| Basic Information | |
|---|---|
| Family ID | F041621 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 42 residues |
| Representative Sequence | KKLPVMDIVTHRFPLDRIQEGLELAARPTAESLKILITHA |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.11 % |
| % of genes from short scaffolds (< 2000 bps) | 88.05 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.088 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.755 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.931 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.088 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 14.71% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 90.57 |
| PF00494 | SQS_PSY | 4.40 |
| PF01593 | Amino_oxidase | 2.52 |
| PF03401 | TctC | 0.63 |
| PF13450 | NAD_binding_8 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 4.40 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.09 % |
| Unclassified | root | N/A | 45.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10425295 | Not Available | 637 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100341102 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300002915|JGI25387J43893_1008233 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300003224|JGI26344J46810_1025438 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300004082|Ga0062384_100776301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 667 | Open in IMG/M |
| 3300004139|Ga0058897_10814030 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300004631|Ga0058899_12266609 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005180|Ga0066685_10720009 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005434|Ga0070709_10369513 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005541|Ga0070733_10985093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 566 | Open in IMG/M |
| 3300005555|Ga0066692_10906703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 540 | Open in IMG/M |
| 3300005566|Ga0066693_10350218 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005574|Ga0066694_10041353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2081 | Open in IMG/M |
| 3300005575|Ga0066702_10375692 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005921|Ga0070766_10739304 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006102|Ga0075015_100906822 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006162|Ga0075030_101292932 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006871|Ga0075434_101021891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 840 | Open in IMG/M |
| 3300007258|Ga0099793_10309108 | Not Available | 769 | Open in IMG/M |
| 3300007265|Ga0099794_10529513 | Not Available | 621 | Open in IMG/M |
| 3300007265|Ga0099794_10633327 | Not Available | 567 | Open in IMG/M |
| 3300009038|Ga0099829_10671378 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300009088|Ga0099830_10941558 | Not Available | 715 | Open in IMG/M |
| 3300009088|Ga0099830_11717172 | Not Available | 524 | Open in IMG/M |
| 3300009090|Ga0099827_11738946 | Not Available | 543 | Open in IMG/M |
| 3300009176|Ga0105242_10053682 | All Organisms → cellular organisms → Bacteria | 3292 | Open in IMG/M |
| 3300009792|Ga0126374_10014228 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300010095|Ga0127475_1085529 | Not Available | 519 | Open in IMG/M |
| 3300010105|Ga0127470_1110589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300010304|Ga0134088_10014417 | All Organisms → cellular organisms → Bacteria | 3424 | Open in IMG/M |
| 3300010343|Ga0074044_10576765 | Not Available | 734 | Open in IMG/M |
| 3300010358|Ga0126370_11210778 | Not Available | 703 | Open in IMG/M |
| 3300010358|Ga0126370_11302378 | Not Available | 681 | Open in IMG/M |
| 3300010360|Ga0126372_12710513 | Not Available | 547 | Open in IMG/M |
| 3300010376|Ga0126381_101397836 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300011120|Ga0150983_11616128 | Not Available | 569 | Open in IMG/M |
| 3300011120|Ga0150983_15088196 | Not Available | 560 | Open in IMG/M |
| 3300011120|Ga0150983_15270843 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300011269|Ga0137392_10879354 | Not Available | 738 | Open in IMG/M |
| 3300011269|Ga0137392_11523553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300011271|Ga0137393_11227617 | Not Available | 636 | Open in IMG/M |
| 3300012096|Ga0137389_10832106 | Not Available | 792 | Open in IMG/M |
| 3300012189|Ga0137388_10020188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4987 | Open in IMG/M |
| 3300012198|Ga0137364_10473317 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300012202|Ga0137363_11554021 | Not Available | 553 | Open in IMG/M |
| 3300012205|Ga0137362_10125335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2180 | Open in IMG/M |
| 3300012205|Ga0137362_11253540 | Not Available | 626 | Open in IMG/M |
| 3300012349|Ga0137387_11325624 | Not Available | 502 | Open in IMG/M |
| 3300012361|Ga0137360_10937317 | Not Available | 747 | Open in IMG/M |
| 3300012372|Ga0134037_1000717 | Not Available | 590 | Open in IMG/M |
| 3300012382|Ga0134038_1067205 | Not Available | 500 | Open in IMG/M |
| 3300012683|Ga0137398_10072550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2103 | Open in IMG/M |
| 3300012918|Ga0137396_10517469 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012918|Ga0137396_10836162 | Not Available | 676 | Open in IMG/M |
| 3300012924|Ga0137413_10832625 | Not Available | 711 | Open in IMG/M |
| 3300012925|Ga0137419_10467040 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300012927|Ga0137416_12240169 | Not Available | 503 | Open in IMG/M |
| 3300012960|Ga0164301_10030914 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
| 3300014155|Ga0181524_10446047 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300014157|Ga0134078_10148576 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300014165|Ga0181523_10015991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5142 | Open in IMG/M |
| 3300014201|Ga0181537_10366445 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300015053|Ga0137405_1016840 | Not Available | 521 | Open in IMG/M |
| 3300015054|Ga0137420_1486386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4652 | Open in IMG/M |
| 3300015241|Ga0137418_10704221 | Not Available | 774 | Open in IMG/M |
| 3300016294|Ga0182041_12079362 | Not Available | 529 | Open in IMG/M |
| 3300016404|Ga0182037_10205466 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300016445|Ga0182038_10786476 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300017822|Ga0187802_10393690 | Not Available | 548 | Open in IMG/M |
| 3300017926|Ga0187807_1205486 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300017932|Ga0187814_10436161 | Not Available | 513 | Open in IMG/M |
| 3300017934|Ga0187803_10128681 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300017943|Ga0187819_10017695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4114 | Open in IMG/M |
| 3300017966|Ga0187776_11102062 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018090|Ga0187770_10998808 | Not Available | 673 | Open in IMG/M |
| 3300018433|Ga0066667_10974477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300019789|Ga0137408_1401276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300020579|Ga0210407_10213468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300020582|Ga0210395_10474589 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300021168|Ga0210406_10214756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1591 | Open in IMG/M |
| 3300021168|Ga0210406_10231172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300021168|Ga0210406_10400466 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300021171|Ga0210405_10564622 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300021171|Ga0210405_10682506 | Not Available | 795 | Open in IMG/M |
| 3300021180|Ga0210396_10589561 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300021401|Ga0210393_11299524 | Not Available | 583 | Open in IMG/M |
| 3300021403|Ga0210397_10167142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1550 | Open in IMG/M |
| 3300021405|Ga0210387_10063407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3004 | Open in IMG/M |
| 3300021406|Ga0210386_10747499 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300021420|Ga0210394_11399950 | Not Available | 595 | Open in IMG/M |
| 3300021474|Ga0210390_10993543 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300021477|Ga0210398_11401224 | Not Available | 546 | Open in IMG/M |
| 3300021559|Ga0210409_11437656 | Not Available | 565 | Open in IMG/M |
| 3300022504|Ga0242642_1042856 | Not Available | 687 | Open in IMG/M |
| 3300022508|Ga0222728_1085880 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300022523|Ga0242663_1069985 | Not Available | 654 | Open in IMG/M |
| 3300022531|Ga0242660_1229363 | Not Available | 521 | Open in IMG/M |
| 3300022726|Ga0242654_10322261 | Not Available | 574 | Open in IMG/M |
| 3300024251|Ga0247679_1000819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5573 | Open in IMG/M |
| 3300024330|Ga0137417_1281801 | Not Available | 643 | Open in IMG/M |
| 3300025906|Ga0207699_11193932 | Not Available | 563 | Open in IMG/M |
| 3300025939|Ga0207665_10557503 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300026041|Ga0207639_11277114 | Not Available | 689 | Open in IMG/M |
| 3300026295|Ga0209234_1079989 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300026295|Ga0209234_1239594 | Not Available | 594 | Open in IMG/M |
| 3300026304|Ga0209240_1015807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2881 | Open in IMG/M |
| 3300026304|Ga0209240_1254708 | Not Available | 537 | Open in IMG/M |
| 3300026313|Ga0209761_1318609 | Not Available | 532 | Open in IMG/M |
| 3300026323|Ga0209472_1026209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2714 | Open in IMG/M |
| 3300026334|Ga0209377_1297838 | Not Available | 536 | Open in IMG/M |
| 3300026334|Ga0209377_1345849 | Not Available | 501 | Open in IMG/M |
| 3300026481|Ga0257155_1062902 | Not Available | 590 | Open in IMG/M |
| 3300026490|Ga0257153_1100804 | Not Available | 573 | Open in IMG/M |
| 3300026515|Ga0257158_1066279 | Not Available | 684 | Open in IMG/M |
| 3300026557|Ga0179587_10322123 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300026839|Ga0207764_108731 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300027071|Ga0209214_1039805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300027173|Ga0208097_1018075 | Not Available | 790 | Open in IMG/M |
| 3300027401|Ga0208637_1041656 | Not Available | 538 | Open in IMG/M |
| 3300027671|Ga0209588_1045627 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300027674|Ga0209118_1196173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300027767|Ga0209655_10123136 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300027795|Ga0209139_10312607 | Not Available | 552 | Open in IMG/M |
| 3300027825|Ga0209039_10430987 | Not Available | 500 | Open in IMG/M |
| 3300027855|Ga0209693_10275898 | Not Available | 822 | Open in IMG/M |
| 3300027874|Ga0209465_10274158 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300027875|Ga0209283_10649628 | Not Available | 664 | Open in IMG/M |
| 3300027882|Ga0209590_10973936 | Not Available | 530 | Open in IMG/M |
| 3300028047|Ga0209526_10380183 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300028879|Ga0302229_10240973 | Not Available | 820 | Open in IMG/M |
| 3300030494|Ga0310037_10398996 | Not Available | 570 | Open in IMG/M |
| 3300030618|Ga0311354_10928873 | Not Available | 809 | Open in IMG/M |
| 3300030738|Ga0265462_11142317 | Not Available | 688 | Open in IMG/M |
| 3300030848|Ga0075388_11170048 | Not Available | 559 | Open in IMG/M |
| 3300030878|Ga0265770_1070678 | Not Available | 666 | Open in IMG/M |
| 3300031590|Ga0307483_1012170 | Not Available | 771 | Open in IMG/M |
| 3300031640|Ga0318555_10384841 | Not Available | 760 | Open in IMG/M |
| 3300031715|Ga0307476_10252008 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300031715|Ga0307476_10873838 | Not Available | 664 | Open in IMG/M |
| 3300031715|Ga0307476_11251580 | Not Available | 542 | Open in IMG/M |
| 3300031718|Ga0307474_10327751 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300031718|Ga0307474_10876250 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031753|Ga0307477_10134851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1723 | Open in IMG/M |
| 3300031771|Ga0318546_11088890 | Not Available | 562 | Open in IMG/M |
| 3300031805|Ga0318497_10556304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300031823|Ga0307478_10100398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2240 | Open in IMG/M |
| 3300031879|Ga0306919_10330728 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300031890|Ga0306925_10090521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3248 | Open in IMG/M |
| 3300031893|Ga0318536_10492152 | Not Available | 617 | Open in IMG/M |
| 3300031945|Ga0310913_10016142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4577 | Open in IMG/M |
| 3300031945|Ga0310913_10100989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1951 | Open in IMG/M |
| 3300031962|Ga0307479_10535181 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300031962|Ga0307479_10609581 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300031962|Ga0307479_10792306 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300032205|Ga0307472_102480582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300032261|Ga0306920_101646488 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300032756|Ga0315742_13093760 | Not Available | 536 | Open in IMG/M |
| 3300033547|Ga0316212_1046814 | Not Available | 614 | Open in IMG/M |
| 3300033983|Ga0371488_0070960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2039 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.14% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010095 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_104252952 | 3300001661 | Forest Soil | VLKKKLPVMEIVTHRFPLARIQEGLDLAVKPTAESLKILVTHA* |
| JGIcombinedJ26739_1003411021 | 3300002245 | Forest Soil | KLPVRDIVTHRFPLDRIQEGLNLAAQPTAESLKILITHA* |
| JGI25387J43893_10082332 | 3300002915 | Grasslands Soil | EGADLVLKKKLPVMDIVTHRFPLARIQQGLDLAAKPTEESLKILITHA* |
| JGI26344J46810_10254381 | 3300003224 | Bog Forest Soil | KKKLPVMEIVTHRFPLDRIQEGLELAARPTVESLKILITHA* |
| Ga0062384_1007763012 | 3300004082 | Bog Forest Soil | SAAADIQEEAAALVLRKKLPVLDIVSHIYTLDRIQEALELANRPTVDSLKILIAHGR* |
| Ga0058897_108140301 | 3300004139 | Forest Soil | KLPVMEIVTHRFPLDKIQEGLELAARPTAESLKILITHA* |
| Ga0058899_122666091 | 3300004631 | Forest Soil | KKLPVMDIVTHRFPLARIQEGLELAARPTVESLKILITHA* |
| Ga0066685_107200092 | 3300005180 | Soil | DSAADLVLRKRLPVMQIVTHRFPLARIQEALDLAAHPTEESLKILVTHE* |
| Ga0070709_103695131 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | KLPVMDIVTHRFPLDRIQEGLELAAHPTDDSLKILITHK* |
| Ga0070733_109850931 | 3300005541 | Surface Soil | VDIQDTAAALVLGKKLPVTDIVTHRFPLARIQEGLDLAAHPTESSLKILITHE* |
| Ga0066692_109067032 | 3300005555 | Soil | VLKKKLPVLEIVTHRFPLARIQEGLELATKPTAESLKILITHA* |
| Ga0066693_103502182 | 3300005566 | Soil | MDIVTHRFPLARIQEGLDLAAKPTAESLKILITHT* |
| Ga0066694_100413531 | 3300005574 | Soil | KLPVMDIVTHRFPLDSIQEALELAARPTAESLKVLITHA* |
| Ga0066702_103756922 | 3300005575 | Soil | ALVLHKKLPVMDIVTHRFPLDKIQAALELAARPTAQSLKILITHS* |
| Ga0070766_107393041 | 3300005921 | Soil | RKLPVMEIVTHRFPLDRIQEALDLAARPTAESLKILITHA* |
| Ga0075015_1009068221 | 3300006102 | Watersheds | PVMEIVTHRFPLDKIQEGLELAAQPTAASLKILITHA* |
| Ga0075030_1012929322 | 3300006162 | Watersheds | DTAGALVLQKKLPVMDIVTHRFPLDRIQQALELAARPTAQSLKILITHT* |
| Ga0075434_1010218911 | 3300006871 | Populus Rhizosphere | VDIQESAAALVLEKKLPVMDIVTHRFPLGRIQEGLDLAVRPTEDSLKILITHA* |
| Ga0099793_103091081 | 3300007258 | Vadose Zone Soil | LVLKKKLPVMDIVTHRFPLARIQEGLNLAAKPTAESLKILITHA* |
| Ga0099794_105295132 | 3300007265 | Vadose Zone Soil | VLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTAESLKILITHA* |
| Ga0099794_106333271 | 3300007265 | Vadose Zone Soil | KKLPVMDIVTHRFPLDRIQEGLELAAHPTEDSLKILITHK* |
| Ga0099829_106713781 | 3300009038 | Vadose Zone Soil | KKLPVMDIVTHRFPLDRIQEGLELAARPTAESLKILITHA* |
| Ga0099830_109415582 | 3300009088 | Vadose Zone Soil | MEIVTHRFPLDRIQEGLELAAHPTSESLKILITHA* |
| Ga0099830_117171721 | 3300009088 | Vadose Zone Soil | MDIVTHRFPLDRIQEGLELAARPTADSLKILITHA* |
| Ga0099827_117389461 | 3300009090 | Vadose Zone Soil | KKLPVMEIVTHRFPLARIQEGLDLAAKPTAESLKILITHA* |
| Ga0105242_100536821 | 3300009176 | Miscanthus Rhizosphere | VMEIFTHRFPLARIQEGLELAAKPTAESLKVLITHE* |
| Ga0126374_100142283 | 3300009792 | Tropical Forest Soil | DIVTHRFPLDKIQEGLDLAVRPTAQSLKILITHS* |
| Ga0127475_10855292 | 3300010095 | Grasslands Soil | LNKKLPVMDIVTHRFPLARIQQGLDLAAKPTEESLKILITHA* |
| Ga0127470_11105892 | 3300010105 | Grasslands Soil | VLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTAESLKILITHT* |
| Ga0134088_100144171 | 3300010304 | Grasslands Soil | GADLLLHKKLPVLEIVTHRFPLARIQEGLDLAARPTEESLKILITHV* |
| Ga0074044_105767652 | 3300010343 | Bog Forest Soil | MEIVTHCYPLDKIQEALELAARPTAESLKILITHA* |
| Ga0126370_112107781 | 3300010358 | Tropical Forest Soil | AELVLHKKLPVMDIVTHRFSLDKIQEALDLAARPAAESLKVLIRHA* |
| Ga0126370_113023781 | 3300010358 | Tropical Forest Soil | VLEKKLPVMEIVTHRFPLAKIQEGLELAVRPTEQSLKILITHE* |
| Ga0126372_127105132 | 3300010360 | Tropical Forest Soil | VDIQDEAAALVLQKKLPVMDIVTHRFPLDKIQEGLDLAVRPTAQSLKILITHS* |
| Ga0126381_1013978361 | 3300010376 | Tropical Forest Soil | LPVMDIVTHRFPLDKIQEGLDLAARPTAQSLKILITHS* |
| Ga0150983_116161281 | 3300011120 | Forest Soil | QEAGADLVLQKKLPVMEIVTHRFPLARIQEGLDLAAKPTAESLKILITHA* |
| Ga0150983_150881961 | 3300011120 | Forest Soil | KKLPVMEIVTHRFPLARIQEGLELAARPTVESLKILITHA* |
| Ga0150983_152708431 | 3300011120 | Forest Soil | AADLVLQKKLPVMDIVTHRFPLARIQEGLELAARPTVESLKILITHA* |
| Ga0137392_108793542 | 3300011269 | Vadose Zone Soil | AAVDIQEAGADLVLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTEESLKILITHA* |
| Ga0137392_115235531 | 3300011269 | Vadose Zone Soil | MEIVTHRFPLARIQEGLELAANPTHESLKILITHQ* |
| Ga0137393_112276171 | 3300011271 | Vadose Zone Soil | LVLKKKLPVMEIVTHRFPLARIQEGLDLAAKPTAESLKILITHA* |
| Ga0137389_108321062 | 3300012096 | Vadose Zone Soil | ASLVLKKKLPVLDIVTHRFPLDKIQEGLELAARPTAESLKILITHA* |
| Ga0137388_100201881 | 3300012189 | Vadose Zone Soil | VMEIVTHRFPLARIQEGLDLAVKPTAESLKILVTHA* |
| Ga0137364_104733171 | 3300012198 | Vadose Zone Soil | KKKLPVMDIVTHRFPLARIQQGLDLAAKPTEESLKILITHA* |
| Ga0137363_115540212 | 3300012202 | Vadose Zone Soil | LVLGKKLPVMDIVTHRFPLDRIQEGLELAAHPTEDSLKILITHK* |
| Ga0137362_101253351 | 3300012205 | Vadose Zone Soil | DIQEAGADLVLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTVESLKILITHA* |
| Ga0137362_112535402 | 3300012205 | Vadose Zone Soil | KKLPVMDIVTHRFPLARIQQGLDLAAKPTEESLKILISHA* |
| Ga0137387_113256241 | 3300012349 | Vadose Zone Soil | DLVLKKKLPVMDIVTHRFPLARIQEGLGLAAMPTAESLKILITHV* |
| Ga0137360_109373172 | 3300012361 | Vadose Zone Soil | LVLGKKLPVMDIVTHRFPLDRIQEGLELAARPTEDSLKILITHK* |
| Ga0134037_10007171 | 3300012372 | Grasslands Soil | LVLKKKLPVMDIVTHRFPLARIQEGLGLAAKPRAESLKILITHT* |
| Ga0134038_10672051 | 3300012382 | Grasslands Soil | LPVMDIVTHRFPLARIQQGLDLAAKPTEESLKILITHA* |
| Ga0137398_100725501 | 3300012683 | Vadose Zone Soil | QESAAGLVLGKKLPVMDIVTHRFPLDRIQEGLELAAHPTEDSLKILITHK* |
| Ga0137396_105174691 | 3300012918 | Vadose Zone Soil | LVLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTAESLKILIAHA* |
| Ga0137396_108361622 | 3300012918 | Vadose Zone Soil | EAGADLVLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTAESLKILITHA* |
| Ga0137413_108326251 | 3300012924 | Vadose Zone Soil | VMQIVTHRFPLDRIQEALELAAHPSADSLKILITHE* |
| Ga0137419_104670402 | 3300012925 | Vadose Zone Soil | PVMEIVTHRFPLANIQEGLDLAAKPTAESLKILITHV* |
| Ga0137416_122401692 | 3300012927 | Vadose Zone Soil | ASLVLKKKLPVMDIVTHRFPLDKIQEGLELAAGPTAESLKILITHA* |
| Ga0164301_100309143 | 3300012960 | Soil | MAIVTYRFPLDRIQEALELAARPTAESLKILITHA* |
| Ga0181524_104460471 | 3300014155 | Bog | LEIVTHRFPLGRIQEGLELAARPTETSLKVLITHR* |
| Ga0134078_101485761 | 3300014157 | Grasslands Soil | MDIVTHRFPLDKIQEALDLAVRPTAESLKVLITHA* |
| Ga0181523_100159915 | 3300014165 | Bog | VLEKKLPVMEIVTHRFPLARIQEGLDLAARPTEESLKILITHE* |
| Ga0181537_103664451 | 3300014201 | Bog | KLPVMEIVTHRFPLDRIQEALDLAARPSADSLKILITHA* |
| Ga0137405_10168402 | 3300015053 | Vadose Zone Soil | DIQEAGADLVLKKKLPVMEIVTHRFPLARIQEGLDLAAKPTEESLKILITHA* |
| Ga0137420_148638610 | 3300015054 | Vadose Zone Soil | VLNKKLPIMEIVTHRFPLARIQEGLDLAVKPTAESLKILVTHA* |
| Ga0137418_107042211 | 3300015241 | Vadose Zone Soil | LPVMDIVTHRFPLARIQEGLNLAAKPTAESLKILITHA* |
| Ga0182041_120793621 | 3300016294 | Soil | LPVMSIVTHRFPLARIQEGLELAARPTEESLKILITHE |
| Ga0182037_102054663 | 3300016404 | Soil | KLPVMEIVTHRFPLASIQEGLDLAVRPTEESLKILITHE |
| Ga0182038_107864761 | 3300016445 | Soil | MEIVTHRFPLARIQEGLDLANRPTEESLKVLITHA |
| Ga0187802_103936901 | 3300017822 | Freshwater Sediment | LVLEKKLPVMEIVTHRFPLARIQEALELAVRPTEESLKILIAHE |
| Ga0187807_12054861 | 3300017926 | Freshwater Sediment | LPVMEIVTHRFPLARIQEGLDFANRPTEESLKILITHA |
| Ga0187814_104361611 | 3300017932 | Freshwater Sediment | LPVMEIVTHRFPLARIQEALELAVRPTEESLKILIAHE |
| Ga0187803_101286812 | 3300017934 | Freshwater Sediment | VDIQESAAALVLGKKLPVMEIVTHRFPLGGIPEGLELAARPTETSLKILIPHQ |
| Ga0187819_100176954 | 3300017943 | Freshwater Sediment | EKKLPVMEIVTHRFPLARIQEGLELAARPTEESLKILITHE |
| Ga0187776_111020622 | 3300017966 | Tropical Peatland | ALVLEKKLPVMEIVTHRFPLARIQEGLELANRPTEESLKILITHE |
| Ga0187770_109988082 | 3300018090 | Tropical Peatland | VTDIVTHRFSLDRIQEALELAARPTAESLKILITHA |
| Ga0066667_109744771 | 3300018433 | Grasslands Soil | LPVMDIVTHRFPLDNIQEALELAARPTAQSLKILITHA |
| Ga0137408_14012761 | 3300019789 | Vadose Zone Soil | RHGYRYPHRFPLDNIQEALELAARPTAQSLKILITHA |
| Ga0210407_102134681 | 3300020579 | Soil | ADLVLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTVESLKILITHA |
| Ga0210395_104745892 | 3300020582 | Soil | LPVMEIVTHRFALDRIQEALELAARPTTESLKILITHA |
| Ga0210406_102147563 | 3300021168 | Soil | VMDIVTHRFPLARIQEALELAAHPTEESLKILIEHQ |
| Ga0210406_102311721 | 3300021168 | Soil | AAALVLQKKLPVMDIVTHRFPLDRIQEGLELAAHPTEDSLKILITHK |
| Ga0210406_104004662 | 3300021168 | Soil | KLPVMEIVTHRFSLDRIQEALELAARPTAESLKILITHA |
| Ga0210405_105646222 | 3300021171 | Soil | LQKKLPVMEIVTHRFPLARIQEGLDLAAKPTAESLKILITHA |
| Ga0210405_106825061 | 3300021171 | Soil | KLPVMEIVTHRFPLDKIQEGLELAARPTAESLKILIRHT |
| Ga0210396_105895612 | 3300021180 | Soil | AAVDIQDSAAALVLGKKLPVMDIVTHRFPLDRIQEGLELAAHPTDESLKILITHQ |
| Ga0210393_112995242 | 3300021401 | Soil | LVLLRKLPVMEIVTHRFPLDRIQEALDLAARPTAESLKILITHA |
| Ga0210397_101671421 | 3300021403 | Soil | ESAADLVLGKKLPVMQIVTHRFSLDRIQEGLELAARPTAESLKILITHA |
| Ga0210387_100634071 | 3300021405 | Soil | LLRKLPVMDIVTHRFPLDRIQEALDLAARPTAESLKILITHA |
| Ga0210386_107474992 | 3300021406 | Soil | KLPVMDIVTHRFPLDRIQEGLELAAHPTDESLKILITHQ |
| Ga0210394_113999502 | 3300021420 | Soil | VMEIVTHRFPLDRIQEALDLAARPTAESLKILITHA |
| Ga0210390_109935432 | 3300021474 | Soil | MEIVTHRFPLARIQEGLDLAARPTEDSLKILITHE |
| Ga0210398_114012241 | 3300021477 | Soil | RKLPVMEIVTHRFPLDRIQEALDLAARPSADSLKILITHA |
| Ga0210409_114376562 | 3300021559 | Soil | GLVLGKKLPVMDIVTHRFPLDRIQEGLELAAHPTDESLKILITHQ |
| Ga0242642_10428561 | 3300022504 | Soil | LVLGKKLPVMDIVTHRFPLARIQEGLELALKPTAESLKILITHG |
| Ga0222728_10858801 | 3300022508 | Soil | LVLQKKLPVMDIVTHRFPLDRIQQALELAARPTAQSLKILITHT |
| Ga0242663_10699852 | 3300022523 | Soil | AAALVLEKKLPVMDIVTHRFPLDRIREGLELAAHPTEDSLKILITHK |
| Ga0242660_12293631 | 3300022531 | Soil | MEIVTHRFPLDKIQEGLELAARPTAESLKILIRHT |
| Ga0242654_103222611 | 3300022726 | Soil | MDIVTHRFPLARIQEGLDLAAKPTVESLKILITHA |
| Ga0247679_10008191 | 3300024251 | Soil | LGKKLPVMDIVTHRFPLDRIQEGLELAAHPTDDSLKILITHK |
| Ga0137417_12818012 | 3300024330 | Vadose Zone Soil | EAGADLVLKKKLPVMDIVTHRFPLARIQEGLNLAAKPTAESLKILITHA |
| Ga0207699_111939321 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVTHRFPLDRIQEGLELAARPTAESLKILITHA |
| Ga0207665_105575032 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YKKLPVMEIVTHRFPLARIQEGLDLALKPTAESLKILVTHA |
| Ga0207639_112771142 | 3300026041 | Corn Rhizosphere | MEIVTHRFPLDRIQEALELAARPTAESLKILITHA |
| Ga0209234_10799892 | 3300026295 | Grasslands Soil | DLVLKKKLPVMDIVTHRFPLARIQEGLGLAAKPTAESLKILITHV |
| Ga0209234_12395942 | 3300026295 | Grasslands Soil | PVMDIVTHRFPLARIQEGLDLAAKPTAESLKILVTHT |
| Ga0209240_10158071 | 3300026304 | Grasslands Soil | VLQKKLPVMDIVTHRFPLGRIQDALELAARPTAQSLKILITHS |
| Ga0209240_12547082 | 3300026304 | Grasslands Soil | PVMDIVTHRFPLDRIQDALELAARPTAQSLKILITHT |
| Ga0209761_13186091 | 3300026313 | Grasslands Soil | LPVMDIVTHRFPLARIQEGLDLAAKPTAESLKILITHT |
| Ga0209472_10262091 | 3300026323 | Soil | PVMDIVTHRFPLARIQEGLDLAAKPTAESLKILITHT |
| Ga0209377_12978382 | 3300026334 | Soil | VMQIVTHRFPLTRIQEGLELAAKPTAESLKILIAHA |
| Ga0209377_13458491 | 3300026334 | Soil | VVLKKKLPVLEIVTHRFPLARIQEGLELATKPTAESLKILITHA |
| Ga0257155_10629021 | 3300026481 | Soil | LVLKKKLPVMEIVTHRFPLARIQEGLDLAAKPTAESLKILITHE |
| Ga0257153_11008041 | 3300026490 | Soil | VMDIVTHRFPLDRIQEGLELAAHPTEDSLKILITHK |
| Ga0257158_10662792 | 3300026515 | Soil | PVMDIVTHRFPLARIQEGLELAARPTVESLKILIIHQ |
| Ga0179587_103221232 | 3300026557 | Vadose Zone Soil | AAALVLGKKLPVMDIVTHRFPLDRIQEGLELAAHPTEQSLKILITHK |
| Ga0207764_1087312 | 3300026839 | Tropical Forest Soil | KLPVMQIVTHRFPLARIQEGLELAARPTEDSLKILITHE |
| Ga0209214_10398052 | 3300027071 | Forest Soil | PVMEIVTHRFPLARIQEGLELAANPTSESLKVLITHQ |
| Ga0208097_10180751 | 3300027173 | Forest Soil | VMEIVTHRFTLDRIQEALELAARPTAESLKILITHA |
| Ga0208637_10416562 | 3300027401 | Soil | PVMDIVSHRFPLARIQEGLELAANPTEDSLKILITHS |
| Ga0209588_10456272 | 3300027671 | Vadose Zone Soil | DLVLKKKLPVMEIVTHRFPLARIQEGLDLAAKPTAESLKILITHA |
| Ga0209118_11961731 | 3300027674 | Forest Soil | AALVLQKKLPVMEIVTHRFPLDKIQDALELAARPTAQSLKILITHL |
| Ga0209655_101231361 | 3300027767 | Bog Forest Soil | ESAAALVLQKKLPVMEIVTHRFPLARIQEGLELANRPTEESLKILITHS |
| Ga0209139_103126071 | 3300027795 | Bog Forest Soil | LVLGKKLPVMEIVTHRFPLDRIQEALELAVRPAAESLKILITHA |
| Ga0209039_104309872 | 3300027825 | Bog Forest Soil | VMEIVTHRFTLDRIQEALDLAARPTAESLKILITHA |
| Ga0209693_102758981 | 3300027855 | Soil | DIQEAAADLVLGKKLPVMDIVTHRFPLARIQEGLELAARPTVESLKILITHA |
| Ga0209465_102741583 | 3300027874 | Tropical Forest Soil | VLEKKLPVMEIVTHRFPLAKIQEGLELAVRPTEQSLKILITHE |
| Ga0209283_106496281 | 3300027875 | Vadose Zone Soil | KLPVMDIVTHRFPLARIQEGLDLAAKPTAESLKILITHA |
| Ga0209590_109739361 | 3300027882 | Vadose Zone Soil | AGADLVLKKKLPVMDIVTHRFPLARIQEGLDLAAKPTEESLKILITHA |
| Ga0209526_103801833 | 3300028047 | Forest Soil | AALVLQKKLPVMDIVTHRFPLDKIQDALELAARPTAQSLKILITHL |
| Ga0302229_102409731 | 3300028879 | Palsa | YSAAADMQEEAAELVLQKKLPVLDIVSHVYPLDRIQDALELANRPTADSLKILIAHD |
| Ga0310037_103989962 | 3300030494 | Peatlands Soil | SLVLQKKLPVMEIVTHRFPLARIQEGLELAAQPTVESLKILITHV |
| Ga0311354_109288732 | 3300030618 | Palsa | IQEEAASLVLRKNLPVLDIVSHIYPLDRIQEALELANRPTAESLKILIALE |
| Ga0265462_111423172 | 3300030738 | Soil | LGKKLPVMEIVTHRFRLDSIQEALELAARPTAESLKILITHA |
| Ga0075388_111700482 | 3300030848 | Soil | KKLPVMDIVTHRFPLARIQEGLDLAAKPTAESLKILITHV |
| Ga0265770_10706781 | 3300030878 | Soil | IQEEAAALVLHKKLPVLDIVSHIYPLDRIQEALELANRPTAESLKILISHDEQ |
| Ga0307483_10121701 | 3300031590 | Hardwood Forest Soil | AVDIQEAGADLVLKKKLPVLDIVTHRFPLARIQEGLDLAAKPTEESLKILITHA |
| Ga0318555_103848412 | 3300031640 | Soil | VMEIVTHRFPLARIQEGLELAARPTEDSLKVLITHE |
| Ga0307476_102520082 | 3300031715 | Hardwood Forest Soil | SAAELVLLRKLPVMEIVTHRFPLDRIQEALDLAARPTAESLKILITHA |
| Ga0307476_108738381 | 3300031715 | Hardwood Forest Soil | PVMNIVTHRFPLARIQEGLELAARPTVESLKILITHQ |
| Ga0307476_112515802 | 3300031715 | Hardwood Forest Soil | KLPVMDIVTHRFPLDRIQEALNLAARPSADSLKILITHE |
| Ga0307474_103277511 | 3300031718 | Hardwood Forest Soil | VMDIVTHRFPLDRIQEALDLAARPTAESLKILITHA |
| Ga0307474_108762502 | 3300031718 | Hardwood Forest Soil | LVLQKKLPVMEIVTHRFPLARIQEGLDLAARPTEDSLKILITHE |
| Ga0307477_101348513 | 3300031753 | Hardwood Forest Soil | MDIVTHRFPLANIQEGLDLAANPTAESLKILITHI |
| Ga0318546_110888902 | 3300031771 | Soil | MEIVTHRFPLASIQEGLDLAVRPTEESLKILITHE |
| Ga0318497_105563042 | 3300031805 | Soil | VMEIVTHRFPLARIQEGLELAARPTAESLKVLITHE |
| Ga0307478_101003981 | 3300031823 | Hardwood Forest Soil | AELVLLRKLPVMDIVTHRFPLDRIQEALDLAARPTAESLKILITHA |
| Ga0306919_103307282 | 3300031879 | Soil | PVMEIVTHRLPLARIQEGLELAARPTEESLKVLITHE |
| Ga0306925_100905213 | 3300031890 | Soil | PVMEIVTHRFPLARIQEGLELAARPTEESLKILITHE |
| Ga0318536_104921522 | 3300031893 | Soil | LPLMVIVTFRFPLARIQEGLELAARPTEESLKVLITHE |
| Ga0310913_100161421 | 3300031945 | Soil | MEIVTHRFPLAKIQEGLELAVRPTEQSLKILITHE |
| Ga0310913_101009893 | 3300031945 | Soil | LPVMEIVTHRFPLASIQEGLDLAVRPTEESLKILITHE |
| Ga0307479_105351812 | 3300031962 | Hardwood Forest Soil | LKNKLPVMDIVTHRFPLARIQEGLDLAAKPTEESLKILITHA |
| Ga0307479_106095812 | 3300031962 | Hardwood Forest Soil | LPVMDIVTHRFALDRIQEGLDLAARPTAESLKILITHA |
| Ga0307479_107923062 | 3300031962 | Hardwood Forest Soil | QKKLPVMDIVTHRFPLDRIQQALELAARPTAQSLKILITHT |
| Ga0307472_1024805821 | 3300032205 | Hardwood Forest Soil | PVMDIVTHRFPLARIQEGLELAANPTHESLKVLITHP |
| Ga0306920_1016464881 | 3300032261 | Soil | LVLQKKLPVMNIVTHRFPLGRIQEGLDLAVRPTEDSLKILITHE |
| Ga0315742_130937601 | 3300032756 | Forest Soil | IQEAGADLVLKKKLPVMEIVTHRFPLARIQQGLDLAARPTEESLKILITHA |
| Ga0316212_10468141 | 3300033547 | Roots | LHKKLPVLDIVSHIYPLDRIQEALELANRPTAESLKILISHDEQ |
| Ga0371488_0070960_1911_2039 | 3300033983 | Peat Soil | LEKKLPVMEIVTHRFPLARIQEGLELAARPTEESLKILIAHE |
| ⦗Top⦘ |