| Basic Information | |
|---|---|
| Family ID | F041800 |
| Family Type | Metagenome |
| Number of Sequences | 159 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQ |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.74 % |
| % of genes near scaffold ends (potentially truncated) | 96.86 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.635 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.975 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.811 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.53% β-sheet: 0.00% Coil/Unstructured: 39.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 11.95 |
| PF03793 | PASTA | 10.69 |
| PF00484 | Pro_CA | 0.63 |
| PF00999 | Na_H_Exchanger | 0.63 |
| PF13282 | DUF4070 | 0.63 |
| PF13424 | TPR_12 | 0.63 |
| PF00082 | Peptidase_S8 | 0.63 |
| PF12728 | HTH_17 | 0.63 |
| PF08281 | Sigma70_r4_2 | 0.63 |
| PF02954 | HTH_8 | 0.63 |
| PF13155 | Toprim_2 | 0.63 |
| PF13432 | TPR_16 | 0.63 |
| PF01095 | Pectinesterase | 0.63 |
| PF01152 | Bac_globin | 0.63 |
| PF03704 | BTAD | 0.63 |
| PF13676 | TIR_2 | 0.63 |
| PF04255 | DUF433 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.63 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.63 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.63 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.63 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.63 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.63 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.63 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.63 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.63 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.63 |
| COG4677 | Pectin methylesterase and related acyl-CoA thioesterases | Carbohydrate transport and metabolism [G] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.64 % |
| All Organisms | root | All Organisms | 38.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000532|CNAas_1001265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2231 | Open in IMG/M |
| 3300005294|Ga0065705_11119170 | Not Available | 518 | Open in IMG/M |
| 3300005334|Ga0068869_102100308 | Not Available | 508 | Open in IMG/M |
| 3300005340|Ga0070689_100861551 | Not Available | 800 | Open in IMG/M |
| 3300005340|Ga0070689_101686401 | Not Available | 576 | Open in IMG/M |
| 3300005341|Ga0070691_10678063 | Not Available | 616 | Open in IMG/M |
| 3300005343|Ga0070687_101020122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → unclassified Syntrophorhabdus → Syntrophorhabdus sp. PtaU1.Bin153 | 601 | Open in IMG/M |
| 3300005344|Ga0070661_101488896 | Not Available | 571 | Open in IMG/M |
| 3300005345|Ga0070692_10022391 | All Organisms → cellular organisms → Bacteria | 3086 | Open in IMG/M |
| 3300005345|Ga0070692_11340762 | Not Available | 514 | Open in IMG/M |
| 3300005353|Ga0070669_101438424 | Not Available | 598 | Open in IMG/M |
| 3300005440|Ga0070705_100147428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1557 | Open in IMG/M |
| 3300005441|Ga0070700_100371674 | Not Available | 1066 | Open in IMG/M |
| 3300005459|Ga0068867_100231577 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300005459|Ga0068867_101486027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 630 | Open in IMG/M |
| 3300005467|Ga0070706_101005552 | Not Available | 769 | Open in IMG/M |
| 3300005518|Ga0070699_100002735 | All Organisms → cellular organisms → Bacteria | 15724 | Open in IMG/M |
| 3300005539|Ga0068853_100259667 | Not Available | 1596 | Open in IMG/M |
| 3300005539|Ga0068853_102029013 | Not Available | 558 | Open in IMG/M |
| 3300005539|Ga0068853_102078862 | Not Available | 551 | Open in IMG/M |
| 3300005547|Ga0070693_100906846 | Not Available | 661 | Open in IMG/M |
| 3300005547|Ga0070693_100907741 | Not Available | 660 | Open in IMG/M |
| 3300005547|Ga0070693_101072762 | Not Available | 613 | Open in IMG/M |
| 3300005547|Ga0070693_101547096 | Not Available | 519 | Open in IMG/M |
| 3300005563|Ga0068855_102076025 | Not Available | 573 | Open in IMG/M |
| 3300005577|Ga0068857_101452787 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005577|Ga0068857_102458100 | Not Available | 511 | Open in IMG/M |
| 3300005616|Ga0068852_100174283 | Not Available | 2018 | Open in IMG/M |
| 3300005617|Ga0068859_102683872 | Not Available | 547 | Open in IMG/M |
| 3300005618|Ga0068864_101542856 | Not Available | 668 | Open in IMG/M |
| 3300005834|Ga0068851_10201700 | Not Available | 1110 | Open in IMG/M |
| 3300005834|Ga0068851_10223614 | Not Available | 1058 | Open in IMG/M |
| 3300005840|Ga0068870_10735834 | Not Available | 684 | Open in IMG/M |
| 3300005841|Ga0068863_101814430 | Not Available | 620 | Open in IMG/M |
| 3300005841|Ga0068863_102032956 | Not Available | 585 | Open in IMG/M |
| 3300005842|Ga0068858_100063469 | All Organisms → cellular organisms → Bacteria | 3418 | Open in IMG/M |
| 3300005843|Ga0068860_100376168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1401 | Open in IMG/M |
| 3300005843|Ga0068860_101451248 | Not Available | 707 | Open in IMG/M |
| 3300005843|Ga0068860_101945570 | Not Available | 610 | Open in IMG/M |
| 3300005844|Ga0068862_102487653 | Not Available | 529 | Open in IMG/M |
| 3300006358|Ga0068871_100650067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 963 | Open in IMG/M |
| 3300006876|Ga0079217_10291744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 898 | Open in IMG/M |
| 3300006876|Ga0079217_11346128 | Not Available | 554 | Open in IMG/M |
| 3300006894|Ga0079215_10918447 | Not Available | 631 | Open in IMG/M |
| 3300006954|Ga0079219_10516864 | Not Available | 842 | Open in IMG/M |
| 3300007004|Ga0079218_10395815 | Not Available | 1174 | Open in IMG/M |
| 3300007004|Ga0079218_13604004 | Not Available | 526 | Open in IMG/M |
| 3300009011|Ga0105251_10247521 | Not Available | 803 | Open in IMG/M |
| 3300009093|Ga0105240_11630996 | Not Available | 674 | Open in IMG/M |
| 3300009101|Ga0105247_10478596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 903 | Open in IMG/M |
| 3300009101|Ga0105247_11714958 | Not Available | 520 | Open in IMG/M |
| 3300009148|Ga0105243_10716779 | Not Available | 977 | Open in IMG/M |
| 3300009156|Ga0111538_11418893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 876 | Open in IMG/M |
| 3300009162|Ga0075423_12814485 | Not Available | 533 | Open in IMG/M |
| 3300009174|Ga0105241_10796809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 870 | Open in IMG/M |
| 3300009174|Ga0105241_11693281 | Not Available | 614 | Open in IMG/M |
| 3300009174|Ga0105241_12072467 | Not Available | 561 | Open in IMG/M |
| 3300009176|Ga0105242_11733833 | Not Available | 661 | Open in IMG/M |
| 3300009545|Ga0105237_12315647 | Not Available | 547 | Open in IMG/M |
| 3300009551|Ga0105238_10003796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15013 | Open in IMG/M |
| 3300009553|Ga0105249_11515193 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales | 743 | Open in IMG/M |
| 3300009553|Ga0105249_12646951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 574 | Open in IMG/M |
| 3300009789|Ga0126307_10063148 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
| 3300009789|Ga0126307_11286969 | Not Available | 592 | Open in IMG/M |
| 3300009789|Ga0126307_11602304 | Not Available | 529 | Open in IMG/M |
| 3300010037|Ga0126304_11141569 | Not Available | 533 | Open in IMG/M |
| 3300010038|Ga0126315_10582019 | Not Available | 721 | Open in IMG/M |
| 3300010039|Ga0126309_10386814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300010041|Ga0126312_10566799 | Not Available | 815 | Open in IMG/M |
| 3300010041|Ga0126312_10681035 | Not Available | 742 | Open in IMG/M |
| 3300010041|Ga0126312_11203963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 558 | Open in IMG/M |
| 3300010045|Ga0126311_10014433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 4534 | Open in IMG/M |
| 3300010045|Ga0126311_10231273 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300010045|Ga0126311_10852732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 737 | Open in IMG/M |
| 3300010047|Ga0126382_11316054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 654 | Open in IMG/M |
| 3300010166|Ga0126306_10835936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 744 | Open in IMG/M |
| 3300010359|Ga0126376_12863597 | Not Available | 532 | Open in IMG/M |
| 3300010371|Ga0134125_11667946 | Not Available | 693 | Open in IMG/M |
| 3300010373|Ga0134128_12188672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 609 | Open in IMG/M |
| 3300010397|Ga0134124_10863321 | Not Available | 909 | Open in IMG/M |
| 3300010397|Ga0134124_10989169 | Not Available | 852 | Open in IMG/M |
| 3300010397|Ga0134124_11825405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 642 | Open in IMG/M |
| 3300010397|Ga0134124_12215964 | Not Available | 589 | Open in IMG/M |
| 3300010399|Ga0134127_10181425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1941 | Open in IMG/M |
| 3300010399|Ga0134127_11631089 | Not Available | 719 | Open in IMG/M |
| 3300010400|Ga0134122_12202263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 595 | Open in IMG/M |
| 3300010401|Ga0134121_10775523 | Not Available | 918 | Open in IMG/M |
| 3300010403|Ga0134123_10075413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8 | 2611 | Open in IMG/M |
| 3300010403|Ga0134123_12678268 | Not Available | 566 | Open in IMG/M |
| 3300010403|Ga0134123_12716549 | Not Available | 563 | Open in IMG/M |
| 3300012015|Ga0120187_1028096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 634 | Open in IMG/M |
| 3300012679|Ga0136616_10016048 | All Organisms → cellular organisms → Bacteria | 3784 | Open in IMG/M |
| 3300012908|Ga0157286_10333996 | Not Available | 566 | Open in IMG/M |
| 3300012913|Ga0157298_10177594 | Not Available | 663 | Open in IMG/M |
| 3300012955|Ga0164298_10139086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1347 | Open in IMG/M |
| 3300013100|Ga0157373_10497182 | Not Available | 881 | Open in IMG/M |
| 3300013102|Ga0157371_10890299 | Not Available | 674 | Open in IMG/M |
| 3300013297|Ga0157378_11174419 | Not Available | 806 | Open in IMG/M |
| 3300013306|Ga0163162_11928518 | Not Available | 676 | Open in IMG/M |
| 3300013308|Ga0157375_13590478 | Not Available | 516 | Open in IMG/M |
| 3300014272|Ga0075327_1228479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 601 | Open in IMG/M |
| 3300014325|Ga0163163_11477584 | Not Available | 741 | Open in IMG/M |
| 3300014326|Ga0157380_10070930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2817 | Open in IMG/M |
| 3300014326|Ga0157380_13058081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 533 | Open in IMG/M |
| 3300014326|Ga0157380_13145909 | Not Available | 527 | Open in IMG/M |
| 3300014745|Ga0157377_10132099 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300014745|Ga0157377_11638604 | Not Available | 517 | Open in IMG/M |
| 3300014968|Ga0157379_10253742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1597 | Open in IMG/M |
| 3300015373|Ga0132257_101792867 | Not Available | 788 | Open in IMG/M |
| 3300015374|Ga0132255_103628900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 656 | Open in IMG/M |
| 3300015374|Ga0132255_106249657 | Not Available | 504 | Open in IMG/M |
| 3300018422|Ga0190265_10192086 | Not Available | 2043 | Open in IMG/M |
| 3300019361|Ga0173482_10622700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 546 | Open in IMG/M |
| 3300019377|Ga0190264_11911407 | Not Available | 539 | Open in IMG/M |
| 3300019487|Ga0187893_10658884 | Not Available | 654 | Open in IMG/M |
| 3300021445|Ga0182009_10056315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1681 | Open in IMG/M |
| 3300025904|Ga0207647_10012591 | All Organisms → cellular organisms → Bacteria | 5883 | Open in IMG/M |
| 3300025908|Ga0207643_10034060 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300025908|Ga0207643_10138731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
| 3300025908|Ga0207643_10146685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1412 | Open in IMG/M |
| 3300025911|Ga0207654_10710241 | Not Available | 722 | Open in IMG/M |
| 3300025911|Ga0207654_10991206 | Not Available | 611 | Open in IMG/M |
| 3300025911|Ga0207654_11058543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 591 | Open in IMG/M |
| 3300025923|Ga0207681_10166772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1665 | Open in IMG/M |
| 3300025924|Ga0207694_10001481 | All Organisms → cellular organisms → Bacteria | 20049 | Open in IMG/M |
| 3300025924|Ga0207694_11155742 | Not Available | 655 | Open in IMG/M |
| 3300025925|Ga0207650_10907615 | Not Available | 748 | Open in IMG/M |
| 3300025927|Ga0207687_11180757 | Not Available | 658 | Open in IMG/M |
| 3300025932|Ga0207690_11151626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 647 | Open in IMG/M |
| 3300025938|Ga0207704_10455759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1022 | Open in IMG/M |
| 3300025940|Ga0207691_10620544 | Not Available | 915 | Open in IMG/M |
| 3300025940|Ga0207691_11355473 | Not Available | 586 | Open in IMG/M |
| 3300025942|Ga0207689_10236265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1511 | Open in IMG/M |
| 3300025945|Ga0207679_11373091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 648 | Open in IMG/M |
| 3300025981|Ga0207640_11093184 | Not Available | 705 | Open in IMG/M |
| 3300026035|Ga0207703_11536291 | Not Available | 640 | Open in IMG/M |
| 3300026035|Ga0207703_11768576 | Not Available | 594 | Open in IMG/M |
| 3300026041|Ga0207639_10613878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1004 | Open in IMG/M |
| 3300026075|Ga0207708_11579432 | Not Available | 576 | Open in IMG/M |
| 3300026088|Ga0207641_11302459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 727 | Open in IMG/M |
| 3300026088|Ga0207641_12204223 | Not Available | 551 | Open in IMG/M |
| 3300026089|Ga0207648_10304651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1429 | Open in IMG/M |
| 3300026089|Ga0207648_10310783 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300026089|Ga0207648_10627134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 992 | Open in IMG/M |
| 3300026095|Ga0207676_10206689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1739 | Open in IMG/M |
| 3300026095|Ga0207676_10863100 | Not Available | 886 | Open in IMG/M |
| 3300026095|Ga0207676_11851779 | Not Available | 602 | Open in IMG/M |
| 3300026095|Ga0207676_12047127 | Not Available | 571 | Open in IMG/M |
| 3300026116|Ga0207674_10595434 | Not Available | 1068 | Open in IMG/M |
| 3300026312|Ga0209153_1233742 | Not Available | 602 | Open in IMG/M |
| 3300027326|Ga0209731_1011216 | Not Available | 1176 | Open in IMG/M |
| 3300027725|Ga0209178_1289912 | Not Available | 600 | Open in IMG/M |
| 3300027787|Ga0209074_10408405 | Not Available | 571 | Open in IMG/M |
| 3300028380|Ga0268265_10808677 | Not Available | 914 | Open in IMG/M |
| 3300028380|Ga0268265_10839522 | Not Available | 898 | Open in IMG/M |
| 3300028381|Ga0268264_10295099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1524 | Open in IMG/M |
| 3300028381|Ga0268264_11941665 | Not Available | 598 | Open in IMG/M |
| 3300031548|Ga0307408_101081072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 743 | Open in IMG/M |
| 3300032005|Ga0307411_11446209 | Not Available | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 13.21% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.18% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.26% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.63% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.63% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| CNAas_10012654 | 3300000532 | Quercus Rhizosphere | MRFLLGVLVGYTVRDKQKLLIKVLVTLLVVYVVLWAVVLPAITLLA |
| Ga0065705_111191701 | 3300005294 | Switchgrass Rhizosphere | MRFLLGVLVGYSLLGKQKLLIRFLVTLALVVYVVIPALALLGLSL |
| Ga0068869_1021003082 | 3300005334 | Miscanthus Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALL |
| Ga0070689_1008615511 | 3300005340 | Switchgrass Rhizosphere | MRFLLGVLVGYSLRGKQKSLIRVLVALLVVCVFLSAIVLPAIALLGLSIDVQRERRSRPAQTK |
| Ga0070689_1016864011 | 3300005340 | Switchgrass Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSR |
| Ga0070691_106780632 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRSRP |
| Ga0070687_1010201221 | 3300005343 | Switchgrass Rhizosphere | MRFLLGVLVGYTLRGKRKRLIKALVTLLVVCVVLSAVVLPAIALLAL |
| Ga0070661_1014888962 | 3300005344 | Corn Rhizosphere | MRFLLGVLLGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRP |
| Ga0070692_100223911 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQ |
| Ga0070692_113407622 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPALALLGLS |
| Ga0070669_1014384242 | 3300005353 | Switchgrass Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVIVPAIALLGLSIDVQRERRS |
| Ga0070705_1001474283 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVALALVVYVVIPTIALLALRLDVQRERRSRPAQIKV |
| Ga0070700_1003716741 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLIGYSLRGKQKLLIKFLVTLALVMYVIVPAIALLGLSI |
| Ga0068867_1002315771 | 3300005459 | Miscanthus Rhizosphere | MRFLLGVLVGYTVRGKHKLLIRVLVTLALVVYVIVPTIALLGLSIDVQRERRSRPAQTKV |
| Ga0068867_1014860271 | 3300005459 | Miscanthus Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDVQRERRSRPAQT |
| Ga0070706_1010055521 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKHKLLIRVLVTLALVVYVVLPAIALLALGIDVQ |
| Ga0070699_1000027351 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQTKVPV |
| Ga0068853_1002596672 | 3300005539 | Corn Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRER |
| Ga0068853_1020290132 | 3300005539 | Corn Rhizosphere | MRFLLGVLVGYTIRGKHKLLIKVLVTLLVVCVFVSAVVLPAIALLALRLDVQRERRSRPAQTKVP |
| Ga0068853_1020788621 | 3300005539 | Corn Rhizosphere | MRFLLGVFVGYTLRGKCKLLIKVLVTLLVVSVVLSAVVLP |
| Ga0070693_1009068462 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKLLIKVFVTLLVVCVVLSAVVLPAIA |
| Ga0070693_1009077411 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYFLRGKHKLLIRFLVTLALVVYVVIPAIALLALRLD |
| Ga0070693_1010727621 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYIVRGKRKLLIKVLVTLLVVCVFLSAVVLPAIALLALRFDVQRERRSRPV |
| Ga0070693_1015470962 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYTVRGKHKLLIAVLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQAKVPALK |
| Ga0068855_1020760252 | 3300005563 | Corn Rhizosphere | MRFLLGVLVGYTVRGKQRLLIRVLVTLALVVYVVLPAIALLELSLDVQR |
| Ga0068857_1014527871 | 3300005577 | Corn Rhizosphere | MRFLLGVLVGYSLRGKRKLLIKVLVTLLVVCVVLSAVVLPAIAL |
| Ga0068857_1024581001 | 3300005577 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDVQ |
| Ga0068852_1001742833 | 3300005616 | Corn Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRSRPAQ |
| Ga0068859_1026838721 | 3300005617 | Switchgrass Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRP |
| Ga0068864_1015428562 | 3300005618 | Switchgrass Rhizosphere | MRFLLGILVGYTLRGKQKLLIRFLVTLALIVYVVLPAIALLALGIDVQREAEKQRQA* |
| Ga0068851_102017001 | 3300005834 | Corn Rhizosphere | MRFILGVLVGYTVRGKHKLLIRVLVTLALVVYVVI |
| Ga0068851_102236141 | 3300005834 | Corn Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPVQT |
| Ga0068870_107358342 | 3300005840 | Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVIVPAIALLGLSIDVQR |
| Ga0068863_1018144301 | 3300005841 | Switchgrass Rhizosphere | MRSVLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPALALL |
| Ga0068863_1020329561 | 3300005841 | Switchgrass Rhizosphere | MRFLLGVLIGYTIRGKHTLLIKILVTLLVVCIVLSAVVIPAIAL |
| Ga0068858_1000634693 | 3300005842 | Switchgrass Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRER |
| Ga0068860_1003761681 | 3300005843 | Switchgrass Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDVQRERRSRPA |
| Ga0068860_1014512482 | 3300005843 | Switchgrass Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSID |
| Ga0068860_1019455702 | 3300005843 | Switchgrass Rhizosphere | MRFLLGVLVGYTVRGKYKLLIGFLVTLVVVVYIVLPAIALLALRLDVQRERRSRPAQ |
| Ga0068862_1024876531 | 3300005844 | Switchgrass Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPALALLGLSIDVQRERRSRPAQTKVPVI |
| Ga0068871_1006500671 | 3300006358 | Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALL |
| Ga0079217_102917442 | 3300006876 | Agricultural Soil | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIHVQRERRSR |
| Ga0079217_113461281 | 3300006876 | Agricultural Soil | MRFLLGVLVGYTVRGKRKLLIKVLVTLLVVCVVLSAVVLPATALLALRLDVQ |
| Ga0079215_109184472 | 3300006894 | Agricultural Soil | MRFLLGVLVGYALRGKQKLLIRFLVTLALVVYVIVPAIALLGLSIDVQRERRSRPPQ |
| Ga0079219_105168641 | 3300006954 | Agricultural Soil | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERR |
| Ga0079218_103958153 | 3300007004 | Agricultural Soil | MRFLLGVLVGYTVRGKQKLLVRFLVTLALVVYVVLPTIALLALSLDVQRERRTRPAQTKVPVLR |
| Ga0079218_136040041 | 3300007004 | Agricultural Soil | MRFLLGVLVGYTYEAQKLLIRVLVTLALVVYVVLPAIALL |
| Ga0105251_102475211 | 3300009011 | Switchgrass Rhizosphere | MRFLLGVLVGHTLRGQQKLLIKVIVTLLVVCVLLSAVVL |
| Ga0105240_116309961 | 3300009093 | Corn Rhizosphere | MRFLLGVLVGYTLRGKHKLLIGILVTLALVVYVVVPAIALFGLRIDVQRE |
| Ga0105247_104785961 | 3300009101 | Switchgrass Rhizosphere | MRFLLGVLVGYMLRGKQKLLIRFLVTLALVVYVVIPAIA |
| Ga0105247_117149581 | 3300009101 | Switchgrass Rhizosphere | MRFVLGVLVGYHVRGKHKLLIKVLVTLLVLYAVLLAVVL |
| Ga0105243_107167791 | 3300009148 | Miscanthus Rhizosphere | MRFLLGVLVGYFLRGKQKLLITFLVTLALVVYVVIPAIALLALRLDVQRERRSRPAQTK |
| Ga0111538_114188932 | 3300009156 | Populus Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVIVPAIALLGLRLDVQRERRSRPAQTKVPVLKG |
| Ga0075423_128144852 | 3300009162 | Populus Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDV |
| Ga0105241_107968091 | 3300009174 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALL |
| Ga0105241_116932811 | 3300009174 | Corn Rhizosphere | MRFLLGVLVGYTLRGKHKLLIRVLVTLLVVCVFVPAVVLPAIALLALRLDVQRERRSRPVQT |
| Ga0105241_120724671 | 3300009174 | Corn Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALLGLS |
| Ga0105242_117338331 | 3300009176 | Miscanthus Rhizosphere | MRFLLGVLVGYSLRGKQKSLIRVLVTLLVVCVVLSATVLPAIALL |
| Ga0105237_123156471 | 3300009545 | Corn Rhizosphere | MRFLLGVLVVYSLRGKQKLLIRFLVTLALVVYVVIPAL |
| Ga0105238_100037961 | 3300009551 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSIDV |
| Ga0105249_115151932 | 3300009553 | Switchgrass Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRSR |
| Ga0105249_126469512 | 3300009553 | Switchgrass Rhizosphere | MRFLLGVLVGYTVRGKHKLLIRVLVMLALVVYVVLPAIALLAVSIDVQRERRSRPVQTKVPALKG |
| Ga0126307_100631481 | 3300009789 | Serpentine Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALAL |
| Ga0126307_112869691 | 3300009789 | Serpentine Soil | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDVQRE |
| Ga0126307_116023042 | 3300009789 | Serpentine Soil | LVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSLDVQRERRSRQLKPRCQRSKD* |
| Ga0126304_111415692 | 3300010037 | Serpentine Soil | MRFLLGVLVGYILRGKQKLLIRFLATLALVVYVVIPAIALLGLSIDVQRERRSRPAQTKV |
| Ga0126315_105820191 | 3300010038 | Serpentine Soil | MRFLLGVLVGYSLRGKQKSLIRVLVTLLVVCVVLSAIVLPAIALLGLSIDVQRERRSR |
| Ga0126309_103868142 | 3300010039 | Serpentine Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSLD |
| Ga0126312_105667992 | 3300010041 | Serpentine Soil | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLS |
| Ga0126312_106810351 | 3300010041 | Serpentine Soil | MRFLLGVLVGYFLRGKRKLLIRFLVTLALVVYVVIPAI |
| Ga0126312_112039631 | 3300010041 | Serpentine Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQTKV |
| Ga0126311_100144334 | 3300010045 | Serpentine Soil | MRFLLGVLVGYTVRGKQKLLIRFLVTLALVVYVVIPAIALLA |
| Ga0126311_102312731 | 3300010045 | Serpentine Soil | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIA |
| Ga0126311_108527321 | 3300010045 | Serpentine Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVILPAIALLALSLDVQRERRSRPAQTKVPV |
| Ga0126382_113160541 | 3300010047 | Tropical Forest Soil | MRFLLGVLVGYTVRGKHKLLIRVLVTLALVVYVVLPAIALLAL |
| Ga0126306_108359361 | 3300010166 | Serpentine Soil | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAI |
| Ga0126376_128635971 | 3300010359 | Tropical Forest Soil | MRFLLGVPVGYTVRGKQKLLIAVLVTLLVVYVLLSAVVLPA |
| Ga0134125_116679462 | 3300010371 | Terrestrial Soil | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVI |
| Ga0134128_121886721 | 3300010373 | Terrestrial Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVIVPAIALLGLSIDVQRERRSRPAQTRVPVLK |
| Ga0134124_108633213 | 3300010397 | Terrestrial Soil | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQTKVPVV |
| Ga0134124_109891691 | 3300010397 | Terrestrial Soil | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVIVPAIALL |
| Ga0134124_118254051 | 3300010397 | Terrestrial Soil | MRFLLGVLVGYMLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLD |
| Ga0134124_122159641 | 3300010397 | Terrestrial Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDV |
| Ga0134127_101814253 | 3300010399 | Terrestrial Soil | MRFLLGVLVGYILRGKHKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRE |
| Ga0134127_116310891 | 3300010399 | Terrestrial Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPA |
| Ga0134122_122022631 | 3300010400 | Terrestrial Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQTRVPAVKG |
| Ga0134121_107755232 | 3300010401 | Terrestrial Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVI |
| Ga0134123_100754131 | 3300010403 | Terrestrial Soil | MRFLLGVLVGYMLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSLDVQRERRSRPA |
| Ga0134123_126782681 | 3300010403 | Terrestrial Soil | MRFVLGVLVGYTLRGKHKLLIGVLVTLALVVYVVIPALALLGLSIDVQRERRSRPT |
| Ga0134123_127165491 | 3300010403 | Terrestrial Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQ |
| Ga0120187_10280961 | 3300012015 | Terrestrial | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRSRPAQT |
| Ga0136616_100160486 | 3300012679 | Polar Desert Sand | MRFLLGVLVGYSMRGKQKLLIRVLATIPFIVYIIVPAIALLALRLDVQHE |
| Ga0157286_103339961 | 3300012908 | Soil | MRFLLGVLVGYTLRGKQKLLIKFLVTLALVVYVVIPAIALLGL |
| Ga0157298_101775942 | 3300012913 | Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAI |
| Ga0164298_101390863 | 3300012955 | Soil | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDVQRERRSRPSQTKVPVIK* |
| Ga0157373_104971821 | 3300013100 | Corn Rhizosphere | MRFLLGILVGYTLRGKQKLLIRFLVTLALIVYVVLPAIALLA |
| Ga0157371_108902991 | 3300013102 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGL |
| Ga0157378_111744192 | 3300013297 | Miscanthus Rhizosphere | MRFLLGVLVGYSLRGKHKLLIGVLVTLALVVYVVVPA |
| Ga0163162_119285181 | 3300013306 | Switchgrass Rhizosphere | MRFLLGVLVGYTLRRKHKLLIKVLVTLLVVCVVLSAVV |
| Ga0157375_135904782 | 3300013308 | Miscanthus Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTMALVVYVVIPALALLGLSIDVQRERRSRPVQ |
| Ga0075327_12284791 | 3300014272 | Natural And Restored Wetlands | MRFLLGVLVGYTVRGKHKLLIRVLVTLVLVVFVVLPAIALFALSLDVHVAAHLKV* |
| Ga0163163_114775841 | 3300014325 | Switchgrass Rhizosphere | MRFLLGVLVGYSLRGKQKLLVRFLVTLALVVYVVLPAIALLALSLDVQRERPSRTSSNQGASRQRTDL |
| Ga0157380_100709301 | 3300014326 | Switchgrass Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALLA |
| Ga0157380_130580811 | 3300014326 | Switchgrass Rhizosphere | MRFLLGVLVGYTVRGKQKLLIRVLVTLALVVYIVLPAIVFLGLSLDVQRERRSRPAQTKVPV |
| Ga0157380_131459091 | 3300014326 | Switchgrass Rhizosphere | MRFLLGVLVGYFIRGKQKLLIRFLVTLALVVYVVIPAIALLA |
| Ga0157377_101320991 | 3300014745 | Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKSLIRVLVTLALVVYVVIPATAL |
| Ga0157377_116386041 | 3300014745 | Miscanthus Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRSRPAQTKVPLLK |
| Ga0157379_102537421 | 3300014968 | Switchgrass Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALIVYVVIPAIALLGLSIDV |
| Ga0132257_1017928672 | 3300015373 | Arabidopsis Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQR |
| Ga0132255_1036289001 | 3300015374 | Arabidopsis Rhizosphere | MRFLLGVLVGYMLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQTK |
| Ga0132255_1062496571 | 3300015374 | Arabidopsis Rhizosphere | MRFLLGVLVGYTLRAKQKLLIRVLVALALVVYVVLPAIALLALSIDVQLER |
| Ga0190265_101920863 | 3300018422 | Soil | MRFLLGVLVGYTVRGKQKLLIRILVTLALVVYVVLPAIALLALSLDVQRERRSRPAQTKV |
| Ga0173482_106227001 | 3300019361 | Soil | MRFLLGVLVGYTVRGKHKRLIRVLVTLALVVYVVIPATALLALRFD |
| Ga0190264_119114071 | 3300019377 | Soil | MRFLLGVFVGYTLRGKQKLLIRFLVTLALFVYVVIPAIALLGLSIEVQRERRLDQL |
| Ga0187893_106588841 | 3300019487 | Microbial Mat On Rocks | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLG |
| Ga0182009_100563153 | 3300021445 | Soil | MRFLLGVLVGYTVRGKHKLLIRVLVMLALVVYVVLPAIALLAVSIDVQRE |
| Ga0207647_100125911 | 3300025904 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSIDVQRER |
| Ga0207643_100340604 | 3300025908 | Miscanthus Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIP |
| Ga0207643_101387313 | 3300025908 | Miscanthus Rhizosphere | MRFLLGVLVGYTVRGKHKLLIKVLVTLLVVCFVSAVVLPAIALLALRLDV |
| Ga0207643_101466853 | 3300025908 | Miscanthus Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPPQTKVPVV |
| Ga0207654_107102412 | 3300025911 | Corn Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERR |
| Ga0207654_109912061 | 3300025911 | Corn Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVIVPAIALLGL |
| Ga0207654_110585432 | 3300025911 | Corn Rhizosphere | MRFLLGVLVGYMLRGKQKLLIRFLVTLALVVYVVIPA |
| Ga0207681_101667723 | 3300025923 | Switchgrass Rhizosphere | MRFLLGVLVGYTVRGKYKLLIGFLVTLVVVVYIVLPAIALLALRL |
| Ga0207694_100014811 | 3300025924 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSIDVQRERWSRPAQ |
| Ga0207694_111557421 | 3300025924 | Corn Rhizosphere | MRFLLGVLVGYLLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRS |
| Ga0207650_109076151 | 3300025925 | Switchgrass Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPALALLGLSIDVQRE |
| Ga0207687_111807571 | 3300025927 | Miscanthus Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALIVYVVIP |
| Ga0207690_111516261 | 3300025932 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPAQTK |
| Ga0207704_104557592 | 3300025938 | Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALFVYVVIPALALLGLSLDVQRE |
| Ga0207691_106205441 | 3300025940 | Miscanthus Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRS |
| Ga0207691_113554731 | 3300025940 | Miscanthus Rhizosphere | MRFLLGVLVGYTVRGKHKLLIKLLVTLLVVYVVLSAVVLPAIAL |
| Ga0207689_102362651 | 3300025942 | Miscanthus Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRSRPAQTKVPTLKG |
| Ga0207679_113730911 | 3300025945 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPVQTKV |
| Ga0207640_110931841 | 3300025981 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDVQR |
| Ga0207703_115362911 | 3300026035 | Switchgrass Rhizosphere | MRFLLGVLVGYTVRGKQKLLIRVLVTLALVVYVVLPAITLLGLGIDV |
| Ga0207703_117685762 | 3300026035 | Switchgrass Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPTIALLALRLD |
| Ga0207639_106138781 | 3300026041 | Corn Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALA |
| Ga0207708_115794321 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLLGVLVGYTVRLKRKLLIKVLVMLLVVCLVLSAVV |
| Ga0207641_113024591 | 3300026088 | Switchgrass Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVI |
| Ga0207641_122042231 | 3300026088 | Switchgrass Rhizosphere | MRFLLGVLVGYTVRGKQRLLIRVLVTLALVVYVVL |
| Ga0207648_103046511 | 3300026089 | Miscanthus Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLS |
| Ga0207648_103107831 | 3300026089 | Miscanthus Rhizosphere | MRFLLGVLVGYTVRGKHKLLIRVLVTLALVVYVVIPAIALLALSL |
| Ga0207648_106271341 | 3300026089 | Miscanthus Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPALALLGLS |
| Ga0207676_102066891 | 3300026095 | Switchgrass Rhizosphere | MRFLLGVLVGYTVRGKHKLLIRVLVMLALVVYVVLPAIALLAVSIDVQRERR |
| Ga0207676_108631002 | 3300026095 | Switchgrass Rhizosphere | MRFLLGILVGYTLRGKQKLLIRFLVTLALIVYVVLPAIALLALGIDVQREAEKQRQA |
| Ga0207676_118517791 | 3300026095 | Switchgrass Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVIPAIALLALRLDVQRERRSRPAQIKV |
| Ga0207676_120471271 | 3300026095 | Switchgrass Rhizosphere | MRFLLGVLVGYSLRGKQKLLVRFLVTLALVVYVVLPAIA |
| Ga0207674_105954342 | 3300026116 | Corn Rhizosphere | MRFLLGVLVGYALRGKQKLLIRFLVTLALVVYVVIPAIALLGLSLDVQRE |
| Ga0209153_12337422 | 3300026312 | Soil | RGKQKLLIRFLVTLALVVYVVIPAIALLALHLDVQRERRSRPPQTKVPLLKGLT |
| Ga0209731_10112162 | 3300027326 | Forest Soil | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDV |
| Ga0209178_12899122 | 3300027725 | Agricultural Soil | MRFVLGVLVGYAVRGKQKPLIRVLVTLALVVYVVLPTIALLTLSLDVQRERRS |
| Ga0209074_104084051 | 3300027787 | Agricultural Soil | MRFLLGVLVGYTVRGKYKLLIGFLVTLVVVVYIVLPAIALL |
| Ga0268265_108086772 | 3300028380 | Switchgrass Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVIVPAIALL |
| Ga0268265_108395221 | 3300028380 | Switchgrass Rhizosphere | MRFLLGVLVGYFLRGKQKLLIRFLVTLALVVYVVI |
| Ga0268264_102950991 | 3300028381 | Switchgrass Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALVVYVVIPAIALLGLSLDVQRERR |
| Ga0268264_119416651 | 3300028381 | Switchgrass Rhizosphere | MRFLLGVLVGYTLRGKQKLLIRFLVTLALFVYVVIPALALLGLSLDVQRERRSRPA |
| Ga0307408_1010810722 | 3300031548 | Rhizosphere | MRFLLGVLVGYILRGKQKLLIRFLVTLALVVYVVIPAIALLGLSIDVQRERRSRPVQTR |
| Ga0307411_114462092 | 3300032005 | Rhizosphere | MRFLLGVLVGYSLRGKQKLLIRFLVTLALVVYVVIPALALLGLSLDVQRERRS |
| ⦗Top⦘ |