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF00557 | Peptidase_M24 | 14.47 |
| PF01625 | PMSR | 13.84 |
| PF01180 | DHO_dh | 1.89 |
| PF03551 | PadR | 1.26 |
| PF00535 | Glycos_transf_2 | 0.63 |
| PF14344 | DUF4397 | 0.63 |
| PF01266 | DAO | 0.63 |
| PF00293 | NUDIX | 0.63 |
| PF00583 | Acetyltransf_1 | 0.63 |
| PF05163 | DinB | 0.63 |
| PF09278 | MerR-DNA-bind | 0.63 |
| PF01661 | Macro | 0.63 |
| PF03352 | Adenine_glyco | 0.63 |
| PF13450 | NAD_binding_8 | 0.63 |
| PF13411 | MerR_1 | 0.63 |
| PF02578 | Cu-oxidase_4 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 13.84 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.89 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.89 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 1.89 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.89 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.89 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.26 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.26 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.26 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.63 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.63 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.63 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.47 % |
| Unclassified | root | N/A | 24.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101635094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 542 | Open in IMG/M |
| 3300004092|Ga0062389_103185991 | Not Available | 614 | Open in IMG/M |
| 3300005167|Ga0066672_10398826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 900 | Open in IMG/M |
| 3300005366|Ga0070659_101648213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 573 | Open in IMG/M |
| 3300005367|Ga0070667_102082875 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005436|Ga0070713_101066771 | Not Available | 780 | Open in IMG/M |
| 3300005445|Ga0070708_100516825 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300005466|Ga0070685_10262364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1149 | Open in IMG/M |
| 3300005530|Ga0070679_101100956 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005536|Ga0070697_100939029 | Not Available | 768 | Open in IMG/M |
| 3300005607|Ga0070740_10223551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 779 | Open in IMG/M |
| 3300005617|Ga0068859_101160619 | Not Available | 850 | Open in IMG/M |
| 3300005899|Ga0075271_10006696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2117 | Open in IMG/M |
| 3300005899|Ga0075271_10104589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 538 | Open in IMG/M |
| 3300006028|Ga0070717_10928580 | Not Available | 792 | Open in IMG/M |
| 3300006031|Ga0066651_10266329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300006176|Ga0070765_100627152 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300006176|Ga0070765_101478665 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006800|Ga0066660_10485117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1038 | Open in IMG/M |
| 3300006800|Ga0066660_11564670 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006893|Ga0073928_10365736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300009038|Ga0099829_11710581 | Not Available | 517 | Open in IMG/M |
| 3300009143|Ga0099792_10230889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
| 3300009545|Ga0105237_10893895 | Not Available | 895 | Open in IMG/M |
| 3300009551|Ga0105238_12170831 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009635|Ga0116117_1223177 | Not Available | 503 | Open in IMG/M |
| 3300009698|Ga0116216_10588188 | Not Available | 671 | Open in IMG/M |
| 3300010043|Ga0126380_10753789 | Not Available | 790 | Open in IMG/M |
| 3300010048|Ga0126373_10068438 | All Organisms → cellular organisms → Bacteria | 3200 | Open in IMG/M |
| 3300010048|Ga0126373_10827207 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300010339|Ga0074046_10629772 | Not Available | 633 | Open in IMG/M |
| 3300010343|Ga0074044_10523232 | Not Available | 774 | Open in IMG/M |
| 3300010343|Ga0074044_10912839 | Not Available | 574 | Open in IMG/M |
| 3300010361|Ga0126378_11588665 | Not Available | 742 | Open in IMG/M |
| 3300010371|Ga0134125_10181884 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300010371|Ga0134125_10462958 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300010375|Ga0105239_10884694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300010375|Ga0105239_11635388 | Not Available | 745 | Open in IMG/M |
| 3300010376|Ga0126381_102061634 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300010376|Ga0126381_102332531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300010376|Ga0126381_103193508 | Not Available | 648 | Open in IMG/M |
| 3300010379|Ga0136449_100228024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3492 | Open in IMG/M |
| 3300010379|Ga0136449_101633257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300010400|Ga0134122_13213400 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010401|Ga0134121_10495101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
| 3300011119|Ga0105246_12527419 | Not Available | 506 | Open in IMG/M |
| 3300012189|Ga0137388_10020746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4929 | Open in IMG/M |
| 3300012200|Ga0137382_10304255 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300012202|Ga0137363_11461037 | Not Available | 574 | Open in IMG/M |
| 3300012207|Ga0137381_10324958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300012208|Ga0137376_11794479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300012356|Ga0137371_10724507 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012917|Ga0137395_10582360 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012924|Ga0137413_11700822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 518 | Open in IMG/M |
| 3300012925|Ga0137419_11298817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 612 | Open in IMG/M |
| 3300012929|Ga0137404_10914942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300012987|Ga0164307_11693948 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300013296|Ga0157374_10887649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 909 | Open in IMG/M |
| 3300014164|Ga0181532_10712887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300014166|Ga0134079_10203977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
| 3300014325|Ga0163163_10259715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1788 | Open in IMG/M |
| 3300014489|Ga0182018_10510618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 635 | Open in IMG/M |
| 3300014658|Ga0181519_10057146 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
| 3300015241|Ga0137418_10737570 | Not Available | 749 | Open in IMG/M |
| 3300015241|Ga0137418_11262196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 517 | Open in IMG/M |
| 3300015261|Ga0182006_1078934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1204 | Open in IMG/M |
| 3300015264|Ga0137403_10130904 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
| 3300015264|Ga0137403_10751598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300017930|Ga0187825_10343115 | Not Available | 564 | Open in IMG/M |
| 3300017935|Ga0187848_10162891 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300017948|Ga0187847_10447155 | Not Available | 713 | Open in IMG/M |
| 3300017955|Ga0187817_10558314 | Not Available | 730 | Open in IMG/M |
| 3300017959|Ga0187779_10370923 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300017961|Ga0187778_10325901 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300017970|Ga0187783_10604178 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300017972|Ga0187781_10742434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 711 | Open in IMG/M |
| 3300017995|Ga0187816_10403646 | Not Available | 608 | Open in IMG/M |
| 3300017998|Ga0187870_1257274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 596 | Open in IMG/M |
| 3300018012|Ga0187810_10083121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1242 | Open in IMG/M |
| 3300018013|Ga0187873_1276092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 619 | Open in IMG/M |
| 3300018024|Ga0187881_10124270 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300018025|Ga0187885_10320123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300018038|Ga0187855_10048272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2655 | Open in IMG/M |
| 3300018043|Ga0187887_10254273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300018062|Ga0187784_10798311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 753 | Open in IMG/M |
| 3300018085|Ga0187772_10169655 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300018086|Ga0187769_11454415 | Not Available | 518 | Open in IMG/M |
| 3300018088|Ga0187771_10525322 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300018090|Ga0187770_10219287 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300018090|Ga0187770_10235818 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300019870|Ga0193746_1005891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1169 | Open in IMG/M |
| 3300019882|Ga0193713_1037022 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300019890|Ga0193728_1208373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 815 | Open in IMG/M |
| 3300020001|Ga0193731_1063461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 969 | Open in IMG/M |
| 3300020579|Ga0210407_10204456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1534 | Open in IMG/M |
| 3300020580|Ga0210403_10971295 | Not Available | 666 | Open in IMG/M |
| 3300020581|Ga0210399_10200960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1657 | Open in IMG/M |
| 3300020581|Ga0210399_10354888 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300020582|Ga0210395_11211558 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021168|Ga0210406_10147564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1975 | Open in IMG/M |
| 3300021170|Ga0210400_10037332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3768 | Open in IMG/M |
| 3300021181|Ga0210388_10730792 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300021344|Ga0193719_10231044 | Not Available | 785 | Open in IMG/M |
| 3300021404|Ga0210389_10410768 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300021474|Ga0210390_10507790 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300025320|Ga0209171_10617513 | Not Available | 520 | Open in IMG/M |
| 3300025898|Ga0207692_10034965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2437 | Open in IMG/M |
| 3300025916|Ga0207663_11196375 | Not Available | 612 | Open in IMG/M |
| 3300025986|Ga0207658_10329331 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300026301|Ga0209238_1260364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300026308|Ga0209265_1178356 | Not Available | 560 | Open in IMG/M |
| 3300026335|Ga0209804_1193324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 861 | Open in IMG/M |
| 3300026538|Ga0209056_10380348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300026552|Ga0209577_10691329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300027050|Ga0209325_1040155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027545|Ga0209008_1094895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 667 | Open in IMG/M |
| 3300027625|Ga0208044_1130627 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300027648|Ga0209420_1034864 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300027663|Ga0208990_1182295 | Not Available | 540 | Open in IMG/M |
| 3300027725|Ga0209178_1242145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300027737|Ga0209038_10179849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 640 | Open in IMG/M |
| 3300027768|Ga0209772_10128574 | Not Available | 789 | Open in IMG/M |
| 3300027842|Ga0209580_10441033 | Not Available | 649 | Open in IMG/M |
| 3300027879|Ga0209169_10244883 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300027898|Ga0209067_10495550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300027908|Ga0209006_11081423 | Not Available | 633 | Open in IMG/M |
| 3300028747|Ga0302219_10190275 | Not Available | 791 | Open in IMG/M |
| 3300028784|Ga0307282_10203013 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300028785|Ga0302201_10434574 | Not Available | 505 | Open in IMG/M |
| 3300028828|Ga0307312_11060640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 536 | Open in IMG/M |
| 3300029954|Ga0311331_10156433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2714 | Open in IMG/M |
| 3300029990|Ga0311336_10914816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300030043|Ga0302306_10061129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1477 | Open in IMG/M |
| 3300030044|Ga0302281_10205565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 825 | Open in IMG/M |
| 3300030659|Ga0316363_10065400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1685 | Open in IMG/M |
| 3300030659|Ga0316363_10136680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1061 | Open in IMG/M |
| 3300030838|Ga0311335_11248211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300030991|Ga0073994_11912925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 566 | Open in IMG/M |
| 3300031231|Ga0170824_116710045 | Not Available | 722 | Open in IMG/M |
| 3300031525|Ga0302326_13735379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 500 | Open in IMG/M |
| 3300031680|Ga0318574_10842231 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031708|Ga0310686_102117272 | Not Available | 626 | Open in IMG/M |
| 3300031718|Ga0307474_10430814 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300031718|Ga0307474_11648890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 503 | Open in IMG/M |
| 3300031890|Ga0306925_10332405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1633 | Open in IMG/M |
| 3300031946|Ga0310910_10222890 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300031962|Ga0307479_11297134 | Not Available | 689 | Open in IMG/M |
| 3300032163|Ga0315281_12146132 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300032515|Ga0348332_14065330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 673 | Open in IMG/M |
| 3300032828|Ga0335080_12190251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 531 | Open in IMG/M |
| 3300032829|Ga0335070_11746651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 564 | Open in IMG/M |
| 3300032892|Ga0335081_10111992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4020 | Open in IMG/M |
| 3300032893|Ga0335069_10421832 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300032955|Ga0335076_10156696 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300033289|Ga0310914_10048274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3497 | Open in IMG/M |
| 3300033412|Ga0310810_11080709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
| 3300033888|Ga0334792_132693 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300033983|Ga0371488_0248672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium | 871 | Open in IMG/M |
| 3300034124|Ga0370483_0139434 | Not Available | 812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.29% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.26% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.26% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.26% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.63% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.63% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.63% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.63% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.63% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1016350942 | 3300002245 | Forest Soil | APMTMVDAAKVGARRVHDRLPAEIRERLPEELRLKITGS* |
| Ga0062389_1031859911 | 3300004092 | Bog Forest Soil | TPAPTTVVDAAKIGARRVHDRLPVKIQERLPEELRLKITGS* |
| Ga0066672_103988261 | 3300005167 | Soil | TPAPMAVVDAARLGARRVHDRLPQEIRERLPEELRMKLTGS* |
| Ga0070659_1016482132 | 3300005366 | Corn Rhizosphere | APVALVDAAKIGARHVHDRLPPEIRKRVPEELRMKITGS* |
| Ga0070667_1020828751 | 3300005367 | Switchgrass Rhizosphere | TPAPVALVDAAKIGARHVHDRLPPEIRKRVPEELRMKITGS* |
| Ga0070713_1010667711 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIATPAPMAVVDVAKIGARHVHDRLPAEIRERLPEELRLKITGS* |
| Ga0070708_1005168253 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | APVTVLDAAKEGARRVHDRLPQEIRQRLPEELRIKITGT* |
| Ga0070685_102623643 | 3300005466 | Switchgrass Rhizosphere | PAPVALVDAAKIGARHVHDRLPPEIRKRVPEELRMKITGS* |
| Ga0070679_1011009561 | 3300005530 | Corn Rhizosphere | TPAPMTMVDVARLGARKVHDRLPPEVRDRIPEEVRMKITGQS* |
| Ga0070697_1009390291 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LIWLGVAVATPVPVTVLDAAKEGARRVHDRLPQEIRQRLPEEIRIKITGT* |
| Ga0070740_102235511 | 3300005607 | Surface Soil | PAPATVVDVARVGARHVHDRLPAEIRQRLPEDLRVKLTGS* |
| Ga0068859_1011606191 | 3300005617 | Switchgrass Rhizosphere | TVVDVARLGARHVHDRLPAEIRQRLPEELRMKLTGS* |
| Ga0075271_100066961 | 3300005899 | Rice Paddy Soil | ALVTPAPMMMVDVALVGARRVHDRLPPEIRDRIPEELRVKISGQP* |
| Ga0075271_101045892 | 3300005899 | Rice Paddy Soil | TPAPLAMVDVARIGARKVHDKLPPDLRDRIPEELRIKITGQS* |
| Ga0070717_109285801 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | APVTVLGAAKEGARRVHARLPEEIRQRLPEEIRIKITGT* |
| Ga0066651_102663292 | 3300006031 | Soil | MIEVARVGARHVHDRLPQEIRDRLPEELRMKITGS* |
| Ga0070765_1006271522 | 3300006176 | Soil | APDTVLDAAKQGARRVHDRLPQEIRERLPEELRVKITGT* |
| Ga0070765_1014786651 | 3300006176 | Soil | VLGAAKEGARRVHDRLPPEIRERLPEELRVKITGT* |
| Ga0066660_104851171 | 3300006800 | Soil | PAPMAVVDAARLGARHVHDRLPQEIRERLPEELRMKLTGS* |
| Ga0066660_115646702 | 3300006800 | Soil | VVADVARLGARQLHDHLPEEIRERIPEQIKLKISGQ* |
| Ga0073928_103657363 | 3300006893 | Iron-Sulfur Acid Spring | VVDAAKLGARHVHDRLPAEIRERLPEEIRVKLTGS* |
| Ga0099829_117105812 | 3300009038 | Vadose Zone Soil | PAPATMVDVARIGARRVHDRLPAEIRERLPEELRVKLTGS* |
| Ga0099792_102308891 | 3300009143 | Vadose Zone Soil | VDVARLGARRVHDRLPAEIRDKLPEELRMKITGS* |
| Ga0105237_108938951 | 3300009545 | Corn Rhizosphere | TPAPQTALVVARTGARLVHDKLPEPIRERIPEELRVKISGL* |
| Ga0105238_121708312 | 3300009551 | Corn Rhizosphere | TVVDVARVGARRVHDRLPEEIRQRIGEDLRVKLTGS* |
| Ga0116117_12231771 | 3300009635 | Peatland | APMAVVDVARIGARHVHDRLPAEIRERLPEELRLKITGS* |
| Ga0116216_105881881 | 3300009698 | Peatlands Soil | PVTVLDAAKQGARRVHDRLPQEIRERLPEELRVKITGT* |
| Ga0126380_107537891 | 3300010043 | Tropical Forest Soil | ATPAPMAVVDAARLGARHVHDRLPQEIRERLPEELRMKLTGS* |
| Ga0126373_100684381 | 3300010048 | Tropical Forest Soil | VDVARVGARHVHDRLPAEIRERLPEELRMKLTGS* |
| Ga0126373_108272073 | 3300010048 | Tropical Forest Soil | APTTMVDIARFGARQVHDRLPAEIRDRLPEELRMKLTGS* |
| Ga0074046_106297722 | 3300010339 | Bog Forest Soil | ATPAPMAVVDVARIGARHVHDRLPAEIREYIPEELRLKITGS* |
| Ga0074044_105232323 | 3300010343 | Bog Forest Soil | AVVDVAKLGARHVHDRLPAEIRDKLPEELRMKITGS* |
| Ga0074044_109128391 | 3300010343 | Bog Forest Soil | TVLDAAKEGARRVHDRLPQEIRERLPEELRVKITGT* |
| Ga0126378_115886651 | 3300010361 | Tropical Forest Soil | AVVDVAKIGARHVHDRLPAEIRERLPEELRLKITGS* |
| Ga0134125_101818844 | 3300010371 | Terrestrial Soil | DVAMVGARRVHDRLPPEIRDRLPEDLRLKITGQS* |
| Ga0134125_104629581 | 3300010371 | Terrestrial Soil | ATPAPMAVVDVAKLGARHVHDRLPPEIRERLPEELRMKLTGS* |
| Ga0105239_108846941 | 3300010375 | Corn Rhizosphere | VDAAKLGARRVHDRLPAEIRERLPEEFRLKITGS* |
| Ga0105239_116353881 | 3300010375 | Corn Rhizosphere | APVALVDAAKIGARHVHDRLPPEIKKRVPEELRMKITGS* |
| Ga0126381_1020616341 | 3300010376 | Tropical Forest Soil | ATPAPTTMVHVAKIGARHVHDRLPAEIRERLPDDLRLKITGS* |
| Ga0126381_1023325311 | 3300010376 | Tropical Forest Soil | VAAVAIATPAPMAVVDVAKLGARHVHDRLPQEIRERLPEELRLKITGS* |
| Ga0126381_1031935082 | 3300010376 | Tropical Forest Soil | ATPAPMAVVDAARVGARHVHDRLPAEIRERLPEELRLKITGS* |
| Ga0136449_1002280245 | 3300010379 | Peatlands Soil | ATPAPVTVLDAAKEGARRVHDRLPPEIRERLPEELRVKITGT* |
| Ga0136449_1016332571 | 3300010379 | Peatlands Soil | TPAPMAVVDAAWVGARHVHDRLPAEIRERLPEELRLKITGS* |
| Ga0134122_132134001 | 3300010400 | Terrestrial Soil | MAVVDAAKLGARRVHDRLPVEIRERLPEEFRLKITGS* |
| Ga0134121_104951012 | 3300010401 | Terrestrial Soil | VVDAALMGARHVHDRLPPEIRERLPEELRLKIGGQH* |
| Ga0105246_125274191 | 3300011119 | Miscanthus Rhizosphere | MAVVDAALMGARHVHDRLPPEIRERLPEELRLKIGGQH* |
| Ga0137388_100207466 | 3300012189 | Vadose Zone Soil | VDAAKLGARHVHDRLPAEIRERLPEEIRVKLTGS* |
| Ga0137382_103042551 | 3300012200 | Vadose Zone Soil | TPAPMTVVDVARLGARRVHDRLPAEIRERLPEELRLKITGS* |
| Ga0137363_114610372 | 3300012202 | Vadose Zone Soil | VDVARLGARRVHDRLPAEIREKLPEELRMKITGS* |
| Ga0137381_103249583 | 3300012207 | Vadose Zone Soil | VDVARLGARRVHDRLPAEIRERLPEELRMKITGS* |
| Ga0137376_117944793 | 3300012208 | Vadose Zone Soil | ATPAPMAVVDVARFGARHVHDRLPAEIRDRLPEELRVKITGQS* |
| Ga0137371_107245073 | 3300012356 | Vadose Zone Soil | PAPAAMVDVARIGARHVHDRLPAEIRERLPEELRMKLTGS* |
| Ga0137395_105823602 | 3300012917 | Vadose Zone Soil | APVTVLDAAKEGARRVHDRLPQEIRERLPEELRVKITGT* |
| Ga0137413_117008221 | 3300012924 | Vadose Zone Soil | TPQVLDAAKEGARRVHDRLPQEIRERLPEELRVKITGT* |
| Ga0137419_112988171 | 3300012925 | Vadose Zone Soil | ATPAPVTVLDAAKEGARRVHDRLPQEIRERLPEELRVKITGT* |
| Ga0137404_109149421 | 3300012929 | Vadose Zone Soil | VALVDAAKIGARHVHDRLPPEIRKRVPEELRVKITGS* |
| Ga0164307_116939481 | 3300012987 | Soil | PATVVDVARVGARRVHDRLPAEIRQRIGEDLRVKLTGS* |
| Ga0157374_108876491 | 3300013296 | Miscanthus Rhizosphere | PMAVVDAARLGARHVHDRLPQEIRERLPEELRMKLTGS* |
| Ga0181532_107128872 | 3300014164 | Bog | ATPAPMVMVDVAKIGARRVHDRLPPEIRERLPEEIRVRITGS* |
| Ga0134079_102039772 | 3300014166 | Grasslands Soil | APTAMVDVAKIGARHVHDRLPAEIRERLPEELRLKITGS* |
| Ga0163163_102597151 | 3300014325 | Switchgrass Rhizosphere | PAPTAVVDVARLGARRVHDRLPAEIRERLPEDFRLKITGS* |
| Ga0182018_105106182 | 3300014489 | Palsa | VTVLDAAKEGARRVHDRLPQEIRERLPEELRVKITGT* |
| Ga0181519_100571464 | 3300014658 | Bog | TPAPVTVLDAAKQGARRVHDRLPPEIRERLPEELRVKITGA* |
| Ga0137418_107375702 | 3300015241 | Vadose Zone Soil | ATPAPTTMVDVARMGARRVHDRLPAEIRERLPEDLRLKITGS* |
| Ga0137418_112621961 | 3300015241 | Vadose Zone Soil | TPAPVTMLDAAREGARRVHDRLPAEIRERLPEELRVKITGT* |
| Ga0182006_10789342 | 3300015261 | Rhizosphere | ATPAPMTMVDVAMVGARRVHDRLPPEIRDRLPEDLRLKITGQS* |
| Ga0137403_101309044 | 3300015264 | Vadose Zone Soil | MVDVARIGARHVHDRLPAEIRERLPEELRVKLTGS* |
| Ga0137403_107515982 | 3300015264 | Vadose Zone Soil | PVALVDAAKIGARHVHDRLPPEIRKRVPEELRVKITGS* |
| Ga0187825_103431151 | 3300017930 | Freshwater Sediment | APTTVVDAARLGARRVHDRLPQEIRQRVPEDVWLKITGS |
| Ga0187848_101628913 | 3300017935 | Peatland | APVTVLDAAKQGARRVHDRLPPEIRERLPEELRVKITGT |
| Ga0187847_104471551 | 3300017948 | Peatland | PMAVVDVAKLGARHVHDHLPAEIRDRLPEEIRLKITGS |
| Ga0187817_105583141 | 3300017955 | Freshwater Sediment | MAVVDVARIGARHVHDRLPAEIRERLPEELRLKITGS |
| Ga0187779_103709231 | 3300017959 | Tropical Peatland | MAVVDVAKLGARHVHDRLPAEIRERLPEELRVKITGS |
| Ga0187778_103259011 | 3300017961 | Tropical Peatland | APTVMVDAARIGARRVHDRLPQEIRERLPEEIRVRITGS |
| Ga0187783_106041782 | 3300017970 | Tropical Peatland | ATPAPVTVLDAAMEGARRVHDRLPQEIRERLPEELRVKITGT |
| Ga0187781_107424342 | 3300017972 | Tropical Peatland | VATPAPTVMVDAAKVGARHVHDRLPQEIRERLPEELRVKITGS |
| Ga0187816_104036461 | 3300017995 | Freshwater Sediment | TPAPMTVVDAAKVGARRVHDRLPAEIRERLPEELRVKLTGS |
| Ga0187870_12572741 | 3300017998 | Peatland | APTAVVDVAMLGARHVHDRLPAEIRDRLPEEIRVKLTGS |
| Ga0187810_100831211 | 3300018012 | Freshwater Sediment | PMAMVDAAKIGARHVHDRLPAEIRERLPEELRLKITGS |
| Ga0187873_12760921 | 3300018013 | Peatland | VTVLDAAKQGARRVHDRLPPEIRERLPEELRVKITGT |
| Ga0187881_101242703 | 3300018024 | Peatland | AVVDVAKLGARHVHDRLPAEIREKLPEELRMKITGS |
| Ga0187885_103201232 | 3300018025 | Peatland | PAPTVMVDVAKLGARHVHDRLPAEIRERLPEEIRVKLTGS |
| Ga0187855_100482723 | 3300018038 | Peatland | PVTVLDAAKEGARRVHDRLPPEIRERLPEEFRVKITGT |
| Ga0187887_102542731 | 3300018043 | Peatland | MAVVDVARLGARHVHDRLPPEIREKLPEEIRVKLTGS |
| Ga0187784_107983111 | 3300018062 | Tropical Peatland | PAPTVMVDAAKVGARHVHDRLPQEIRERLPEELRVKITGS |
| Ga0187772_101696552 | 3300018085 | Tropical Peatland | ATPAPVTVLDAAKEGARRVHDRLPAEIRERLPEELRVKITGT |
| Ga0187769_114544151 | 3300018086 | Tropical Peatland | TPAPMVVVDAAKIGARHVHDRLPAEIRERIPDELRLKITGS |
| Ga0187771_105253221 | 3300018088 | Tropical Peatland | PAPMVVVDVAMLGAKHVHDRLPAEIRERLPEELRTKITGS |
| Ga0187770_102192872 | 3300018090 | Tropical Peatland | MAVVDAARLGARHVHDRLPPEIRERLPEELRLKITGS |
| Ga0187770_102358181 | 3300018090 | Tropical Peatland | ATPAPMVVVDVAMIGAKHVHDRLPAEIRERLPEELRAKITGS |
| Ga0193746_10058911 | 3300019870 | Soil | VATPAPMAVVDAARLGARHVHDRLPQEIRERLPEELRMKLTGS |
| Ga0193713_10370221 | 3300019882 | Soil | TVMVDVARLGARRVHDRLPAEIREKLPEELRVKITGS |
| Ga0193728_12083732 | 3300019890 | Soil | PMAVVDVARLGARHVHDRLPAEIRDRLPEELRVKITGQS |
| Ga0193731_10634611 | 3300020001 | Soil | MTMVDAAKVGARRVHDRLPAEIRERLPEEFRLKITGS |
| Ga0210407_102044561 | 3300020579 | Soil | TVVDVARVGARRVHDRLPAEIRQRLGEELRVKLTGS |
| Ga0210403_109712952 | 3300020580 | Soil | PAPMTVVDVARLGARRVHDRLPAEIRERLPEDLRLKITGS |
| Ga0210399_102009602 | 3300020581 | Soil | TPAPMAVVDVARIGARHVHDRLPAEIRERLPEELRLKITGS |
| Ga0210399_103548883 | 3300020581 | Soil | PMAVVDVAMLGARHVHDRLPAEIRERLPEELRLKITGS |
| Ga0210395_112115582 | 3300020582 | Soil | MVDAAKVGARRVHDRLPAEIRERLPEELRLKITGS |
| Ga0210406_101475643 | 3300021168 | Soil | APMVVVDAARLGARHVHDRLPAEIRERLPEEIRVKLTGS |
| Ga0210400_100373326 | 3300021170 | Soil | APVTVLDAAKQGARRVHDRLPQEIRERLPEELRVKITGT |
| Ga0210388_107307922 | 3300021181 | Soil | ATPAPTTVVDAAKIGARRVHDRLPAEIRERLPEELRLKITGS |
| Ga0193719_102310441 | 3300021344 | Soil | PATMVDVARIGARRVHDRLPAEIRERLPEELRVKLTGS |
| Ga0210389_104107681 | 3300021404 | Soil | PTVMVDAALLGARHVHDRLPAEIRDRLPEELRVRITGS |
| Ga0210390_105077901 | 3300021474 | Soil | PAPMAVVDVAKIGARHVHDRLPPEIRERLPEELRLKITGS |
| Ga0209171_106175132 | 3300025320 | Iron-Sulfur Acid Spring | MTVVDAARLGARHVHDRLPPEIRDRLPEELRVKITGS |
| Ga0207692_100349654 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PMTMVDAAKVGARRVHDRLPAEIRERLPEELRLKITGS |
| Ga0207663_111963751 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDVAKLGARHVHDRLPPEIRERLPEELRMKLTGS |
| Ga0207658_103293311 | 3300025986 | Switchgrass Rhizosphere | TPAPVALVDAAKIGARHVHDRLPPEIRKRVPEELRMKITGS |
| Ga0209238_12603641 | 3300026301 | Grasslands Soil | MAVVDVARLGARHVHDRLPAEIRDRLPEELRVKITGQS |
| Ga0209265_11783561 | 3300026308 | Soil | PAPATVVDVARVGARRVHDRLPAEIRQRIGEDLRVKLTGS |
| Ga0209804_11933241 | 3300026335 | Soil | TPAPMAVVDAARLGARRVHDRLPQEIRERLPEELRMKLTGS |
| Ga0209056_103803482 | 3300026538 | Soil | APVALVDAAKIGARHVHDRLPPEIKKRVPEELRMKITGS |
| Ga0209577_106913292 | 3300026552 | Soil | VVDVARLGARHVHDRLPAEIRDRLPEELRVKITGQS |
| Ga0209325_10401551 | 3300027050 | Forest Soil | ATPAPTTVVDVARLGARRVHDRLPAEIRERLPEDLRLKITGS |
| Ga0209008_10948951 | 3300027545 | Forest Soil | VTVLGAAKEGARRVHDRLPPEIRERLPEELRVKITGT |
| Ga0208044_11306272 | 3300027625 | Peatlands Soil | TPAPVTVLDAAKEGARRVHDRLPQEIRQRLPEELRIKITGT |
| Ga0209420_10348643 | 3300027648 | Forest Soil | TPAPVTVLDAAKQGARRVHDRLPPEIRERLPEELRVKITGT |
| Ga0208990_11822952 | 3300027663 | Forest Soil | VVDVARLGARRVHDRLPAEIREKLPEELRMKITGS |
| Ga0209178_12421451 | 3300027725 | Agricultural Soil | TVVDVARLGARHVHDRLPEEIRQRLPEELRMKLTGS |
| Ga0209038_101798491 | 3300027737 | Bog Forest Soil | PVTVLDAAKQGARRVHDRLPQEIRERLPEELRVKITGT |
| Ga0209772_101285741 | 3300027768 | Bog Forest Soil | MAMVDAAKIGARHVHDRLPAEIRERLPEEIRVKLTGS |
| Ga0209580_104410332 | 3300027842 | Surface Soil | VVDVARLGARHVHDRLPAEIRERLPEDLRLKITGS |
| Ga0209169_102448831 | 3300027879 | Soil | APMAVVDVARIGARHVHDRLPAEIRERLPEELRLKITGS |
| Ga0209067_104955502 | 3300027898 | Watersheds | VVDVAKIGARHVHDRLPAEIRERLPEEIRVKITGS |
| Ga0209006_110814231 | 3300027908 | Forest Soil | MVDAALLGARHVHDRLPAEIRDRLPEELRVRITGS |
| Ga0302219_101902752 | 3300028747 | Palsa | TAVVDVAKLGARHVHDRLPAEIRERLPEEIRVKLTGS |
| Ga0307282_102030134 | 3300028784 | Soil | TMVDVARLGARRVHDRLPAEIRERLPEELRLKITGS |
| Ga0302201_104345742 | 3300028785 | Bog | PAPVTVLDAAKQGARKVHDRLPAEIRERLPEELRVKITGT |
| Ga0307312_110606401 | 3300028828 | Soil | VATPAPMAVVDVARLGARHVHDRLPAEIRDRLPEELRVKITGQS |
| Ga0311331_101564335 | 3300029954 | Bog | VLDAAKQGARKVHDRLPAEIRERLPEELRVKITGT |
| Ga0311336_109148162 | 3300029990 | Fen | VVDVARIGARRVHDRLPAEIREKLPEELRMKITGS |
| Ga0302306_100611291 | 3300030043 | Palsa | TPAPVTVLDAAKQGARRVHDRLPQEIRERLPEELRVKITGT |
| Ga0302281_102055651 | 3300030044 | Fen | ALATPAPIVMAGAARLGARHVHDRLPLEIRERLPEELRVKLTGS |
| Ga0316363_100654002 | 3300030659 | Peatlands Soil | TPAPMAVVDAAKIGARRVHDRLPAEIRERLPEELRLKITGS |
| Ga0316363_101366803 | 3300030659 | Peatlands Soil | PAPVTVLDAARQGARRVHDRLPPEIRERLPEELRVKITGT |
| Ga0311335_112482111 | 3300030838 | Fen | AVVDVARIGARRVHDRLPAEIREKLPEELRMKITGS |
| Ga0073994_119129251 | 3300030991 | Soil | AVVDAAKLGARHVHDRLPAEIRERLPEEIRVKLTGS |
| Ga0170824_1167100452 | 3300031231 | Forest Soil | VVDAAKLGARHVHDRLPAEIRERLPEEIRVKLTGS |
| Ga0302326_137353791 | 3300031525 | Palsa | LIWLVVAVATPVPVTVLDAAKEGARRVHDRLPQEIRERLPEELRVKITGT |
| Ga0318574_108422311 | 3300031680 | Soil | ATPAPMAMVDVALFGARKVHDRLPAEVRERIPEEVRLKITGQS |
| Ga0310686_1021172722 | 3300031708 | Soil | VTVLDAAKEGARRVHDRLPQEIRERLPEEIRVKITGT |
| Ga0307474_104308142 | 3300031718 | Hardwood Forest Soil | VLDAAKQGARRVHDRLPQEIRERLPEELRVKITGT |
| Ga0307474_116488901 | 3300031718 | Hardwood Forest Soil | TPAPVTVLDAARQGARRVHDRLPAEIRERLPEELRVKITGT |
| Ga0306925_103324053 | 3300031890 | Soil | TPAPTMVVDVARLGARHVHDRLPAEIRERLPEELRVKLTGS |
| Ga0310910_102228903 | 3300031946 | Soil | VVDVARLGARHVHDRLPAEIRERLPEELRVKLTGS |
| Ga0307479_112971341 | 3300031962 | Hardwood Forest Soil | PAAVVDVARVGARRVHDRLPAEIRQRLGEDLRVKLTGS |
| Ga0315281_121461322 | 3300032163 | Sediment | MAMADVARLGARAVHDRLPPEIRERIPEELRLKISGQS |
| Ga0348332_140653301 | 3300032515 | Plant Litter | APMTVVDAARLGARHVHDHLPPEIRDRLPEELRMKITGS |
| Ga0335080_121902511 | 3300032828 | Soil | APMAMVDAAKIGARHVHDRLPAEIRERLPEELRLRITGS |
| Ga0335070_117466511 | 3300032829 | Soil | ATPAPTVMVDAAIIGARHVHDRLPQEIRDRLPEELRLKITGS |
| Ga0335081_101119924 | 3300032892 | Soil | PAPMAMVDAAKIGARHVHDRLPPEIRERLPEELRLKITGS |
| Ga0335069_104218321 | 3300032893 | Soil | VMVDAALLGARRVHDRLPAEIRERLPEELRVRITGS |
| Ga0335076_101566964 | 3300032955 | Soil | PAPVTVLDAAKEGARRVHDRLPQEIRQRLPEELRIKITGT |
| Ga0310914_100482746 | 3300033289 | Soil | VATPAPMTVVDVARIGARRVHDRLPAEIRERLPEDLRLKITGS |
| Ga0310810_110807091 | 3300033412 | Soil | APTTVADVARLGARHVHDRLPAEIRERLPEELRLKITGS |
| Ga0334792_132693_5_118 | 3300033888 | Soil | MAVVDVAKLGAGHVYDRLPPEIRERLPEEIRVKITGS |
| Ga0371488_0248672_758_871 | 3300033983 | Peat Soil | MVVVDVAKLGAGHVYDRLPPEIRERLPEEIRVKITGS |
| Ga0370483_0139434_2_121 | 3300034124 | Untreated Peat Soil | APMAVVDVARHGARVVHDRLPAEIRERLPEEIRVKFTGS |
| ⦗Top⦘ |