Basic Information | |
---|---|
Family ID | F041759 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 159 |
Average Sequence Length | 41 residues |
Representative Sequence | MAKLKITRADGSVSEHKITPRIEYAFELYAKKGFHKAFRD |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 159 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 95.54 % |
% of genes near scaffold ends (potentially truncated) | 98.74 % |
% of genes from short scaffolds (< 2000 bps) | 90.57 % |
Associated GOLD sequencing projects | 122 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (86.792 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.528 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.522 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.635 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 14.71% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 159 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 1.89 |
PF04586 | Peptidase_S78 | 1.26 |
PF04860 | Phage_portal | 1.26 |
PF03354 | TerL_ATPase | 0.63 |
COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.89 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.26 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.94 % |
Unclassified | root | N/A | 10.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000736|JGI12547J11936_1054659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300000756|JGI12421J11937_10048569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1391 | Open in IMG/M |
3300001523|JGI1221J15618_1112463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300001839|RCM40_1024966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300002098|JGI24219J26650_1002422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4799 | Open in IMG/M |
3300002206|metazooDRAFT_1332372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1045 | Open in IMG/M |
3300004481|Ga0069718_16124145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300005582|Ga0049080_10052782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
3300005662|Ga0078894_10226706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1693 | Open in IMG/M |
3300006005|Ga0073910_1002090 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
3300006484|Ga0070744_10151752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300006805|Ga0075464_10610159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300006805|Ga0075464_10657737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300006805|Ga0075464_10746436 | Not Available | 607 | Open in IMG/M |
3300006919|Ga0070746_10396542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300006920|Ga0070748_1087764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
3300006920|Ga0070748_1190174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300007304|Ga0102689_1768264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300007321|Ga0102692_1506558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300007534|Ga0102690_1633193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300007538|Ga0099851_1118588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
3300007559|Ga0102828_1194990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300007960|Ga0099850_1357406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300008264|Ga0114353_1240674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300008267|Ga0114364_1143217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300008450|Ga0114880_1209935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300008450|Ga0114880_1211330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300009026|Ga0102829_1059882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
3300009039|Ga0105152_10090131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
3300009151|Ga0114962_10021186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4590 | Open in IMG/M |
3300009151|Ga0114962_10493675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300009158|Ga0114977_10627496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300009161|Ga0114966_10406403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300009168|Ga0105104_10961567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300009181|Ga0114969_10157355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1423 | Open in IMG/M |
3300009181|Ga0114969_10158605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1416 | Open in IMG/M |
3300009183|Ga0114974_10457784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300009183|Ga0114974_10483307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300010334|Ga0136644_10693662 | Not Available | 553 | Open in IMG/M |
3300010354|Ga0129333_10713337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300010354|Ga0129333_11130618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300010354|Ga0129333_11753736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300010368|Ga0129324_10063841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1653 | Open in IMG/M |
3300010370|Ga0129336_10782458 | Not Available | 503 | Open in IMG/M |
3300010885|Ga0133913_13420782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
3300012663|Ga0157203_1045733 | Not Available | 596 | Open in IMG/M |
3300012702|Ga0157596_1110050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300012714|Ga0157601_1230960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300012715|Ga0157599_1045814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300012721|Ga0157612_1002279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300012725|Ga0157610_1059780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1862 | Open in IMG/M |
3300012729|Ga0157625_1278904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300013004|Ga0164293_11038527 | Not Available | 509 | Open in IMG/M |
3300013005|Ga0164292_10517644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1288108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10598816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300015360|Ga0163144_11739901 | Not Available | 531 | Open in IMG/M |
3300016683|Ga0180042_158308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
3300017716|Ga0181350_1115623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300017716|Ga0181350_1144959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300017722|Ga0181347_1069146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300017722|Ga0181347_1151059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300017722|Ga0181347_1166306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300017723|Ga0181362_1021383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
3300017723|Ga0181362_1028032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1201 | Open in IMG/M |
3300017754|Ga0181344_1011880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2781 | Open in IMG/M |
3300017754|Ga0181344_1048427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
3300017761|Ga0181356_1104734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300017774|Ga0181358_1168454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300017778|Ga0181349_1067776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
3300017780|Ga0181346_1257123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300017784|Ga0181348_1285378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300017784|Ga0181348_1298212 | Not Available | 541 | Open in IMG/M |
3300017785|Ga0181355_1235573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300017785|Ga0181355_1290542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300017785|Ga0181355_1299396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300019784|Ga0181359_1174769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300020084|Ga0194110_10609753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300020160|Ga0211733_11049552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300020172|Ga0211729_10877703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
3300020205|Ga0211731_10200340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300020525|Ga0207938_1034827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300020570|Ga0208465_1016823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300021961|Ga0222714_10389714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300021962|Ga0222713_10355904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300021962|Ga0222713_10652759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300021963|Ga0222712_10188636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1360 | Open in IMG/M |
3300022063|Ga0212029_1039644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300022179|Ga0181353_1032803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1376 | Open in IMG/M |
3300022190|Ga0181354_1115432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300022190|Ga0181354_1132326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300022190|Ga0181354_1140809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300022200|Ga0196901_1087697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300022407|Ga0181351_1087756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
3300022407|Ga0181351_1229872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300022407|Ga0181351_1253924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300022543|Ga0212119_1073177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300022748|Ga0228702_1117726 | Not Available | 607 | Open in IMG/M |
3300022752|Ga0214917_10237914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300023174|Ga0214921_10339302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300024346|Ga0244775_10056811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3391 | Open in IMG/M |
3300024348|Ga0244776_10567871 | Not Available | 721 | Open in IMG/M |
3300024481|Ga0256330_1042421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300024533|Ga0256299_1126443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300024859|Ga0255278_1056257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300025630|Ga0208004_1028394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
3300025635|Ga0208147_1058858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300027129|Ga0255067_1003186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2745 | Open in IMG/M |
3300027140|Ga0255080_1039204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300027631|Ga0208133_1024419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1541 | Open in IMG/M |
3300027644|Ga0209356_1003886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5637 | Open in IMG/M |
3300027659|Ga0208975_1135969 | Not Available | 693 | Open in IMG/M |
3300027688|Ga0209553_1271764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300027720|Ga0209617_10136255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300027734|Ga0209087_1099119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
3300027734|Ga0209087_1101118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300027734|Ga0209087_1218805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300027744|Ga0209355_1189044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300027756|Ga0209444_10006939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5946 | Open in IMG/M |
3300027759|Ga0209296_1277868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300027764|Ga0209134_10037885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1578 | Open in IMG/M |
3300027782|Ga0209500_10186830 | Not Available | 945 | Open in IMG/M |
3300027785|Ga0209246_10164952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300027785|Ga0209246_10196938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300027785|Ga0209246_10286036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300027808|Ga0209354_10251991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300027871|Ga0209397_10695652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300027900|Ga0209253_10769749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300027974|Ga0209299_1109771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300028392|Ga0304729_1132178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300031786|Ga0315908_10111492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2206 | Open in IMG/M |
3300031787|Ga0315900_11060276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300031857|Ga0315909_10023386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6155 | Open in IMG/M |
3300031857|Ga0315909_10067940 | All Organisms → Viruses → Predicted Viral | 3203 | Open in IMG/M |
3300031857|Ga0315909_10267965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1298 | Open in IMG/M |
3300032050|Ga0315906_10660843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300032093|Ga0315902_10504772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
3300032093|Ga0315902_10994468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300033981|Ga0334982_0276551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300033981|Ga0334982_0444725 | Not Available | 581 | Open in IMG/M |
3300033996|Ga0334979_0305671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300034012|Ga0334986_0545930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300034020|Ga0335002_0163329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
3300034023|Ga0335021_0321019 | Not Available | 826 | Open in IMG/M |
3300034051|Ga0335024_0610088 | Not Available | 521 | Open in IMG/M |
3300034062|Ga0334995_0481995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300034062|Ga0334995_0647159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300034063|Ga0335000_0093060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2073 | Open in IMG/M |
3300034073|Ga0310130_0313147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300034092|Ga0335010_0507020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300034093|Ga0335012_0052438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2355 | Open in IMG/M |
3300034106|Ga0335036_0089072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2284 | Open in IMG/M |
3300034108|Ga0335050_0428537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300034112|Ga0335066_0605278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300034122|Ga0335060_0332526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300034356|Ga0335048_0363380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300034356|Ga0335048_0397041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.13% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.32% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.55% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.03% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.14% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.14% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.89% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.89% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.26% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.26% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.26% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.26% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.63% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.63% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.63% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.63% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.63% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.63% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.63% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.63% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.63% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.63% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.63% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300016683 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024859 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12547J11936_10546591 | 3300000736 | Freshwater And Sediment | MAKLKITKADGSLSEHQITPSIEYAFELYAKKGFHKAF |
JGI12421J11937_100485691 | 3300000756 | Freshwater And Sediment | MARLKITRATGEVSEHQISPRIEYAFELYAKKGFHKAFR |
JGI1221J15618_11124631 | 3300001523 | Hypersaline | MAKLKITRTDGTTLDAEITLSAEYAFEQHFKKGFY |
RCM40_10249661 | 3300001839 | Marine Plankton | MRLKITRASGEETIHEISPVIEYAFESYAKKGFYRAFSED |
JGI24219J26650_10024221 | 3300002098 | Lentic | MATKLKITKISGEESIHDITPSIEFHFEQYAKKGFYK |
metazooDRAFT_13323724 | 3300002206 | Lake | MASLKITRADGTESNHEITPAIEYAFEQHAKKGFYKAFTEDQK |
Ga0069718_161241451 | 3300004481 | Sediment | MARLKITRADGNVSEHQITPRIEYAFELYAKKGFMKAFRDDEKQSDLYWLAHEC |
Ga0049080_100527825 | 3300005582 | Freshwater Lentic | MARLKITRANGEVTEHQITPRIEYAFELYAKKGFH |
Ga0078894_102267065 | 3300005662 | Freshwater Lake | MARLKITRATGEVSEHQISPRIEYAFELYAKKGFHKAFRDDE |
Ga0073910_10020901 | 3300006005 | Sand | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKAFRDD |
Ga0070744_101517521 | 3300006484 | Estuarine | MAKLKITRADGSVSEHKITPRIEYAFEQYAKKGFHKA |
Ga0075464_106101593 | 3300006805 | Aqueous | MAKLKITRADGSVSDHQITPSIEYAFEVYAKKGFHKAFRDD |
Ga0075464_106577372 | 3300006805 | Aqueous | MAKLKITRADGSVSDHQITPSIEFAFESYAKKGFHKAFRDDEKQS |
Ga0075464_107464362 | 3300006805 | Aqueous | MARLKITRATGEVTEHQISPRIEYAFELMAKKGFHKAFRDD |
Ga0070746_103965422 | 3300006919 | Aqueous | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAFRDDEKQSDVY |
Ga0070748_10877641 | 3300006920 | Aqueous | MAKLIVTMADNTVTEIEITPRLEYAFELYAKMGFHKAFRDL |
Ga0070748_11901743 | 3300006920 | Aqueous | MAKLKITRADGTVSEHPITPKIEWAFELYAKKGFHKAFRDDEKQSDV |
Ga0102689_17682641 | 3300007304 | Freshwater Lake | MAKLIVTTTDNSVTEIEITPRLEYAFELYAKKGFHRAFRDDEK |
Ga0102692_15065581 | 3300007321 | Freshwater Lake | MARLKVTRADGTESVHDITPAVEYAFEMHTKKGFYRAFQEDQKQSD |
Ga0102690_16331933 | 3300007534 | Freshwater Lake | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAFRDDEK |
Ga0099851_11185884 | 3300007538 | Aqueous | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAFRD |
Ga0102828_11949902 | 3300007559 | Estuarine | MVKLKITRADGSVSEHQITPRIQWAFELYAKKGFHKSFRDDEMQTSVFWLASE |
Ga0099850_13574062 | 3300007960 | Aqueous | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAF |
Ga0114353_12406744 | 3300008264 | Freshwater, Plankton | MARLKVTRADGTESIHEITPAVEYAFEMHTKKGFYRAFQ |
Ga0114364_11432173 | 3300008267 | Freshwater, Plankton | MAKLIVTMADNSVTNIEITPRLEYAFELYAKMGFHKAFRDLER |
Ga0114880_12099353 | 3300008450 | Freshwater Lake | MGMARLKVTRADGTESVHDITPAVEYAFEMHTKKGFYRAF |
Ga0114880_12113302 | 3300008450 | Freshwater Lake | MAKLIVTMTDGEVHNIEITPRLEYAFELYQKKGFHKAFAEDSMQS |
Ga0102829_10598821 | 3300009026 | Estuarine | MAKLKITRADGTVSEHQITPRIEYAFEVYAKKGFHKAFREDEKQSDVY |
Ga0105152_100901315 | 3300009039 | Lake Sediment | MAKLKITRADGAVTEHAVTPSIEYAFELYAKKGFH |
Ga0114962_100211861 | 3300009151 | Freshwater Lake | MARLKITLANGDVSDHRITPVIEYAFEQYSKKGFSRAFRED |
Ga0114962_104936753 | 3300009151 | Freshwater Lake | MASLKITRATGEESVFPITPVIEWAFELYAKKGFAKALM |
Ga0114977_106274962 | 3300009158 | Freshwater Lake | MAKLKITRVGGEVSEHQVTPAIEMAFERYAKKGFHKAFR |
Ga0114966_104064034 | 3300009161 | Freshwater Lake | MVKLKITRADGSVSEHQITPRIQWAFELYAKKGFHKSFRDDEMQ |
Ga0105104_109615672 | 3300009168 | Freshwater Sediment | MAKLIVTLADNSVTEIEITPRLEYAFELYAKKGFHKAFRD |
Ga0114969_101573555 | 3300009181 | Freshwater Lake | MARLKITRADGSVSEHQITPRIEYAFELYAKKGFHK |
Ga0114969_101586051 | 3300009181 | Freshwater Lake | MVKLKITRADGSVSEHQITPRIQWAFELYAKKGFHKSFRD |
Ga0114974_102642094 | 3300009183 | Freshwater Lake | MAKLKVTRADGSVNEYQITPAIEYAFEAYAKKGFHKAFRD |
Ga0114974_104577843 | 3300009183 | Freshwater Lake | MAKLKITRVGGEVSEHQVTPAIEMAFERYAKKGFHKAFRDD |
Ga0114974_104833071 | 3300009183 | Freshwater Lake | MAKLKVTRADGSVNEYQITPAIEYAFEAYAKKGFHKAFRDDEKQTDIYWLC |
Ga0136644_106936621 | 3300010334 | Freshwater Lake | MARLKITRANGDVTEHQITPSIEYSFEMYAKKGFAKAFAEDQQQSDI |
Ga0129333_107133374 | 3300010354 | Freshwater To Marine Saline Gradient | MAKLKITRADGSVSEHKITPRIEYAFELYAKKGFHKAFRD |
Ga0129333_111306181 | 3300010354 | Freshwater To Marine Saline Gradient | MARLKITRADGTESIHEITPVIEYAFEQHTKKGFYKA |
Ga0129333_117537361 | 3300010354 | Freshwater To Marine Saline Gradient | MARLKVTRADGSETVHEITPVIEYAFEQHTKKGFYRAF |
Ga0129324_100638415 | 3300010368 | Freshwater To Marine Saline Gradient | MARLMITRADGTESIHEITPVIEYAFEQHTKKGFY |
Ga0129336_107824582 | 3300010370 | Freshwater To Marine Saline Gradient | MASLKVVRADGTESIHEITTAIEFDFEQYAKKGFYRAFR |
Ga0133913_134207821 | 3300010885 | Freshwater Lake | MAKLRITKANGDVSEHAITPSIEYAFEMYAKKGFGKAFAEDQKQ |
Ga0157203_10457332 | 3300012663 | Freshwater | MARLKITRATGEVTEHQITPRIEYAFELYAKKGFHK |
Ga0157596_11100501 | 3300012702 | Freshwater | MARLKITRANGDITEHQITPRIEYAFELYAKKGFHKAFRDDEKQSDIYW |
Ga0157601_12309602 | 3300012714 | Freshwater | MARLKITRATGEVTEHQITPRIEYAFEIYAKKGFHKAFRDDE |
Ga0157599_10458141 | 3300012715 | Freshwater | MADNSVTDIEITPRLEYAFELYAKKGFHKAFRDDEKQ |
Ga0157612_10022791 | 3300012721 | Freshwater | MAKLIVKMIDNTEHEIEITPRLEYSFELYSKKGFHKSFR |
Ga0157610_10597806 | 3300012725 | Freshwater | MARLKITRATGEVTEHQITPRIEYAFEIYAKKGFHK |
Ga0157625_12789042 | 3300012729 | Freshwater | MARLKITRATGEVSEHQITPRIEYAFEIYAKKGFHKAFRDDE |
Ga0164293_110385272 | 3300013004 | Freshwater | MARLKITRATGEVTEHQITPRIEYAFEIYAKKGFH |
Ga0164292_105176441 | 3300013005 | Freshwater | MAKLKITRANGDVTEHQITPRIEYAFELYAKAGFHKVFRDLERQTDV |
(restricted) Ga0172374_12881082 | 3300013122 | Freshwater | MAKLKITRADGSVTEHKITPRIEYAFELYAKMGFHKAFRDLER |
(restricted) Ga0172372_105988163 | 3300013132 | Freshwater | MAKLKITRADGSVTEHKITPRIEYAFELMAKKGFHKAFRD |
Ga0163144_117399012 | 3300015360 | Freshwater Microbial Mat | MARLKITRASGETTEHQITPRIEYSFELYSKKGFH |
Ga0180042_1583085 | 3300016683 | Freshwater | MARLKITRATGEVSEHQISPRIEYAFELYAKKGFHKAFRD |
Ga0181350_11156233 | 3300017716 | Freshwater Lake | MADNTVTQIEITPRLEYAFELYAKKGFHKAFRDDEKQ |
Ga0181350_11449592 | 3300017716 | Freshwater Lake | MAKLKITRADGTISEHQVTPSIEYAFELYAKKGFHKAFRDDEKQ |
Ga0181347_10691464 | 3300017722 | Freshwater Lake | MAQLKITRADGSVSEHQITPRIEYAFELYAKKGFHKAFRDDEKQ |
Ga0181347_11510591 | 3300017722 | Freshwater Lake | MAILKITRADGSVSEHKITPRIEYAFELYAKKGFHKAFRDDEKQSD |
Ga0181347_11663062 | 3300017722 | Freshwater Lake | MAKLKITRADCTISEHQVTPSIEYAFELYAKKGFHKAFRDDEKQS |
Ga0181362_10213835 | 3300017723 | Freshwater Lake | MALLKITRADGSVSEHKITPRIEYAFELYAKKGFHKAFRD |
Ga0181362_10280325 | 3300017723 | Freshwater Lake | MAKLKITRANGDVTEHQITPRIEYAFELYAKMGFHKAFRDLERQT |
Ga0181344_10118806 | 3300017754 | Freshwater Lake | MAKLIVTMADNSVTEIEITPRLEYAFELYAKKGFH |
Ga0181344_10484275 | 3300017754 | Freshwater Lake | MAKLIVTLADNTVTEIEITPRLEYAFELYAKKGFHKAFRDD |
Ga0181356_11047344 | 3300017761 | Freshwater Lake | MAILKITRADGSVSEHKITPRIEYAFELYAKKGFHK |
Ga0181358_11684541 | 3300017774 | Freshwater Lake | MAKLIVTMADNSVTEIEITPRLEYSYELHHKKGFHKSMRDDEMQ |
Ga0181349_10677765 | 3300017778 | Freshwater Lake | MAKLIVKLADDSVIDIEITPRLEYAFELYAKMGFHKA |
Ga0181346_12571232 | 3300017780 | Freshwater Lake | MAQLKITRADGSISEHQITPRIEYAFELYAKKGFHKAFRDDEKQSDVY |
Ga0181348_12853782 | 3300017784 | Freshwater Lake | MALLKITRADGSVSEHKITPRIEYAFELYAKKGFHKAFRDDEKQSDV |
Ga0181348_12982122 | 3300017784 | Freshwater Lake | MAKLKITRADGSVSDHQITPRIEYAFELYAKAGFHKVFR |
Ga0181355_12355733 | 3300017785 | Freshwater Lake | MASLKITRADGTESLHEITPAIEYAFEQYSKKGFYKAFRE |
Ga0181355_12905422 | 3300017785 | Freshwater Lake | MARLKITRATGDVTEHQITPRIEWAFEQYAKKGFHKAFRDDEKQ |
Ga0181355_12993961 | 3300017785 | Freshwater Lake | MAQLKITRADGSVTEHKITPRIEYAFEQYAKKGFHKAF |
Ga0181359_11747691 | 3300019784 | Freshwater Lake | MAILKITRADGSVSEHKITPRIEYAFELYAKAGFHT |
Ga0194110_106097533 | 3300020084 | Freshwater Lake | MAKLKITRADGSVSEHKITPRIEYAFELYAKKGFQ |
Ga0211733_110495524 | 3300020160 | Freshwater | DQKRKGANTMAKLKITRADGTVSEHQITPKIEWAFELYAKKGFHKAFR |
Ga0211729_108777031 | 3300020172 | Freshwater | MARVKITRATGEVTEHQISPRIEYAFELYAKKGFHKAFRDDEKQ |
Ga0211731_102003401 | 3300020205 | Freshwater | MAKLKITRADGTVSEHPITPKIEWAFELYAKAGFHKVF |
Ga0207938_10348271 | 3300020525 | Freshwater | MAKLKITRATGEVTEHQITPAIEFAFEAYKGKGFHKAFRDDEK |
Ga0208465_10168234 | 3300020570 | Freshwater | MARLKVTRADGSESTHEITPVVEYAFEQHTKKGFYRAFQ |
Ga0222714_103897141 | 3300021961 | Estuarine Water | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFH |
Ga0222713_103559044 | 3300021962 | Estuarine Water | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKAFRDDEKQS |
Ga0222713_106527591 | 3300021962 | Estuarine Water | MAQLKITRADGSVSEHQITPRIEYAFELYAKKGFHKAFRDDEKQSDV |
Ga0222712_101886361 | 3300021963 | Estuarine Water | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAFRDD |
Ga0212029_10396441 | 3300022063 | Aqueous | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAFRDDETL |
Ga0181353_10328035 | 3300022179 | Freshwater Lake | MAKLVIKLSDDSVHNIEITPRLEYAFELYAKKGFHKA |
Ga0181354_11154324 | 3300022190 | Freshwater Lake | MAKLKITRANGDVTEHQITPRIEYAFELYAKKGFHKAFRDDEKQS |
Ga0181354_11323264 | 3300022190 | Freshwater Lake | MAQLKITRADGSVTEHKITPRIEYAFEQYAKKGFH |
Ga0181354_11408093 | 3300022190 | Freshwater Lake | MAQLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAF |
Ga0196901_10876974 | 3300022200 | Aqueous | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFH |
Ga0181351_10877565 | 3300022407 | Freshwater Lake | MARLKITRATGEISEHQISPRIEYAFELYAKKGFHKAFRDDEKQS |
Ga0181351_12298721 | 3300022407 | Freshwater Lake | MAKLIVTMADNSVTEIEITPRLEYAFELYAKKGFHK |
Ga0181351_12539241 | 3300022407 | Freshwater Lake | MAQLKITRADGSVSEHQITPRIEYAFELYAKKGFHKAFRDDEKQSD |
Ga0212119_10731772 | 3300022543 | Freshwater | MARLKITRANGEVTEHQITPRIEYAFELYAKKGFHKAFRDDEKQSD |
Ga0228702_11177261 | 3300022748 | Freshwater | MARLKITRATGEVSEHQITPRIEYAFELYAKKGFH |
Ga0214917_102379141 | 3300022752 | Freshwater | MAKLKITRADGSVSDHQITPSIEYAFEVYAKKGFHKAFRDDE |
Ga0214921_103393021 | 3300023174 | Freshwater | MAKLKITRADGTVSEHQITPKIEWAFELYAKKGFHKAFRDDE |
Ga0244775_100568111 | 3300024346 | Estuarine | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKAFRDDE |
Ga0244776_105678713 | 3300024348 | Estuarine | MARLKITRATGEVTEHQISPRIEYAFELYAKKGFHKAF |
Ga0256330_10424214 | 3300024481 | Freshwater | MAKLKITRADGQVQEYEITPLLEYSFEQYAKKGFHKALIEDSKQSD |
Ga0256299_11264432 | 3300024533 | Freshwater | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKAFRDDEKQS |
Ga0255278_10562571 | 3300024859 | Freshwater | MAKLKITRADGQVQEYEITPLLEYSFEQYAKKGFHK |
Ga0208004_10283941 | 3300025630 | Aqueous | MAKLKITRADGSVTEHKITPRIEYAFELYAKKGFHKA |
Ga0208147_10588584 | 3300025635 | Aqueous | MARLKITRSDGSVSEHQITPRIEYAFELYAKAGFHK |
Ga0255067_10031861 | 3300027129 | Freshwater | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKA |
Ga0255080_10392043 | 3300027140 | Freshwater | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKAF |
Ga0208133_10244191 | 3300027631 | Estuarine | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKAFR |
Ga0209356_10038868 | 3300027644 | Freshwater Lake | MARLKITRVTGEVTEHQITPRIEYAFELYAKQGFHKAFRLDEKQ |
Ga0208975_11359691 | 3300027659 | Freshwater Lentic | MAILKITRADGSVSEHKITPRIEYAFELYAKKGFHKAFR |
Ga0209553_12717642 | 3300027688 | Freshwater Lake | MAQLKITRADGSVTEHKITPRIEYAFEQYAKKGFHK |
Ga0209617_101362551 | 3300027720 | Freshwater And Sediment | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKAFRDEEK |
Ga0209087_10991195 | 3300027734 | Freshwater Lake | MAKLIVTLADDTVTEIEITPRLEYAFELYAKKGFHKAF |
Ga0209087_11011184 | 3300027734 | Freshwater Lake | MAKLKITRADGTVSEHQITPKIEWAFELYAKKGFHKAFRDDEKQ |
Ga0209087_12188051 | 3300027734 | Freshwater Lake | MAKLKITRANGDVTEHQITPRIEYAFELYAKAGFHKVFRDFER |
Ga0209355_11890444 | 3300027744 | Freshwater Lake | MAKLKITRADGTISEHQVTPSIEYAFELYAKKGFHKAFRD |
Ga0209444_100069398 | 3300027756 | Freshwater Lake | MAKLKITRADGSVSDHQITPSIEYAFEVYAKKGFHKAFRDDEKQSDV |
Ga0209296_12778681 | 3300027759 | Freshwater Lake | MAKLKVTRADGSVNEYQITPAIEYAFEAYAKKGFHKAFRDDEKQTDIYWLCW |
Ga0209134_100378855 | 3300027764 | Freshwater Lake | MAKLKITRADGSVSDHQITPSIEYAFEVYAKKGFHKAF |
Ga0209500_101868303 | 3300027782 | Freshwater Lake | MAKLKITRADGSVSEHQITPKIEWAFELYAKKGFHKAF |
Ga0209246_101649521 | 3300027785 | Freshwater Lake | MAILKITRADGSVSEHKITPRIEYAFELYAKKGFHKAFRDDE |
Ga0209246_101969381 | 3300027785 | Freshwater Lake | MAKLIVKLADDSVIDIEITPRLEYAFELYAKMGFHKAFRDLER |
Ga0209246_102860362 | 3300027785 | Freshwater Lake | MAQLKITRADGSVSEHQITPRIEYAFELYAKMGFHLAFRTLERQSD |
Ga0209354_102519913 | 3300027808 | Freshwater Lake | MAKLIVTLADNSVTEIEITPRLEYAFELYAKKGFHKAF |
Ga0209397_106956522 | 3300027871 | Wetland | MAKLIVTMADNSVTDIEITPRLEYAFELYAKKGFHKA |
Ga0209253_107697493 | 3300027900 | Freshwater Lake Sediment | MAKLKITRADGSVSDHQITPSIEYAFEVYAKKGFHKAFR |
Ga0209299_11097711 | 3300027974 | Freshwater Lake | MASLKITRATGEVTNHVITPAIEYAFELHAKGGFHKIFR |
Ga0304729_11321783 | 3300028392 | Freshwater Lake | MASLKITRATGEESVFPITPVIEWAFELYAKKGFAKAL |
Ga0315908_101114926 | 3300031786 | Freshwater | MARLKVTRADGSESIHEITPVVEYAFEQHTKKGFYRAFQED |
Ga0315900_110602762 | 3300031787 | Freshwater | MAKLIVTMTDGEVHNIEITPRLEYAFELYQKKGFHKAFAEDSMQSH |
Ga0315909_100233868 | 3300031857 | Freshwater | MAKLKITRATGEVTEHQITPRIEYAFELHVKKGFHRAFLEDSKQT |
Ga0315909_100679401 | 3300031857 | Freshwater | MAKLIVTMADNTVTEIEITPRLEYAFELYAKKGFHKAFR |
Ga0315909_102679651 | 3300031857 | Freshwater | MAKLIVTLADNSVTEIEITPRLEYAFELYAKKGFHK |
Ga0315906_106608431 | 3300032050 | Freshwater | MAKLIVTLADNSVTEIEITPRLEYAFELYAKKGFH |
Ga0315902_105047721 | 3300032093 | Freshwater | MAKLKITRVTGEVTEHQITPRIEYAFELHVKKGFH |
Ga0315902_109944682 | 3300032093 | Freshwater | MTDGAEHQIEITPRLEYAFELHHKKGFHRAFQEDAMQSMVYWLA |
Ga0334982_0276551_648_797 | 3300033981 | Freshwater | MYRLKITRATGEVSEHDITPRIEYLFELHTKKGFHKAFREDEKQGDLYYL |
Ga0334982_0444725_476_580 | 3300033981 | Freshwater | MARLKITRATGEVSEHQISPRIEYAFELYAKKGFH |
Ga0334979_0305671_1_120 | 3300033996 | Freshwater | MAKLKITRADGSVSDHQITPRIEYAFELYAKKGFHKAFRD |
Ga0334986_0545930_2_109 | 3300034012 | Freshwater | MAKLKITRADGEVSEHQITPRIEWAFELYAKAGFHK |
Ga0335002_0163329_1286_1426 | 3300034020 | Freshwater | MARLKITRATGEVSEHQISPRIEYAFELYAKKGFHKAFRDDEKQSDV |
Ga0335021_0321019_1_120 | 3300034023 | Freshwater | MARLKITRATGEVSEHQISPRIEYAFELYAKKGFMIRRPP |
Ga0335024_0610088_417_521 | 3300034051 | Freshwater | MARLKITRADGSVSEHQITPRIEYAFELYAKKGFM |
Ga0334995_0481995_1_123 | 3300034062 | Freshwater | MAKLIVTLADNSVTEIEITPRLEYAFELYAKKGFHKAFRDD |
Ga0334995_0647159_491_604 | 3300034062 | Freshwater | MAKLKVVRVDGSVNEYEVTPVIEYAFENYAKMGFHKAI |
Ga0335000_0093060_1927_2073 | 3300034063 | Freshwater | MARLKITRATGEVSEHQITPRIEYAFELYAKQGFHKAFRNEERQTDVYW |
Ga0310130_0313147_2_130 | 3300034073 | Fracking Water | MAKLKITRADGSVSDHQITPSIEYAFELHAKKGFHKAFRDDEK |
Ga0335010_0507020_522_632 | 3300034092 | Freshwater | MAKLIVTLADNSVTEIEITPRLEYAFELYAKKGFHKA |
Ga0335012_0052438_2_124 | 3300034093 | Freshwater | MARLKITRATGEVTEHQISPRIEYAFELYAKKGFHKAFRDD |
Ga0335036_0089072_2_109 | 3300034106 | Freshwater | MAKLKITRADGSVSDHQITPRIEYAFELNYKKGFHK |
Ga0335050_0428537_1_123 | 3300034108 | Freshwater | MARLKITRADGNVSEHQITPRIEYAFELYAKKGFMKAFRDD |
Ga0335066_0605278_461_565 | 3300034112 | Freshwater | MAKLKITRADGSVSEHQITPKIEWAFELYAKAGFH |
Ga0335060_0332526_1_129 | 3300034122 | Freshwater | MASLKVVRADGTESIHEITPAIEFAFESYAKKGFYRAFREDQK |
Ga0335013_0203099_1140_1313 | 3300034284 | Freshwater | MAKLKVTKVDGNVSEHQITPSIEYAFELYAKKGFHRAFREDEKQTDVYSSNAYSIDGV |
Ga0335048_0363380_2_124 | 3300034356 | Freshwater | MAKLKITKVDGSVSEHQVTPFIEYAFEIYAKQGFHAAFRIN |
Ga0335048_0397041_560_685 | 3300034356 | Freshwater | MAKLKITKADGSLSEHQITPSIEYAFELYAKKGFHKAFRDDE |
⦗Top⦘ |