| Basic Information | |
|---|---|
| Family ID | F041758 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.77 % |
| % of genes near scaffold ends (potentially truncated) | 35.22 % |
| % of genes from short scaffolds (< 2000 bps) | 84.91 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.264 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (15.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.057 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF06508 | QueC | 68.55 |
| PF01242 | PTPS | 1.89 |
| PF00085 | Thioredoxin | 1.89 |
| PF13385 | Laminin_G_3 | 1.26 |
| PF13472 | Lipase_GDSL_2 | 1.26 |
| PF03061 | 4HBT | 1.26 |
| PF03796 | DnaB_C | 0.63 |
| PF07460 | NUMOD3 | 0.63 |
| PF00154 | RecA | 0.63 |
| PF13202 | EF-hand_5 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 68.55 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 68.55 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 68.55 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 68.55 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 68.55 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 68.55 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 68.55 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 68.55 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 68.55 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.89 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.63 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.63 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.26 % |
| All Organisms | root | All Organisms | 37.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2200039875 | Not Available | 589 | Open in IMG/M |
| 3300000929|NpDRAFT_10268208 | Not Available | 506 | Open in IMG/M |
| 3300001968|GOS2236_1020523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1791 | Open in IMG/M |
| 3300002408|B570J29032_109042072 | Not Available | 575 | Open in IMG/M |
| 3300002408|B570J29032_109078337 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300002408|B570J29032_109374768 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 721 | Open in IMG/M |
| 3300002835|B570J40625_100076361 | All Organisms → cellular organisms → Bacteria | 4382 | Open in IMG/M |
| 3300002835|B570J40625_100082249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4146 | Open in IMG/M |
| 3300002835|B570J40625_100220375 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300002835|B570J40625_101024124 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 703 | Open in IMG/M |
| 3300003277|JGI25908J49247_10081152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 799 | Open in IMG/M |
| 3300004793|Ga0007760_10690918 | Not Available | 1101 | Open in IMG/M |
| 3300004810|Ga0007757_11397422 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 583 | Open in IMG/M |
| 3300004836|Ga0007759_11443205 | Not Available | 1422 | Open in IMG/M |
| 3300005581|Ga0049081_10106738 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1042 | Open in IMG/M |
| 3300006484|Ga0070744_10157918 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 649 | Open in IMG/M |
| 3300006802|Ga0070749_10162914 | Not Available | 1292 | Open in IMG/M |
| 3300006920|Ga0070748_1363612 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 509 | Open in IMG/M |
| 3300007555|Ga0102817_1014180 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300007555|Ga0102817_1074697 | Not Available | 742 | Open in IMG/M |
| 3300007559|Ga0102828_1162910 | Not Available | 562 | Open in IMG/M |
| 3300007630|Ga0102903_1160813 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 614 | Open in IMG/M |
| 3300007670|Ga0102862_1094438 | Not Available | 747 | Open in IMG/M |
| 3300007974|Ga0105747_1037509 | Not Available | 1393 | Open in IMG/M |
| 3300007974|Ga0105747_1266480 | Not Available | 575 | Open in IMG/M |
| 3300007992|Ga0105748_10095664 | Not Available | 1184 | Open in IMG/M |
| 3300007992|Ga0105748_10404351 | Not Available | 589 | Open in IMG/M |
| 3300008107|Ga0114340_1050790 | Not Available | 1814 | Open in IMG/M |
| 3300008107|Ga0114340_1162043 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1362 | Open in IMG/M |
| 3300008107|Ga0114340_1222074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 607 | Open in IMG/M |
| 3300008110|Ga0114343_1027891 | Not Available | 2863 | Open in IMG/M |
| 3300008113|Ga0114346_1007148 | Not Available | 6654 | Open in IMG/M |
| 3300008113|Ga0114346_1072139 | Not Available | 1652 | Open in IMG/M |
| 3300008113|Ga0114346_1168859 | Not Available | 1650 | Open in IMG/M |
| 3300008113|Ga0114346_1195984 | Not Available | 811 | Open in IMG/M |
| 3300008119|Ga0114354_1143362 | Not Available | 897 | Open in IMG/M |
| 3300008119|Ga0114354_1207584 | Not Available | 673 | Open in IMG/M |
| 3300008258|Ga0114840_1030430 | Not Available | 884 | Open in IMG/M |
| 3300008266|Ga0114363_1000106 | Not Available | 90035 | Open in IMG/M |
| 3300008266|Ga0114363_1113926 | Not Available | 951 | Open in IMG/M |
| 3300008266|Ga0114363_1130145 | Not Available | 861 | Open in IMG/M |
| 3300008266|Ga0114363_1212369 | Not Available | 582 | Open in IMG/M |
| 3300008267|Ga0114364_1000681 | Not Available | 29829 | Open in IMG/M |
| 3300008267|Ga0114364_1006643 | Not Available | 5712 | Open in IMG/M |
| 3300008267|Ga0114364_1016519 | Not Available | 3179 | Open in IMG/M |
| 3300008267|Ga0114364_1033806 | Not Available | 1972 | Open in IMG/M |
| 3300008267|Ga0114364_1069139 | Not Available | 1194 | Open in IMG/M |
| 3300008267|Ga0114364_1103800 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 879 | Open in IMG/M |
| 3300008267|Ga0114364_1168806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Fastidiosibacteraceae → Fangia → Fangia hongkongensis | 575 | Open in IMG/M |
| 3300008450|Ga0114880_1059908 | All Organisms → Viruses → Predicted Viral | 1578 | Open in IMG/M |
| 3300008450|Ga0114880_1243704 | Not Available | 566 | Open in IMG/M |
| 3300008996|Ga0102831_1061141 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1258 | Open in IMG/M |
| 3300009026|Ga0102829_1004523 | All Organisms → Viruses → Predicted Viral | 3815 | Open in IMG/M |
| 3300009056|Ga0102860_1142650 | Not Available | 675 | Open in IMG/M |
| 3300009059|Ga0102830_1236187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 534 | Open in IMG/M |
| 3300009068|Ga0114973_10060686 | Not Available | 2208 | Open in IMG/M |
| 3300009151|Ga0114962_10089758 | Not Available | 1932 | Open in IMG/M |
| 3300009159|Ga0114978_10210936 | Not Available | 1223 | Open in IMG/M |
| 3300009169|Ga0105097_10557851 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 643 | Open in IMG/M |
| 3300009181|Ga0114969_10298461 | Not Available | 951 | Open in IMG/M |
| 3300010885|Ga0133913_11755531 | Not Available | 1556 | Open in IMG/M |
| 3300010885|Ga0133913_13614748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1004 | Open in IMG/M |
| 3300011010|Ga0139557_1006512 | Not Available | 2410 | Open in IMG/M |
| 3300012013|Ga0153805_1044544 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 753 | Open in IMG/M |
| 3300012719|Ga0157600_1010382 | Not Available | 607 | Open in IMG/M |
| 3300012721|Ga0157612_1096035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 570 | Open in IMG/M |
| 3300012722|Ga0157630_1221891 | Not Available | 906 | Open in IMG/M |
| 3300012779|Ga0138284_1204679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 631 | Open in IMG/M |
| 3300013004|Ga0164293_10285149 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1151 | Open in IMG/M |
| 3300013004|Ga0164293_10542662 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 762 | Open in IMG/M |
| 3300013005|Ga0164292_10681538 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 657 | Open in IMG/M |
| 3300013006|Ga0164294_10017338 | Not Available | 5900 | Open in IMG/M |
| 3300013014|Ga0164295_10807351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 726 | Open in IMG/M |
| 3300013295|Ga0170791_14995670 | Not Available | 2733 | Open in IMG/M |
| 3300013372|Ga0177922_10584120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 550 | Open in IMG/M |
| 3300013372|Ga0177922_11096021 | Not Available | 507 | Open in IMG/M |
| 3300013372|Ga0177922_11122245 | Not Available | 527 | Open in IMG/M |
| 3300013372|Ga0177922_11169652 | Not Available | 561 | Open in IMG/M |
| 3300014042|Ga0117790_1064590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 599 | Open in IMG/M |
| 3300016691|Ga0180055_1109548 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 514 | Open in IMG/M |
| 3300017736|Ga0181365_1127300 | Not Available | 609 | Open in IMG/M |
| 3300017761|Ga0181356_1005546 | Not Available | 5043 | Open in IMG/M |
| 3300017761|Ga0181356_1099963 | Not Available | 945 | Open in IMG/M |
| 3300017774|Ga0181358_1280263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 514 | Open in IMG/M |
| 3300017777|Ga0181357_1264174 | Not Available | 594 | Open in IMG/M |
| 3300017780|Ga0181346_1266424 | Not Available | 593 | Open in IMG/M |
| 3300017785|Ga0181355_1268106 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 650 | Open in IMG/M |
| 3300019784|Ga0181359_1005064 | All Organisms → Viruses → Predicted Viral | 4251 | Open in IMG/M |
| 3300019784|Ga0181359_1007146 | All Organisms → Viruses → Predicted Viral | 3780 | Open in IMG/M |
| 3300019784|Ga0181359_1046580 | Not Available | 1675 | Open in IMG/M |
| 3300019784|Ga0181359_1188127 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 675 | Open in IMG/M |
| 3300019784|Ga0181359_1259382 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 522 | Open in IMG/M |
| 3300020141|Ga0211732_1350621 | Not Available | 753 | Open in IMG/M |
| 3300020151|Ga0211736_10716734 | Not Available | 891 | Open in IMG/M |
| 3300020159|Ga0211734_10638634 | Not Available | 767 | Open in IMG/M |
| 3300020159|Ga0211734_10676143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 650 | Open in IMG/M |
| 3300020160|Ga0211733_10886742 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 697 | Open in IMG/M |
| 3300020161|Ga0211726_10127547 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1486 | Open in IMG/M |
| 3300020161|Ga0211726_10555766 | Not Available | 678 | Open in IMG/M |
| 3300020162|Ga0211735_10063898 | Not Available | 980 | Open in IMG/M |
| 3300020162|Ga0211735_10711938 | Not Available | 9675 | Open in IMG/M |
| 3300020506|Ga0208091_1010918 | Not Available | 1128 | Open in IMG/M |
| 3300020506|Ga0208091_1023790 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 703 | Open in IMG/M |
| 3300020532|Ga0208601_1051036 | Not Available | 575 | Open in IMG/M |
| 3300020563|Ga0208082_1026893 | Not Available | 1129 | Open in IMG/M |
| 3300020573|Ga0208485_1020917 | Not Available | 1343 | Open in IMG/M |
| 3300021141|Ga0214163_1118262 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 598 | Open in IMG/M |
| 3300021961|Ga0222714_10082780 | Not Available | 2085 | Open in IMG/M |
| 3300021961|Ga0222714_10387186 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 742 | Open in IMG/M |
| 3300021961|Ga0222714_10425187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 696 | Open in IMG/M |
| 3300021961|Ga0222714_10450717 | Not Available | 669 | Open in IMG/M |
| 3300021962|Ga0222713_10131370 | Not Available | 1753 | Open in IMG/M |
| 3300021962|Ga0222713_10191082 | Not Available | 1378 | Open in IMG/M |
| 3300021962|Ga0222713_10205089 | Not Available | 1315 | Open in IMG/M |
| 3300021962|Ga0222713_10608793 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 636 | Open in IMG/M |
| 3300021963|Ga0222712_10073238 | All Organisms → Viruses | 2468 | Open in IMG/M |
| 3300021963|Ga0222712_10435828 | Not Available | 789 | Open in IMG/M |
| 3300022179|Ga0181353_1030924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1418 | Open in IMG/M |
| 3300022190|Ga0181354_1082317 | Not Available | 1061 | Open in IMG/M |
| 3300022190|Ga0181354_1159968 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 699 | Open in IMG/M |
| 3300022407|Ga0181351_1050552 | Not Available | 1736 | Open in IMG/M |
| 3300022407|Ga0181351_1148739 | Not Available | 845 | Open in IMG/M |
| 3300022407|Ga0181351_1190993 | Not Available | 694 | Open in IMG/M |
| 3300022407|Ga0181351_1235463 | Not Available | 582 | Open in IMG/M |
| 3300023179|Ga0214923_10003417 | Not Available | 19904 | Open in IMG/M |
| 3300023179|Ga0214923_10559775 | Not Available | 549 | Open in IMG/M |
| 3300024346|Ga0244775_10158565 | Not Available | 1908 | Open in IMG/M |
| 3300024346|Ga0244775_10160858 | Not Available | 1893 | Open in IMG/M |
| 3300024346|Ga0244775_10458331 | Not Available | 1044 | Open in IMG/M |
| 3300024348|Ga0244776_10355537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 984 | Open in IMG/M |
| 3300024348|Ga0244776_10752315 | Not Available | 595 | Open in IMG/M |
| 3300024861|Ga0256312_1100927 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 615 | Open in IMG/M |
| 3300024863|Ga0255246_1010047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1955 | Open in IMG/M |
| 3300024863|Ga0255246_1111779 | Not Available | 637 | Open in IMG/M |
| 3300026454|Ga0256319_1065996 | Not Available | 713 | Open in IMG/M |
| 3300027186|Ga0208797_1041857 | Not Available | 585 | Open in IMG/M |
| 3300027193|Ga0208800_1043187 | Not Available | 611 | Open in IMG/M |
| 3300027631|Ga0208133_1051243 | Not Available | 998 | Open in IMG/M |
| 3300027798|Ga0209353_10411006 | Not Available | 553 | Open in IMG/M |
| 3300031784|Ga0315899_10782087 | Not Available | 876 | Open in IMG/M |
| 3300031787|Ga0315900_10076604 | All Organisms → Viruses | 3369 | Open in IMG/M |
| 3300031787|Ga0315900_10248645 | Not Available | 1521 | Open in IMG/M |
| 3300031951|Ga0315904_10853110 | Not Available | 742 | Open in IMG/M |
| 3300031999|Ga0315274_10634864 | Not Available | 1171 | Open in IMG/M |
| 3300032092|Ga0315905_11243839 | Not Available | 604 | Open in IMG/M |
| 3300032116|Ga0315903_10669334 | Not Available | 782 | Open in IMG/M |
| 3300033981|Ga0334982_0205155 | Not Available | 972 | Open in IMG/M |
| 3300033984|Ga0334989_0447379 | Not Available | 654 | Open in IMG/M |
| 3300033993|Ga0334994_0161538 | All Organisms → Viruses → Predicted Viral | 1249 | Open in IMG/M |
| 3300033996|Ga0334979_0113018 | Not Available | 1678 | Open in IMG/M |
| 3300034019|Ga0334998_0325084 | Not Available | 905 | Open in IMG/M |
| 3300034061|Ga0334987_0808329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 521 | Open in IMG/M |
| 3300034096|Ga0335025_0043702 | Not Available | 2967 | Open in IMG/M |
| 3300034096|Ga0335025_0237825 | Not Available | 1005 | Open in IMG/M |
| 3300034102|Ga0335029_0302628 | Not Available | 1008 | Open in IMG/M |
| 3300034104|Ga0335031_0337440 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 967 | Open in IMG/M |
| 3300034104|Ga0335031_0470769 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 771 | Open in IMG/M |
| 3300034104|Ga0335031_0754427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 551 | Open in IMG/M |
| 3300034116|Ga0335068_0051408 | Not Available | 2413 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.09% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 13.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.29% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.77% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.52% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.26% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.63% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.63% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.63% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.63% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.63% |
| Epidermal Mucus | Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014042 | Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter) | Host-Associated | Open in IMG/M |
| 3300016691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES124 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024861 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200254531 | 2199352005 | Freshwater | DINPAYEAEIKKVLDAIWENRFRLSLSNLEQLRRLANKTKL |
| NpDRAFT_102682082 | 3300000929 | Freshwater And Marine | MEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL*INKQYYH* |
| GOS2236_10205233 | 3300001968 | Marine | MNTKKPMKDINSAWEAEIKKQLDAIWENRYRLSLANVELLRRLANKTRL* |
| B570J29032_1090420721 | 3300002408 | Freshwater | AWEAEIKKALDAIWENRFRMNLNNLEKLRKLANKTKL* |
| B570J29032_1090783372 | 3300002408 | Freshwater | MSPVDINPVYEAEIKKLLDALWENRFRLSLSNLEQLRRLANKTKL* |
| B570J29032_1093747683 | 3300002408 | Freshwater | PMMDINSAWEAEIKKTLDALWENRFRLSLSNLELLRRLSNKTKL* |
| B570J40625_10007636110 | 3300002835 | Freshwater | MEKIDINPAWEAEIKKALDAIWENRFRMNLNNLEKLRKLANKTKL* |
| B570J40625_1000822494 | 3300002835 | Freshwater | MKKIDINPAYEAEIKKVLDAIWENRFRLSLSNLEQLRRLANKTKL* |
| B570J40625_1002203752 | 3300002835 | Freshwater | MQKIDINSAYEAEIKKVLDAIWENRFRINLNNLEKLRKLANKTKL* |
| B570J40625_1010241243 | 3300002835 | Freshwater | SKPMMDINSAWEAEIKKTLDALWENRFRLSLSNLELLRRLSNKTKL* |
| JGI25908J49247_100811524 | 3300003277 | Freshwater Lake | MXPIDINPAYEAEXKKLLDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0007760_106909182 | 3300004793 | Freshwater Lake | MQKIDISSAYEAEIKKVLDAIWENRFRINLNNLEKLRKLANKTKL* |
| Ga0007757_113974222 | 3300004810 | Freshwater Lake | MSPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0007759_114432053 | 3300004836 | Freshwater Lake | MQKIDISSAYEAEIKKVLDAIWENRFRINLNNLEKLRKLANKIKL* |
| Ga0049081_101067382 | 3300005581 | Freshwater Lentic | MKKIDINPAWEAEIKKVLDAIWENRFRMSLSNLEKLRKLANKTKL* |
| Ga0070744_101579183 | 3300006484 | Estuarine | MEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLELLRKLANKTRL* |
| Ga0070749_101629143 | 3300006802 | Aqueous | MSPVDINPAYEAEIKKLLDALWENRFRLSVTNLEMLRRLANKTKL* |
| Ga0070748_13636122 | 3300006920 | Aqueous | MKPVDINPAYEAEIKKLLDAIWENRFRMSVNNVELLRRLANKTKL* |
| Ga0102817_10141806 | 3300007555 | Estuarine | FLIMEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLELLRKLANKTRL* |
| Ga0102817_10746973 | 3300007555 | Estuarine | MKDINPVWENEIKKVLDAVWENRYRLSLENLKILRRLANKTRL* |
| Ga0102828_11629101 | 3300007559 | Estuarine | MEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0102903_11608132 | 3300007630 | Estuarine | MKKIDINPAYEAEIKKILDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0102862_10944382 | 3300007670 | Estuarine | SPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0105747_10375092 | 3300007974 | Estuary Water | MSPIDINPVYEAEIKKLLDAIWENRFRLSLSNLELLRKLTNKTRL* |
| Ga0105747_12664802 | 3300007974 | Estuary Water | MEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLEQLRKLANKTRL* |
| Ga0105748_100956642 | 3300007992 | Estuary Water | MEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLEQLRKLANKTKL* |
| Ga0105748_104043511 | 3300007992 | Estuary Water | MKPVDINPAYEAEIKKLLDALWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0114340_10507902 | 3300008107 | Freshwater, Plankton | MSPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL* |
| Ga0114340_11620432 | 3300008107 | Freshwater, Plankton | MSPIDINPAYEAEIKKLLDAVWENRFRLSVKNLEMLRKLANKTKL* |
| Ga0114340_12220741 | 3300008107 | Freshwater, Plankton | MKDINPAWEAEIKKQLDAIWENRYRLSLSNLEMLCRLANKTKL* |
| Ga0114343_10278915 | 3300008110 | Freshwater, Plankton | MKPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL* |
| Ga0114346_10071483 | 3300008113 | Freshwater, Plankton | MEMNSAWEAEIKKTLDALWENRHRLSLANVELLRRFANKTRL* |
| Ga0114346_10721394 | 3300008113 | Freshwater, Plankton | MKPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTK |
| Ga0114346_11688591 | 3300008113 | Freshwater, Plankton | MNPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTK |
| Ga0114346_11959842 | 3300008113 | Freshwater, Plankton | MKPIDINPAYEAEIKKLLDAIWENRFRISVNNLEMLRRLANKTKL* |
| Ga0114354_11433622 | 3300008119 | Freshwater, Plankton | MSPIDINPAYEAEIKKLLDAIWENRFRMSLSNLEQLRRLANKTKL* |
| Ga0114354_12075841 | 3300008119 | Freshwater, Plankton | MNPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL* |
| Ga0114840_10304301 | 3300008258 | Freshwater, Plankton | IDINPAYEAEIKKALDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0114363_100010691 | 3300008266 | Freshwater, Plankton | MKKPMKDINPAWEAEIKKQLDAIWENRYRLSLSNLEMLCRLANKTKL* |
| Ga0114363_11139264 | 3300008266 | Freshwater, Plankton | MKDINPAWEAEIKKQLDPIWENRYRLSLSNLEMLCRLANKTKL* |
| Ga0114363_11301452 | 3300008266 | Freshwater, Plankton | GSFLMSPIDINPAYEAEIKKLLDAIWENRFRMSLSNLEQLRRLANKTKL* |
| Ga0114363_12123692 | 3300008266 | Freshwater, Plankton | MEKIDINPAWEAEIKKVLDAIWENRFRMSLSNLEKLRKLANKTKL* |
| Ga0114364_100068132 | 3300008267 | Freshwater, Plankton | MEKIDINPAWEAEIKKVLDAIWENRFRMNLNNLEKLRKLANKTKL* |
| Ga0114364_10066433 | 3300008267 | Freshwater, Plankton | MSPIDINPAYEAEIKKALDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0114364_10165197 | 3300008267 | Freshwater, Plankton | MKDINPVWENEIKKLLDSVWENRFRLSLSNLELLRKLANKTRL* |
| Ga0114364_10338065 | 3300008267 | Freshwater, Plankton | MSPVDINPAYEAEIKKLLDALWENRFRLSLSNLELLRRLANKTKL* |
| Ga0114364_10691392 | 3300008267 | Freshwater, Plankton | MANMSPADINPAYEAEIKKVLDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0114364_11038001 | 3300008267 | Freshwater, Plankton | PAYEAEIKKLLDALWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0114364_11688063 | 3300008267 | Freshwater, Plankton | IKSTVNMSPIDINPAYEAEIKKLLDAVWENRFRLSVKNLEMLRKLANKTKL* |
| Ga0114880_10599081 | 3300008450 | Freshwater Lake | AYEAEIKKALDAIWENRYRLSLSNLEQLRRLANKTKL* |
| Ga0114880_12437041 | 3300008450 | Freshwater Lake | MKKIDINPAYEAEIKKALDAIWENRYRLSLSNLEQLRRLANKTKL* |
| Ga0102831_10611413 | 3300008996 | Estuarine | MKKIDINPAWEAEIKKALDAIWENRFRMSLSNLEKLRKLANKTKL* |
| Ga0102829_10045234 | 3300009026 | Estuarine | MKDINPVWENEIKKVLDAVWENRYHLSLENLKILRRLANKTRL* |
| Ga0102860_11426502 | 3300009056 | Estuarine | MSPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEQIRRLANKTKL* |
| Ga0102830_12361872 | 3300009059 | Estuarine | VYEAEIKKLLDAIWENRFRLSLSNLEQLRKLANKTKL* |
| Ga0114973_100606865 | 3300009068 | Freshwater Lake | MKDINPVWENEIKKVLDSVWENRYRLSLENLEKLRRLANKTKL* |
| Ga0114962_100897583 | 3300009151 | Freshwater Lake | MKDINPVWENEIKKVLDSVWENRFRLSLSNLEQLRRLADKTKL* |
| Ga0114978_102109364 | 3300009159 | Freshwater Lake | MKDINPVWENEIKKVLDSVWENRYRLSLSNLEQLRRLANKTKL* |
| Ga0105097_105578512 | 3300009169 | Freshwater Sediment | MTEINSAWEAEIKKTLDALWENRYRLSLANVELLRRFANKTKL* |
| Ga0114969_102984612 | 3300009181 | Freshwater Lake | MKDINPAWEAEIKKTLDALWENRYRLSLANVELLRKFANKTKL* |
| Ga0133913_117555315 | 3300010885 | Freshwater Lake | MEKIDISSAYEAEIKKVLDAIWENRFRINLNNLEKLRKLANKTKL* |
| Ga0133913_136147483 | 3300010885 | Freshwater Lake | MKDINPVWENEIKKLLDTIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0139557_10065125 | 3300011010 | Freshwater | MSPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRKLANKTRL* |
| Ga0153805_10445442 | 3300012013 | Surface Ice | MKKQIEMNSAWEAEIKKQLDNIWKNRHRLSLANLEMLHRLANKTKL* |
| Ga0157600_10103822 | 3300012719 | Freshwater | AEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL* |
| Ga0157612_10960351 | 3300012721 | Freshwater | KQFWRKGFGNTNWSYSMKPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL* |
| Ga0157630_12218912 | 3300012722 | Freshwater | MNPIDINPAYEAEIKKILDAIWENRFRISLSNLEQLRRLANKTKL* |
| Ga0138284_12046793 | 3300012779 | Freshwater Lake | MSPVYINPAYEAEIKKLLYALWENRFRLILSNLEQLRRLANKTKL* |
| Ga0164293_102851491 | 3300013004 | Freshwater | KPMKDINPAWEAEIKKQLDAIWENRYRLSLSNLELLCRLANKTKL* |
| Ga0164293_105426621 | 3300013004 | Freshwater | PSKPMMDINSAWEAEIKKTLDALWENRFRLSLSNLELLRRLANKTKL* |
| Ga0164292_106815382 | 3300013005 | Freshwater | MKDINPAWEAEIKKTLDALWENRYRLSLENLKMLRRLANKTKL* |
| Ga0164294_100173389 | 3300013006 | Freshwater | MKDINPAWEAEIKKVLDEIWENRYRLSLENLKMLRRLANKTKL* |
| Ga0164295_108073512 | 3300013014 | Freshwater | MKDINPAWEAEIKKTLDALWENRYRLSLANVELLRRFANKTKL* |
| Ga0170791_149956707 | 3300013295 | Freshwater | MSPIDINPAYEAEIKKLLDALWENRFRMSLSNLEQLRRLANKTKL* |
| Ga0177922_105841202 | 3300013372 | Freshwater | MSPIDINPAYEAEIKKLLDAIWENRFRISVNNLEMLRRLANKTKL* |
| Ga0177922_110960211 | 3300013372 | Freshwater | MSPIDINPVYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0177922_111222452 | 3300013372 | Freshwater | MSPVDINPAYEAEIKKLLDAVWENRFRLSLSNLEQLRRLANKTKL* |
| Ga0177922_111696523 | 3300013372 | Freshwater | MQKIDINPAWEAEIKKVLDAIWENRFRMSLSNLEKLRKLANKTKL* |
| Ga0117790_10645902 | 3300014042 | Epidermal Mucus | MNKPMKDINPVWEAEIKKLLDKIWENRYRLSLGNIENLRRLANKTKL* |
| Ga0180055_11095482 | 3300016691 | Freshwater | MKPIDTNPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL |
| Ga0181365_11273002 | 3300017736 | Freshwater Lake | AYEAEIKKLLDAVWENRFRLSVKNLEMLRKLANKTKL |
| Ga0181356_10055462 | 3300017761 | Freshwater Lake | MEKIDINPAWEAEIKKVLDAIWENRFRMNLNNLEKLRKLANKIKL |
| Ga0181356_10999631 | 3300017761 | Freshwater Lake | NPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL |
| Ga0181358_12802631 | 3300017774 | Freshwater Lake | IDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL |
| Ga0181357_12641743 | 3300017777 | Freshwater Lake | MKPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANK |
| Ga0181346_12664241 | 3300017780 | Freshwater Lake | MKPIDINPAYEAEIKKLLDAIWENRFRISVNNLEMLRRLANKTKL |
| Ga0181355_12681063 | 3300017785 | Freshwater Lake | PMSPVDINPAYEAEIKKLLDALWENRFRLSLSNLELLRRLSNKTKL |
| Ga0181359_10050642 | 3300019784 | Freshwater Lake | MNPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL |
| Ga0181359_100714610 | 3300019784 | Freshwater Lake | MQKIDISSAYEAEIKKVLDAIWENRFRINLNNLEKLRKLANKTKL |
| Ga0181359_10465802 | 3300019784 | Freshwater Lake | MEKIDINPAWEAEIKKVLDAIWENRFRMNLNNLEKLRKLANKTKL |
| Ga0181359_11881272 | 3300019784 | Freshwater Lake | MSPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEKLRRLANKTKL |
| Ga0181359_12593822 | 3300019784 | Freshwater Lake | MKPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL |
| Ga0211732_13506212 | 3300020141 | Freshwater | YRKNCWSFLMSPIDINPAYEAEIKKLLDAIWENRFRMSLSNLEQLRRLANKTKL |
| Ga0211736_107167342 | 3300020151 | Freshwater | NMSPVDINPAYEAEIKKLLDAVWENRFRMSVKNLEMLRKLANKTKL |
| Ga0211734_106386342 | 3300020159 | Freshwater | NPAYEAEIKKLLDAIWENRFRLSVKNLGMLRKLANKTKL |
| Ga0211734_106761432 | 3300020159 | Freshwater | MSPIDINPAYEAEIKKLLDAIWENRFRMSLSNLEQLRRLANKTKL |
| Ga0211733_108867422 | 3300020160 | Freshwater | MNPIDINPAYEAEIKKLLDAIWENRFRMSLSNLEQLRRLANKTKL |
| Ga0211726_101275472 | 3300020161 | Freshwater | MKKIDINPAWEAEIKKVLDAIWENRFRMSLSNLEKLRKLANKTKL |
| Ga0211726_105557664 | 3300020161 | Freshwater | MSPVDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLA |
| Ga0211735_100638982 | 3300020162 | Freshwater | MSPVDINPAYEAEIKKLLDAVWENRFRMSVKNLEMLRKLANKTKL |
| Ga0211735_107119387 | 3300020162 | Freshwater | MEKIDINPAWEAEIKKALDAIWENRFRINLNNLEKLRKLANKTKL |
| Ga0208091_10109181 | 3300020506 | Freshwater | MDINSAWEAEIKKTLDALWENRFRLSLSNLELLRRLSNKTKL |
| Ga0208091_10237902 | 3300020506 | Freshwater | MSPVDINPVYEAEIKKLLDALWENRFRLSLSNLEQLRRLANKTKL |
| Ga0208601_10510363 | 3300020532 | Freshwater | MEKIDINPAWEAEIKKALDAIWENRFRMNLNNLEKLRKLA |
| Ga0208082_10268931 | 3300020563 | Freshwater | MKKIDINPAYEAEIKKVLDAIWENRFRLSLSNLEQLRRLANK |
| Ga0208485_10209172 | 3300020573 | Freshwater | MQKIDINSAYEAEIKKVLDAIWENRFRINLNNLEKLRKLANKTKL |
| Ga0214163_11182622 | 3300021141 | Freshwater | SAWEAEIKKTLDALWENRFRLSLTNVELLRRLSNKTRKR |
| Ga0222714_100827805 | 3300021961 | Estuarine Water | MEMNSAWEAEIKKQLDNIWEKRHHLSLANLEMLRRLANKTKL |
| Ga0222714_103871863 | 3300021961 | Estuarine Water | MEKIDINPAYEAEIKKLLDAIWENRFRMSLSNLELLRRLANKTKL |
| Ga0222714_104251873 | 3300021961 | Estuarine Water | MKDINPAWEAEIKKQLDAIWENRYRLSLANLEMLRRLANKTKL |
| Ga0222714_104507171 | 3300021961 | Estuarine Water | VNMSPIDINPAYEAEIKKLLDAVWENRFRMSVKNLEMLRKLANKTKL |
| Ga0222713_101313705 | 3300021962 | Estuarine Water | MKKIEMNSAWEAEIKKQLDAIWENRHRLSLANLEMLRRLSNKTKL |
| Ga0222713_101910823 | 3300021962 | Estuarine Water | MSPININPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0222713_102050892 | 3300021962 | Estuarine Water | MSPIDINPAYEAEIKKLLDAVWENRFRMSVKNLEMLRKLANKTKL |
| Ga0222713_106087933 | 3300021962 | Estuarine Water | MKKIDINPVYEAEIKKQLDAIWENRYRLSLANLEMLRRLANKTKL |
| Ga0222712_100732387 | 3300021963 | Estuarine Water | KKIDINPVYEAEIKKQLDAIWENRYRLSLANLEMLRRLANKTKL |
| Ga0222712_104358282 | 3300021963 | Estuarine Water | MEKIDINPAYEAEIKKLLDAIWENRFRINLNNLEKLRKLANKTKL |
| Ga0181353_10309244 | 3300022179 | Freshwater Lake | MNSAWEAEIKKQLDNIWKNRHRLSLANLEMLHRLANKTKL |
| Ga0181354_10823172 | 3300022190 | Freshwater Lake | WSFSMKPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL |
| Ga0181354_11599682 | 3300022190 | Freshwater Lake | MKKQIEMNSAWEAEIKKQLDNIWKNRHRLSLANLEMLHRLANKTKL |
| Ga0181351_10505521 | 3300022407 | Freshwater Lake | MSPIDINSAYEAEIKKALDAIWENRFRMSVKNLEMLRKLA |
| Ga0181351_11487392 | 3300022407 | Freshwater Lake | SNWSFSMSPVDINPAYEAEIKKLLDALWENRFRLSLSNLEQLRRLANKTKL |
| Ga0181351_11909931 | 3300022407 | Freshwater Lake | MSPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANK |
| Ga0181351_12354631 | 3300022407 | Freshwater Lake | AYEAEIKKLLDAIWENRFRISVNNLEMLRRLANKTKL |
| Ga0214923_100034178 | 3300023179 | Freshwater | MKPVDINPAYEAEIKKLLDAIWENRFRMSVNNVELLRRLANKTKL |
| Ga0214923_105597752 | 3300023179 | Freshwater | FLRTRFRNSNWSFLMKPVDINPAYEAEIKKQLDAIWENRFRLSVNNVELLRRLANKTKL |
| Ga0244775_101585655 | 3300024346 | Estuarine | MKKIDINPAWEAEIKKALDAIWENRFRMSLSNLEKLRKLANKTKL |
| Ga0244775_101608584 | 3300024346 | Estuarine | MSPIDINPVYEAEIKKLLDAIWENRFRLSLSNLELLRKLANKTRL |
| Ga0244775_104583313 | 3300024346 | Estuarine | MEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLELLRKLANKTRL |
| Ga0244776_103555373 | 3300024348 | Estuarine | MEKIDINPAWEAEIKKALDAIWENRFRMSLSNLEKLRKLANKTKL |
| Ga0244776_107523151 | 3300024348 | Estuarine | KIDINPAYEAEIKKILDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0256312_11009272 | 3300024861 | Freshwater | MSPIDINPAYEAEIKKLLDAIWENRFRISVNNVEMLRRLANKTKL |
| Ga0255246_10100476 | 3300024863 | Freshwater | YEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0255246_11117792 | 3300024863 | Freshwater | PIDINPAYEAEIKKLLDAVWENRFRLSVKNLEMLRKLANKTKL |
| Ga0256319_10659961 | 3300026454 | Freshwater | IDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0208797_10418572 | 3300027186 | Estuarine | FLIMEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0208800_10431873 | 3300027193 | Estuarine | MEKIDINPVYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0208133_10512432 | 3300027631 | Estuarine | KIDINPVYEAEIKKLLDAIWENRFRLSLSNLELLRKLANKTRL |
| Ga0209353_104110062 | 3300027798 | Freshwater Lake | PAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0315899_107820874 | 3300031784 | Freshwater | MSPVDINPAYEAEIKKLLDALWENRFRLSLSNLELLRRLANKTKL |
| Ga0315900_100766043 | 3300031787 | Freshwater | MKKPMKDINPAWEAEIKKQLDAIWENRYRLSLSNLEMLCRLANKTKL |
| Ga0315900_102486453 | 3300031787 | Freshwater | MKDINPAWEAEIKKQLDAIWENRYRLSLSNLEMLCRLANKTKL |
| Ga0315904_108531102 | 3300031951 | Freshwater | KPMMDINSAWEAEIKKTLDALWENRFRLSLTNVELLRRLSNKTRL |
| Ga0315274_106348643 | 3300031999 | Sediment | NNGSFLMSPIDINPAYEAEIKKLLDAIWENRFRLSLSNLEQLRRLADKTRL |
| Ga0315905_112438391 | 3300032092 | Freshwater | MSPIDINPAYEAEIKKLLDAIWENRFRISVNNLEMLRRLA |
| Ga0315903_106693344 | 3300032116 | Freshwater | MKKQIEMNSAWEAEIKKQLDNIWKNRHRLSLANLEMLHRLA |
| Ga0334982_0205155_645_776 | 3300033981 | Freshwater | MMDINSAWEAEIKKTLDALWENRFRLSLTNVELLRRLSNKTRL |
| Ga0334989_0447379_433_570 | 3300033984 | Freshwater | MKKIDINPAYEAEIKKILDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0334994_0161538_150_287 | 3300033993 | Freshwater | MEKIDINPAWEAEIKKALDAIWENRFRMNLNNLEKLRKLANKTKL |
| Ga0334979_0113018_489_620 | 3300033996 | Freshwater | MMDINSAWEAEIKKTLDALWENRFRLSLSNLELLRRLSNKTRL |
| Ga0334998_0325084_781_903 | 3300034019 | Freshwater | INSAWEAEIKKTLDALWENRFRLSLTNVELLRRLSNKTRL |
| Ga0334987_0808329_381_521 | 3300034061 | Freshwater | MKKLIEMNSAWEAEIKKQLDNIWKNRHRLSLANLEMLHRLANKTKL |
| Ga0335025_0043702_130_261 | 3300034096 | Freshwater | MKDINPAWEAEIKKQLDAIWENRYRLSLSNLELLCRLANKTKL |
| Ga0335025_0237825_873_1004 | 3300034096 | Freshwater | MEKIDINPAWEAEIKKALDAIWENRFRMNLNNLEKLRKLANKTK |
| Ga0335029_0302628_41_178 | 3300034102 | Freshwater | MEKIDSNPAWEAEIKKVLDAIWENRFRMSLSNLEKLRKLANKTKL |
| Ga0335031_0337440_232_363 | 3300034104 | Freshwater | MMDINSAWEAEIKKTLDALWENRFRLSLSNLELLRRLANKTKL |
| Ga0335031_0470769_2_139 | 3300034104 | Freshwater | MSPVDINPAYEAEIKKVLDAIWENRFRLSLSNLEQLRRLANKTKL |
| Ga0335031_0754427_434_550 | 3300034104 | Freshwater | DPAYEAEIKKIIDALWENRFNLNLRNLETLHKFANKRH |
| Ga0335068_0051408_491_631 | 3300034116 | Freshwater | MKNQPPMNPAWENEIKKQLDKIWENKYCLSLSNLEMLRRLAYKTKL |
| ⦗Top⦘ |