| Basic Information | |
|---|---|
| Family ID | F041832 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MHRPSAEEFLLTLLETLDELPPDLARRFADLLKKDHVDRPSAIRQLFEDVAGD |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.53 % |
| % of genes near scaffold ends (potentially truncated) | 20.13 % |
| % of genes from short scaffolds (< 2000 bps) | 84.91 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.824 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.723 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.931 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.006 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.15% β-sheet: 0.00% Coil/Unstructured: 51.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF13476 | AAA_23 | 67.30 |
| PF02463 | SMC_N | 4.40 |
| PF00266 | Aminotran_5 | 1.26 |
| PF01261 | AP_endonuc_2 | 1.26 |
| PF00069 | Pkinase | 1.26 |
| PF01676 | Metalloenzyme | 0.63 |
| PF03807 | F420_oxidored | 0.63 |
| PF01663 | Phosphodiest | 0.63 |
| PF07721 | TPR_4 | 0.63 |
| PF12704 | MacB_PCD | 0.63 |
| PF13649 | Methyltransf_25 | 0.63 |
| PF10282 | Lactonase | 0.63 |
| PF00296 | Bac_luciferase | 0.63 |
| PF05988 | DUF899 | 0.63 |
| PF13620 | CarboxypepD_reg | 0.63 |
| PF09976 | TPR_21 | 0.63 |
| PF00892 | EamA | 0.63 |
| PF03576 | Peptidase_S58 | 0.63 |
| PF08281 | Sigma70_r4_2 | 0.63 |
| PF03551 | PadR | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.03 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.26 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.63 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.63 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.63 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.63 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.82 % |
| Unclassified | root | N/A | 8.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_10178762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1551 | Open in IMG/M |
| 2228664021|ICCgaii200_c0840274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 2228664022|INPgaii200_c0928656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10846704 | Not Available | 613 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_102006669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9506 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_102009125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300000550|F24TB_10923417 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300000956|JGI10216J12902_101148039 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300000956|JGI10216J12902_109141042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300000956|JGI10216J12902_110253841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300000956|JGI10216J12902_111867572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300000956|JGI10216J12902_120726327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
| 3300001431|F14TB_104162862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300003319|soilL2_10076460 | All Organisms → cellular organisms → Bacteria | 4865 | Open in IMG/M |
| 3300003319|soilL2_10226150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300004114|Ga0062593_100028852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3115 | Open in IMG/M |
| 3300004114|Ga0062593_100552140 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300004156|Ga0062589_100382080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300004156|Ga0062589_101262255 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300004157|Ga0062590_100144796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1614 | Open in IMG/M |
| 3300004157|Ga0062590_100428043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
| 3300004157|Ga0062590_101098592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300004463|Ga0063356_100829969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1294 | Open in IMG/M |
| 3300004463|Ga0063356_101215409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300004480|Ga0062592_100183879 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300004480|Ga0062592_100196218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1417 | Open in IMG/M |
| 3300004643|Ga0062591_100831404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300005093|Ga0062594_101208090 | Not Available | 750 | Open in IMG/M |
| 3300005093|Ga0062594_101607051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300005093|Ga0062594_102985324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300005289|Ga0065704_10439552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300005293|Ga0065715_10095493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4073 | Open in IMG/M |
| 3300005293|Ga0065715_10228096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300005293|Ga0065715_10326889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300005293|Ga0065715_10649785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300005294|Ga0065705_10516478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300005294|Ga0065705_10676984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300005295|Ga0065707_10778538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300005330|Ga0070690_100575513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300005332|Ga0066388_100017987 | All Organisms → cellular organisms → Bacteria | 6020 | Open in IMG/M |
| 3300005337|Ga0070682_100381810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300005337|Ga0070682_100434683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300005337|Ga0070682_102082391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300005339|Ga0070660_101313096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300005353|Ga0070669_101242983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300005355|Ga0070671_100145278 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300005356|Ga0070674_100135816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1839 | Open in IMG/M |
| 3300005356|Ga0070674_101133660 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005366|Ga0070659_100665864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300005439|Ga0070711_100087866 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300005441|Ga0070700_101124653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300005456|Ga0070678_101491238 | Not Available | 633 | Open in IMG/M |
| 3300005526|Ga0073909_10653239 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005529|Ga0070741_10136907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2492 | Open in IMG/M |
| 3300005545|Ga0070695_100494545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300005545|Ga0070695_101398182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300005546|Ga0070696_100535027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300005564|Ga0070664_101139301 | Not Available | 735 | Open in IMG/M |
| 3300005577|Ga0068857_100167822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1994 | Open in IMG/M |
| 3300005615|Ga0070702_101875651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300005713|Ga0066905_100460480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
| 3300005713|Ga0066905_101174491 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005764|Ga0066903_102380048 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005764|Ga0066903_107814341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300005844|Ga0068862_100996208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300006237|Ga0097621_100714938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300006580|Ga0074049_11717676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300006844|Ga0075428_100050610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4555 | Open in IMG/M |
| 3300006845|Ga0075421_100017914 | All Organisms → cellular organisms → Bacteria | 8869 | Open in IMG/M |
| 3300006845|Ga0075421_100107788 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
| 3300006845|Ga0075421_100729295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300006845|Ga0075421_101589212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300006847|Ga0075431_100863375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300006852|Ga0075433_10030433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4606 | Open in IMG/M |
| 3300006852|Ga0075433_11555634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300006854|Ga0075425_100348623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1704 | Open in IMG/M |
| 3300006854|Ga0075425_100436505 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300006854|Ga0075425_100658433 | Not Available | 1203 | Open in IMG/M |
| 3300006880|Ga0075429_100059470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3329 | Open in IMG/M |
| 3300006880|Ga0075429_100284678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1447 | Open in IMG/M |
| 3300006881|Ga0068865_100176128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1644 | Open in IMG/M |
| 3300006904|Ga0075424_100621502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1154 | Open in IMG/M |
| 3300006914|Ga0075436_100171706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1531 | Open in IMG/M |
| 3300007076|Ga0075435_100973303 | Not Available | 741 | Open in IMG/M |
| 3300009094|Ga0111539_10034376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6147 | Open in IMG/M |
| 3300009094|Ga0111539_10351439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1715 | Open in IMG/M |
| 3300009100|Ga0075418_10526907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1269 | Open in IMG/M |
| 3300009101|Ga0105247_11192645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300009147|Ga0114129_11643145 | Not Available | 785 | Open in IMG/M |
| 3300009156|Ga0111538_10085966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4001 | Open in IMG/M |
| 3300009162|Ga0075423_11467730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300009176|Ga0105242_12759111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300009553|Ga0105249_12477287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300009810|Ga0105088_1112326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300010362|Ga0126377_10044625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3834 | Open in IMG/M |
| 3300010366|Ga0126379_13476475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300010371|Ga0134125_10613126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300010401|Ga0134121_11668399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300010403|Ga0134123_12395875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300010403|Ga0134123_13237573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300012944|Ga0137410_10510582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300012951|Ga0164300_10647192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300012961|Ga0164302_10074631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1783 | Open in IMG/M |
| 3300012961|Ga0164302_11144827 | Not Available | 618 | Open in IMG/M |
| 3300012961|Ga0164302_11722903 | Not Available | 526 | Open in IMG/M |
| 3300012984|Ga0164309_10765472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300012984|Ga0164309_11100300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012986|Ga0164304_10045438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2358 | Open in IMG/M |
| 3300014326|Ga0157380_13350614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300014968|Ga0157379_10033343 | All Organisms → cellular organisms → Bacteria | 4593 | Open in IMG/M |
| 3300015371|Ga0132258_11288228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1847 | Open in IMG/M |
| 3300015371|Ga0132258_12144951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1404 | Open in IMG/M |
| 3300015371|Ga0132258_12498270 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300015372|Ga0132256_100876733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300015372|Ga0132256_101064555 | Not Available | 924 | Open in IMG/M |
| 3300015372|Ga0132256_101465041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300015372|Ga0132256_103434092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300015373|Ga0132257_101071852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300015373|Ga0132257_102001257 | Not Available | 747 | Open in IMG/M |
| 3300015373|Ga0132257_102076332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300015374|Ga0132255_100688895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
| 3300018084|Ga0184629_10066910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1685 | Open in IMG/M |
| 3300018422|Ga0190265_13262893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300024055|Ga0247794_10269960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300025315|Ga0207697_10030737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2197 | Open in IMG/M |
| 3300025315|Ga0207697_10075086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
| 3300025900|Ga0207710_10489937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300025912|Ga0207707_10483127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300025917|Ga0207660_10653445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300025923|Ga0207681_11487940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300025925|Ga0207650_11662646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300025930|Ga0207701_10108590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2483 | Open in IMG/M |
| 3300025930|Ga0207701_10480076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
| 3300025930|Ga0207701_10977993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300025932|Ga0207690_10195378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1533 | Open in IMG/M |
| 3300025933|Ga0207706_11642175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300025934|Ga0207686_11584999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300025940|Ga0207691_10141576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2119 | Open in IMG/M |
| 3300025940|Ga0207691_11606534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025986|Ga0207658_12076051 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026075|Ga0207708_11186063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300026075|Ga0207708_11747488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300027395|Ga0209996_1069947 | Not Available | 545 | Open in IMG/M |
| 3300027523|Ga0208890_1048392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300027577|Ga0209874_1030701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1473 | Open in IMG/M |
| 3300027909|Ga0209382_10011674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 10894 | Open in IMG/M |
| 3300027909|Ga0209382_10024416 | All Organisms → cellular organisms → Bacteria | 7315 | Open in IMG/M |
| 3300027909|Ga0209382_11251149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300028381|Ga0268264_10581450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300028381|Ga0268264_10699667 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300028592|Ga0247822_11012994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300028802|Ga0307503_10102732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
| 3300031226|Ga0307497_10025795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1867 | Open in IMG/M |
| 3300031538|Ga0310888_10120710 | Not Available | 1362 | Open in IMG/M |
| 3300031740|Ga0307468_100713004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300031892|Ga0310893_10167818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300031908|Ga0310900_10158968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1541 | Open in IMG/M |
| 3300033551|Ga0247830_10434614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300034115|Ga0364945_0033954 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 8.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.14% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.26% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.26% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.63% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0847.00006660 | 2162886013 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLETLDELPPDMAARFADLLKNEHVDRAAAIRQLFEDAAGD |
| ICCgaii200_08402742 | 2228664021 | Soil | MHRPSAEEFLRTLLETLDDLPPDLAQRFAELLKKEHLDRAAAIRQLFEDVASD |
| INPgaii200_09286562 | 2228664022 | Soil | VHRPSAEEFLLTLLETLDELPPDLARRFADLLKKEDVDRPSAIRQLFEDVAGD |
| ICChiseqgaiiFebDRAFT_108467041 | 3300000363 | Soil | MHRPSAEEFLRTLLETLDDLPPDLAQRFAELLKKEHLDRAAAIRQLFEDVASD* |
| INPhiseqgaiiFebDRAFT_1020066692 | 3300000364 | Soil | VHRPSAEEFLLTLLETLDELPPDLARRFADLLKKEDVDRPSAIRQLFEDVAGD* |
| INPhiseqgaiiFebDRAFT_1020091252 | 3300000364 | Soil | VHRPSAEEFLLTLFETLDELPPDLARRFADLLKKGDVDRASAIRQLFEDVAGD* |
| F24TB_109234172 | 3300000550 | Soil | MHRPSAEEFLLALLEGLGDLPPELAQRLAEVLARPHVDRSQAIRQLFEEFAGD* |
| JGI10216J12902_1011480392 | 3300000956 | Soil | VHRPSAEEFLLTLLDTLDEVPPDLARRFADLLKKDHVDRPSAIRQLFEDVAGD* |
| JGI10216J12902_1091410421 | 3300000956 | Soil | MHRPSAEEFLLTLLETLDELPPDLAQRLAALLQKDHVDRSAAIRQLFEELAGE* |
| JGI10216J12902_1102538412 | 3300000956 | Soil | MNRPMHRPDAEEFLLTLLGALDELPPDLAERFAALLKNDHVDRSAAIRQLFEDVTGE* |
| JGI10216J12902_1118675722 | 3300000956 | Soil | MHRPSAEEFLLTLLETLDELPPDLAQRLAAVLKNDEGDRSAAIRQLFEDVAGE* |
| JGI10216J12902_1207263272 | 3300000956 | Soil | MHRPSAEEFLLTLLEGLDEVPPDLAQRFAVLLTEDHVDRSAAIRQLFEDMAGE* |
| F14TB_1041628621 | 3300001431 | Soil | SAEEFLLTLLETVEELPPDLARRFAELLKKDHPDRASAIRQLFEDVAGD* |
| soilL2_100764603 | 3300003319 | Sugarcane Root And Bulk Soil | MHRPSAEEFLLTLLETLDDLPPDLAARFAAVLKQEHMDRSAAIRQLFEEAAGE* |
| soilL2_102261501 | 3300003319 | Sugarcane Root And Bulk Soil | VHRPSAEEFLLTLLEGLDELPPDLAHRFAEVLKKEHVDRAGAIRQLFEDAAGD* |
| Ga0062593_1000288522 | 3300004114 | Soil | MHRPSAEEFLLMLLQTLDDLPAELARRFSELLKRDDVDRSAAIRQLFEDVAGD* |
| Ga0062593_1005521402 | 3300004114 | Soil | MHRPSAEEFLLTLLKTLDELPPDLARRFADLLKQDVVDRPSAIRQMFEDLAGD* |
| Ga0062589_1003820801 | 3300004156 | Soil | GPVIEELPMHRPSAEEFLLTLLQTLDDLPAELARRFSELLKRDDVDRSAAIRQLFEDVAGD* |
| Ga0062589_1012622552 | 3300004156 | Soil | MARPSAEEFLLALFETLDELPPDLARRFADLLKKGDVDRSAAIRQLFEDVAGD* |
| Ga0062590_1001447961 | 3300004157 | Soil | MHRPSAEEFLLTLLETLEELPPELARRLAGLLKKEHVDRASAIRQLFEDVAGD* |
| Ga0062590_1004280432 | 3300004157 | Soil | SMHRPSAQEFLLTLLDTLDELPPDLTRRFAELLKTEHVDRPAAIRQLFEDIAGD* |
| Ga0062590_1010985922 | 3300004157 | Soil | LAELEVLMHRPSAEEFLRTLLEALDDLPPDLARRFADLLRKDHVDRPSAIRQLFEDVAGD |
| Ga0063356_1008299692 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHRPSAEEFLLTLLETLDELPPGLAQRLAAVLKKDDVDRSAAIRQLFEDVASE* |
| Ga0063356_1012154091 | 3300004463 | Arabidopsis Thaliana Rhizosphere | HRPSAEEFLLTLLRTLDELPPDLARRFADLLKKDDVDRPSAIRQMFEDIAGD* |
| Ga0062592_1001838792 | 3300004480 | Soil | MHRPSAEEFLLTLLETLDELPPDLAQRFAELLKKEHVDRASAIRQMFEDAAGD* |
| Ga0062592_1001962181 | 3300004480 | Soil | MHRPSAEEFLRTLLEALDDLPPDLARRFADLLRKDHVDRPSAIRQLFEDVAGD* |
| Ga0062591_1008314041 | 3300004643 | Soil | MHRPSAQEFLLTLLDTLDELPPDLARRFAELLKTEHVDRPAAIRQLFEDIAGD* |
| Ga0062594_1012080901 | 3300005093 | Soil | MHRPSAEEFLLTLLETLDELPPDLARRFSELLKRDDVDRPTAIRQLFED |
| Ga0062594_1016070512 | 3300005093 | Soil | HRPSAQEFLLTLLDTLDELPPDLARRFAELLKTEHVDRPAAIRQLFEDIAGD* |
| Ga0062594_1029853242 | 3300005093 | Soil | MHRPSAEEFLQTLLETMDELPPDLAQRVAELLKTQHVDRSAAIRQLFEDVAGE* |
| Ga0065704_104395522 | 3300005289 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLETLDELPPDMAARFADLLKNEHVDRAAAIRQLFEDAAGD* |
| Ga0065715_100954931 | 3300005293 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDDLPPDLARRLAGLLKKEHADRPAAIRQLFEDVAGD* |
| Ga0065715_102280962 | 3300005293 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRFSELLKRDDVDRPTAIRQLFEDAAGD* |
| Ga0065715_103268891 | 3300005293 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLEKIDELPPDLAKRFTELLKKDHVDRASAIRQLFEDVAGD* |
| Ga0065715_106497852 | 3300005293 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDMAPRFADLLKNEHVDRAAAIRQLFEDAAGD* |
| Ga0065705_105164781 | 3300005294 | Switchgrass Rhizosphere | MHCPSAEEFLLTLLETLDELPPDLAQRLAAVLKTDHVDRSAAIRQLFEDVASE* |
| Ga0065705_106769841 | 3300005294 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLQTLDDLPAELARRFSELLKRDDVDRSAAIRQLFEDVAGD* |
| Ga0065707_107785382 | 3300005295 | Switchgrass Rhizosphere | MHRPSAEEFLVTLLETLDELPPDLAQRLAAVLKTDEVDRSAAIRQLFEEVASE* |
| Ga0070690_1005755131 | 3300005330 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLDTMDELPPDLVQRVAALLKKEHIDRSAAIRQLFEDVAGE* |
| Ga0066388_1000179875 | 3300005332 | Tropical Forest Soil | MHRPSAEEFLLTLLETLDELPPDLAERLAVVLKKDDVERSAAIRQLFEDVAGE* |
| Ga0070682_1003818102 | 3300005337 | Corn Rhizosphere | MHRPSAEEFLLTLLEALDDVPPDLAERFVMLLKKDQVDRSAAIRQLFEDVAGE* |
| Ga0070682_1004346832 | 3300005337 | Corn Rhizosphere | MHRPSAQEFLLTLLDTLDELPPDLARRFAELLKTEHVDRGAAIRQLFEDIAGD* |
| Ga0070682_1020823911 | 3300005337 | Corn Rhizosphere | WFSSFIRRGPDMHRPSAEEFLLTLLETLDELPPDLAQRFAELLKKEHVDRASAIRQMFEDAAGD* |
| Ga0070660_1013130962 | 3300005339 | Corn Rhizosphere | MHRPSAEEFLLSLLEELHDLPPDLSERFANLLKQDHVDRSAAIRQLLEELAGE* |
| Ga0070669_1012429832 | 3300005353 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRFADLLKKDHADRPSAIRQLFEDVAGD* |
| Ga0070671_1001452783 | 3300005355 | Switchgrass Rhizosphere | MHRPSAQEFLLTLLDTLDELPPDLARRFAELLKTEHVDRPAAIRQLFEDIA |
| Ga0070674_1001358162 | 3300005356 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLDTMDELPPDLAQRVAALLKKEHIDRAAAIRQLFEDVAGE* |
| Ga0070674_1011336601 | 3300005356 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRFSELLKRDDVDRPTAIRQLFEDVAGD* |
| Ga0070659_1006658641 | 3300005366 | Corn Rhizosphere | LAELEVLMHRPSAEEFLRTLLEALGDLPPDLARRFADLLGKDHVDRPSAIRQLFEDVAGD |
| Ga0070711_1000878661 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPELAGRLADLLKKDHVDRASAIRQLFEDAAGD* |
| Ga0070700_1011246532 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLQTLLETMDELPPDLAQRVAELLKTEHVDRSAAIRQLFEDVAGE* |
| Ga0070678_1014912381 | 3300005456 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRLTDLLKKDDVDRPSAIRQLFEDVAGD* |
| Ga0073909_106532391 | 3300005526 | Surface Soil | MHRPSAEEFLLTLLETLDELPPDLARRLADLLKKDDVDRPSAIRQLFEDVAGD* |
| Ga0070741_101369072 | 3300005529 | Surface Soil | MPRQSADEFLLTLLDTLDDLPPDFASRFVDTLTRGDEERAQAIRQLFEDAAGD* |
| Ga0070695_1004945452 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAAEFLLTLIETLDELPPDLAQRFAELLKKEHVDRASAIRQMFEDAAGD* |
| Ga0070695_1013981822 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLERLDDLPPDLAQRLADLLKKDHVDRSAAIRQLFEDVAGD* |
| Ga0070696_1005350271 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLEALDDVPPDLAERFVMLLKKDQVDRSAAIRQLFEDGAGE* |
| Ga0070664_1011393013 | 3300005564 | Corn Rhizosphere | MHRPSAEEFLLTLLETLDELPPDMAARFADLLKNEHVDRAAAIRQLF |
| Ga0068857_1001678221 | 3300005577 | Corn Rhizosphere | LLTLLETLDELPPDMAARFADLLKNEHVDRAAAIRQLFEDAAGD* |
| Ga0070702_1018756511 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LEVLMHRPSAEEFLRTLLEALDDLPPDLARRFADLLRKDHVDRPSAIRQLFEDVAGD* |
| Ga0066905_1004604802 | 3300005713 | Tropical Forest Soil | MHRPSAEEFLLSLLETLDELPPDLAQRFADLLKKDHVDRPSAIRQLFEDVTGD* |
| Ga0066905_1011744912 | 3300005713 | Tropical Forest Soil | MHRPSAEEFLLTLLDTLNELPPDLARRFADLLKKEHVDRPSAIRQLFEDVAGD* |
| Ga0066903_1023800482 | 3300005764 | Tropical Forest Soil | MHRPSAEEFLLTLLEELKELPPDLTERFSMLLKNDHVDRSAAIRQLFEDVAGE* |
| Ga0066903_1078143411 | 3300005764 | Tropical Forest Soil | MHRPSAEEFLLTLLETLDELPPDLAERLAVVLKKDDVDRSAAIRQLFEDVAGE* |
| Ga0068862_1009962081 | 3300005844 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLETLDDLPPDLARRLAGLLKKEHVDRPAAIRQLFEDVAGD* |
| Ga0097621_1007149381 | 3300006237 | Miscanthus Rhizosphere | EFLLTLLDTLDELPPDLARRFAELLKTEHVDRPAAIRQLFEDIAGD* |
| Ga0074049_117176762 | 3300006580 | Soil | MHRPSAEEFLLTLLDTMDELPPDLAQRVAALLKKEHIDRSASIRQLFEDVAGE* |
| Ga0075428_1000506103 | 3300006844 | Populus Rhizosphere | MHRPSAEEFLLTLLESLEELPPDLAQRLATLLKKDHTDRSAAIRQLFEEIAGE* |
| Ga0075421_1000179146 | 3300006845 | Populus Rhizosphere | MHRPSADEFLLTLLESLEDLPPDLAQRFAELLKKDHVDRSAAIRQLFEDAGGE* |
| Ga0075421_1001077881 | 3300006845 | Populus Rhizosphere | MHRPSAEEFLLTLLETMDELPPDLSQRVAALLKKEHVDRSAAIRQ |
| Ga0075421_1007292952 | 3300006845 | Populus Rhizosphere | MNRPTAQEFLLTLLDTLDELPPDLARRFAALLKQDHVDRSAAIRQLFEDVAGE* |
| Ga0075421_1015892121 | 3300006845 | Populus Rhizosphere | MHRPSAEEFLLTLLQTLDELPPDLAQRFAALLKQPHLDRSAAIRQLFEETAGE* |
| Ga0075431_1008633751 | 3300006847 | Populus Rhizosphere | MHRQTAEEFLLTLLETLDDLPPDFASRLAEVIKNDEGDRSQAIRQLFEDVAGD* |
| Ga0075433_100304333 | 3300006852 | Populus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLAARVAALLKNDHVDRAAALRQLFEDVTGE* |
| Ga0075433_115556342 | 3300006852 | Populus Rhizosphere | VHRPSAEEFLLTLLETLDGLPPDLARRFADLLRKDHVDRPSAIRQLFEDAAGD* |
| Ga0075425_1003486234 | 3300006854 | Populus Rhizosphere | MHRPSAEEFLLTLLETLDGLPPDLARRFADLLKKDHVDRPSAIRQLFEDAAGD* |
| Ga0075425_1004365052 | 3300006854 | Populus Rhizosphere | MHRPSADEFLLTLLETLDELPPDLAKRFAELLKKDNIDRATAIRQLFEDVAGD* |
| Ga0075425_1006584332 | 3300006854 | Populus Rhizosphere | MHRPSAEEFLLTLLETLDELPPNLARRFSELLKRDDVDRPTAIRQLFEDAAGD* |
| Ga0075429_1000594704 | 3300006880 | Populus Rhizosphere | MHRPSAEEFLRTLLETLDDLPPDLAQRFVELLKKEHLDRAAAIRQLFEDVASD* |
| Ga0075429_1002846781 | 3300006880 | Populus Rhizosphere | MHRPSAEEFLLTLLQSLEELPPDLAQRLATLLKKDHTDRSAAIRQLFEEIAGE* |
| Ga0068865_1001761282 | 3300006881 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRFADLLKKDHVDRPSAIRQLFEDVAGD* |
| Ga0075424_1006215021 | 3300006904 | Populus Rhizosphere | HRPSAEEFLLTLLETLDGLPPDLARRFADLLKKDHVDRPSAIRQLFEDAAGD* |
| Ga0075436_1001717063 | 3300006914 | Populus Rhizosphere | MHRPSAEEFLLTLLETLDDLPPDLAQRLAGLLKKEHADRPAAVRQLFEDVAGD* |
| Ga0075435_1009733032 | 3300007076 | Populus Rhizosphere | VHRPSAEEFLLTLLETLDGLPPDLARRFADLLKKDHVDRPSAIRQLFEDAAGD* |
| Ga0111539_100343763 | 3300009094 | Populus Rhizosphere | VHRPSAEQFLLTLLETLEELPPELAQRLAGLVKKEHVDRASAIRQLFEDVAGD* |
| Ga0111539_103514392 | 3300009094 | Populus Rhizosphere | MHRPSAEEFLQTLLETMDELPPDLAQRVAELLKTKHVDRSAAIRQLFEDVAGE* |
| Ga0075418_105269072 | 3300009100 | Populus Rhizosphere | VHRPSAEEFLLTLLETLEELPPELAQRLAGLVKKEHVDRASAIRQLFEDVAGD* |
| Ga0105247_111926451 | 3300009101 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLDTMDELPPDLAQRVAALLKKEHIDRSAAIRQLFEDVAGE* |
| Ga0114129_116431451 | 3300009147 | Populus Rhizosphere | VHRPSAQEFLLTLLETLEELPPELAQRLAGLVKKEHVDRASAIRQLFEDVAGD* |
| Ga0111538_100859661 | 3300009156 | Populus Rhizosphere | LPKEEVLMHRPSAEEFLLTLLETLEELPPELAQRLAGLLKKEHVDRASAIRQLFEDVAGD |
| Ga0075423_114677301 | 3300009162 | Populus Rhizosphere | VHRPSAEEFLLTLLETLEELPPELAQRLAGLVKKEHVDGASEIRQLFK |
| Ga0105242_127591111 | 3300009176 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDEIPPDLARRFADLLKKDHVDRPSAIRQLFEDIAGD* |
| Ga0105249_124772871 | 3300009553 | Switchgrass Rhizosphere | MHRPSAEEFLQTLLETMDELPPNLAERVAALLKTEHVDRSAAIRQLFEDLAGE* |
| Ga0105088_11123262 | 3300009810 | Groundwater Sand | MHRPSAEEFLLTLLETLDELPPDLAQRFAALLKKDHVDRSAAIRQLFEDVAGE* |
| Ga0126377_100446253 | 3300010362 | Tropical Forest Soil | MHRPSAEEFFLTLLKTLDELPPDLAERFAALLKKDDVDRSAAIRQLFEDVAGE* |
| Ga0126379_134764752 | 3300010366 | Tropical Forest Soil | MHRPSAEEFLLTLLETLDDLPPDLAERLAAVLKKDDVDRSAAIRRLFEDVASE* |
| Ga0134125_106131262 | 3300010371 | Terrestrial Soil | MHRPSPEEFLLTPLETLDHLPPALARRLAGLLKKEHADRPAAIRQLFEDVAGD* |
| Ga0134121_116683992 | 3300010401 | Terrestrial Soil | MHRPSAEEFLLTLLETLDELPPDLAERFAGVLKKADVDRSAAIRQLFEDVAGE* |
| Ga0134123_123958752 | 3300010403 | Terrestrial Soil | MPRPSAEEFLLALFETLDELPPDLARRFADLLKKGDVDRPAAIRQLFEDVAGD* |
| Ga0134123_132375731 | 3300010403 | Terrestrial Soil | MHRPSAEEFLLTLLEKIDELPPDLAKRFAELLMKDHVDRASAIRQLFEDVAGD* |
| Ga0137410_105105821 | 3300012944 | Vadose Zone Soil | MHRPSAEEFLLTLLETLDGLPPDLARRLADLLKEDVVDRPSAIRQLFEDAADD* |
| Ga0164300_106471922 | 3300012951 | Soil | MHRPGADEFLRTLLEALDELPPDLAERFAALLQKDHVDRSAAIRKLFEDVTGE* |
| Ga0164302_100746312 | 3300012961 | Soil | MHRPSAEEFLLTLLDTMDELQPDLAQRVAALLKKEHIDRSAAIRQLFEDVAGE* |
| Ga0164302_111448272 | 3300012961 | Soil | MHRPSAEEFLLTLLETLDDLPPDLARRLADLLKKDDIDRPSTIRQLFEDVAGD* |
| Ga0164302_117229031 | 3300012961 | Soil | MHRPSAQEFLLTLLDTLDELPPDLARRFAELLKTEHVDRPAAIRQLFEDIAG |
| Ga0164309_107654722 | 3300012984 | Soil | EEFLLTLLETLDDLPPDLARRLADLLKKDEADRPSAIRQLFEDVAGA* |
| Ga0164309_111003001 | 3300012984 | Soil | MHRPSAEEFLLTLLDTMDELPPDLAQRVAALLKKEHIDRSAAIRQLFEDVSGE* |
| Ga0164304_100454381 | 3300012986 | Soil | MHRPSAEEFLLTLLETLDDLPPDLARRLADLLKKDEADRPSAIRQLFEDVAGA* |
| Ga0157380_133506141 | 3300014326 | Switchgrass Rhizosphere | AEEFLQTLLETMDELPPDLAQRVAELLKTEHVDRSAAIRQLFEDVAGE* |
| Ga0157379_100333432 | 3300014968 | Switchgrass Rhizosphere | MHRPSAQEFLLTLLDTLDELPPDLARRFAELLKTEHVDRSAAIRQLFEDIAGD* |
| Ga0132258_112882282 | 3300015371 | Arabidopsis Rhizosphere | MHRPSAEEFLLTLLETVDELPPDLAQRLAELLKKEHVDRASAIRQLFEDAAGD* |
| Ga0132258_121449512 | 3300015371 | Arabidopsis Rhizosphere | MHRPSAEEFLLTLLEKIDELPPDLAKRFAELLKKDHVDRASAIRQLFEDVAGD* |
| Ga0132258_124982702 | 3300015371 | Arabidopsis Rhizosphere | MHRPSAEEFLLTLLETLDELPPELAGRLADLLKKDHVDRASAIRQLFEDVAGD* |
| Ga0132256_1008767332 | 3300015372 | Arabidopsis Rhizosphere | MHRPSAEEFLQTLLETMDELPPDLAERVAELLKTKHVDRSAAIRQLFEDVAGE* |
| Ga0132256_1010645551 | 3300015372 | Arabidopsis Rhizosphere | MHRPSAEEFLLTLLEKFDELPPDLAKRFTELLKKDHVDGASAIRQLFEDVAGD |
| Ga0132256_1014650412 | 3300015372 | Arabidopsis Rhizosphere | MHRPSAEEILLTLLETLDELPPDMAARFADLLKNEPVDRAAAIRQLFEDAAGD* |
| Ga0132256_1034340922 | 3300015372 | Arabidopsis Rhizosphere | MHRPSAEEFLLTLLETLDDLPPDLARRFADLLKKEHVDRPSAIRQLFEDAAGD* |
| Ga0132257_1010718522 | 3300015373 | Arabidopsis Rhizosphere | LLTLLETLDELPPDLARRFADLLKKDHVDRPSAIRQLFEDVAGD* |
| Ga0132257_1020012571 | 3300015373 | Arabidopsis Rhizosphere | MHRPSAEEFLQTLLETMDELPPDLAQRVAALLKTEHVDRSAAIRQLFEDVAGE* |
| Ga0132257_1020763321 | 3300015373 | Arabidopsis Rhizosphere | MHRPSAEEFLLTLLEKIDDVPPDLAERFAELLKKDHVDRAAAIRQLFEDVAGD* |
| Ga0132255_1006888951 | 3300015374 | Arabidopsis Rhizosphere | MHRPSAEEFLLTLLEKIDDVPPDLAERFAELLKKDHVDRASAIRQLFEDVAGD* |
| Ga0184629_100669102 | 3300018084 | Groundwater Sediment | MHRPSAEEFLLTLLETLDELPPDLARRFADLLKNDGVDRPSAIRQLFEDVAGD |
| Ga0190265_132628932 | 3300018422 | Soil | MHRPGAEEFLLTLLETLDEIPPDLAQRFAALLKKDHVDRSAAIRQLFEELAGE |
| Ga0247794_102699602 | 3300024055 | Soil | MHRPSAQEFLLTLLDTLDELPPDLARRFAELLKTEHVDRPAAIRQLFEDIAGD |
| Ga0207697_100307371 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDMAARFADLLKNEHVDRAAAIRQLFE |
| Ga0207697_100750861 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | SAEEFLQTLLETMDELPPDLAQRVAELLKTEHVDRGAAIRQLFEDIAGD |
| Ga0207710_104899371 | 3300025900 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLDTMDELPPDLAQRVAALLKKEHIDRSAAIRQLFEDVAGE |
| Ga0207707_104831271 | 3300025912 | Corn Rhizosphere | MHRPSAEEFLLTLLEALDDVPPDLAERFVMLLKKDQVDRSAAIRQLFEDVAGE |
| Ga0207660_106534452 | 3300025917 | Corn Rhizosphere | MHRPSAEEFLRTLLEALDDLPPDLARRFADLLRKDHVDRPSAIRQLFEDVAGD |
| Ga0207681_114879401 | 3300025923 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRFADLLKKDHADRPSAIRQLFEDVAGD |
| Ga0207650_116626462 | 3300025925 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLETLDELPPDMAPRFADLLKNEHVDRAAAIRQLFEDAAGD |
| Ga0207701_101085903 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRFADLLKKDHVDRPSAIRQLFEDVAGD |
| Ga0207701_104800762 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLAQRFAELLKKEHVDRASAIRQMFEDAAGD |
| Ga0207701_109779932 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLEKFDELPPDLAKRFTELLKKDHVDRASAIRQLFEDVAGD |
| Ga0207690_101953782 | 3300025932 | Corn Rhizosphere | MHRPSAEEFLRTLLEALGDLPPDLARRFADLLGKDHVDRPSAIRQLFEDVAGD |
| Ga0207706_116421751 | 3300025933 | Corn Rhizosphere | MPRPSAEEFLLALFETLDELPPDLARRFADLLKKGDVDRPAAIRQLFEDVAGD |
| Ga0207686_115849992 | 3300025934 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDEIPPDLARRFADLLKKDHADRPSAIRQLFEDVAGD |
| Ga0207691_101415761 | 3300025940 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLETLDELPPDMAARFADLLKNEHVDRAAAIRQLFEDAA |
| Ga0207691_116065342 | 3300025940 | Miscanthus Rhizosphere | MHRPSAEEFLLTLLQTLDDLPAELARRFSELLKRDDVDRSAAIRQLFEDVAGD |
| Ga0207658_120760511 | 3300025986 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLDTMDELPPDLVQRVAALLKKEHIDRSAAIRQLFED |
| Ga0207708_111860631 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLQTLLETMDELPPDLAQRVAELLKTEHVDRSAAIRQLFEDVAGE |
| Ga0207708_117474881 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRPSAEEFLLTLLEKIDELPPDLAKRFAELLMKDHVDRASAIRQLFEDVAGD |
| Ga0209996_10699472 | 3300027395 | Arabidopsis Thaliana Rhizosphere | MHRPSAEEFLLTLLRTLDELPPDLARRFADLLKKDDVDRPSAIRQMFEDI |
| Ga0208890_10483922 | 3300027523 | Soil | MHRPSAEEFLLTLLDTMDELPPDLAQRVAALLKKEHIDRSASIRQLFEDVAGE |
| Ga0209874_10307012 | 3300027577 | Groundwater Sand | MHRPSAEEFLLTLLETLDELPPDLAQRFADLLRKNHVDRSAAIRQLFEDVAGE |
| Ga0209382_100116747 | 3300027909 | Populus Rhizosphere | MHRPSADEFLLTLLESLEDLPPDLAQRFAELLKKDHVDRSAAIRQLFEDAGGE |
| Ga0209382_100244163 | 3300027909 | Populus Rhizosphere | MHRPSAEEFLLTLLESLEELPPDLAQRLATLLKKDHTDRSAAIRQLFEEIAGE |
| Ga0209382_112511491 | 3300027909 | Populus Rhizosphere | MHRPSAEEFLLTLLQTLDELPPDLAQRFAALLKQPHLDRSAAIRQLFEETAGE |
| Ga0268264_105814502 | 3300028381 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLETLDELPPDLARRFSELLKRDDVDRSTAIRQLFEDVAGD |
| Ga0268264_106996671 | 3300028381 | Switchgrass Rhizosphere | MHRPSAEEFLLTLLDTMDELPPDLAQRVAALLKKEHIDRAAAIRQ |
| Ga0247822_110129941 | 3300028592 | Soil | MHRPSAEEFLLTLLETMDELPPDLSQRVAALLKKEHVDRSAAIRQLFEDLAGE |
| Ga0307503_101027322 | 3300028802 | Soil | MHRPSAEEFLLTLLETLDDLPPDLARRFADLLKKEHVDRPSAIRQLFEDAAGD |
| Ga0307497_100257952 | 3300031226 | Soil | MHRPSAEEFLLTLLETLNELPPDLARRLADLLKEEHVDRPAAIRQLFEDVAGD |
| Ga0310888_101207101 | 3300031538 | Soil | MHCPSAEEFLLTLLETLDELPPDLAQRLAAVLTKGDVDRSAAIRELFEDVASE |
| Ga0307468_1007130041 | 3300031740 | Hardwood Forest Soil | MHRPSAEEFLLTLLETLDGLPPDLARRFTDLLKKDHVDRPSAIRQLFEDVAGD |
| Ga0310893_101678182 | 3300031892 | Soil | MHCPSAEEFLLTLLETLDELPPDLAQRLAAVLKKGDVDRSAAIRELFEDVASE |
| Ga0310900_101589682 | 3300031908 | Soil | MHCPSAEEFLLTLLETLDELPPVLAQRLAAVLTKGDVDRSAAIRELFEDVASE |
| Ga0247830_104346142 | 3300033551 | Soil | MHRQTAEEFLLTLLETLDDLPPDFARRLAEVVKNEEGDRSQAIRQLFEDGAGD |
| Ga0364945_0033954_140_301 | 3300034115 | Sediment | MHRPSAEEFLLTLLDTMDELPPDLAQRVVALLKKEHVDRSAAIRQLFEDAAGE |
| ⦗Top⦘ |