| Basic Information | |
|---|---|
| Family ID | F041613 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MTSNDNQIDEVELARLGIRRVERHVYQRGEYIYSNLGDAIAAAKREQKR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.47 % |
| % of genes near scaffold ends (potentially truncated) | 19.50 % |
| % of genes from short scaffolds (< 2000 bps) | 84.91 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.535 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (20.755 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.346 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.925 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.68% β-sheet: 15.58% Coil/Unstructured: 59.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF02627 | CMD | 5.03 |
| PF09966 | DUF2200 | 2.52 |
| PF05901 | Excalibur | 1.89 |
| PF10067 | DUF2306 | 1.89 |
| PF00268 | Ribonuc_red_sm | 1.89 |
| PF14534 | DUF4440 | 1.89 |
| PF00565 | SNase | 1.89 |
| PF01329 | Pterin_4a | 1.26 |
| PF13545 | HTH_Crp_2 | 1.26 |
| PF14696 | Glyoxalase_5 | 1.26 |
| PF00313 | CSD | 1.26 |
| PF04402 | SIMPL | 0.63 |
| PF02643 | DUF192 | 0.63 |
| PF13531 | SBP_bac_11 | 0.63 |
| PF00411 | Ribosomal_S11 | 0.63 |
| PF01176 | eIF-1a | 0.63 |
| PF00004 | AAA | 0.63 |
| PF04191 | PEMT | 0.63 |
| PF07238 | PilZ | 0.63 |
| PF03544 | TonB_C | 0.63 |
| PF02588 | YitT_membrane | 0.63 |
| PF09190 | DALR_2 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 5.03 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 5.03 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 1.89 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 1.26 |
| COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG1284 | Uncharacterized membrane-anchored protein YitT, contains DUF161 and DUF2179 domains | Function unknown [S] | 0.63 |
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 0.63 |
| COG2364 | Uncharacterized membrane protein YczE | Function unknown [S] | 0.63 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.63 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.53 % |
| Unclassified | root | N/A | 14.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2001200001|2001327106 | Not Available | 1308 | Open in IMG/M |
| 2170459021|G14TP7Y01DSYOU | Not Available | 627 | Open in IMG/M |
| 3300003320|rootH2_10339340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1515 | Open in IMG/M |
| 3300004114|Ga0062593_100043993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2711 | Open in IMG/M |
| 3300004114|Ga0062593_100639941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1023 | Open in IMG/M |
| 3300004114|Ga0062593_102003451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 643 | Open in IMG/M |
| 3300004463|Ga0063356_101000298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1193 | Open in IMG/M |
| 3300004463|Ga0063356_101664273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 953 | Open in IMG/M |
| 3300004463|Ga0063356_105010259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 569 | Open in IMG/M |
| 3300004480|Ga0062592_100620377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 923 | Open in IMG/M |
| 3300005093|Ga0062594_100934514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 824 | Open in IMG/M |
| 3300005093|Ga0062594_101526789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 687 | Open in IMG/M |
| 3300005093|Ga0062594_102499805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 567 | Open in IMG/M |
| 3300005163|Ga0066823_10017202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1088 | Open in IMG/M |
| 3300005165|Ga0066869_10002180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2231 | Open in IMG/M |
| 3300005327|Ga0070658_10157115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1907 | Open in IMG/M |
| 3300005327|Ga0070658_10223639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1593 | Open in IMG/M |
| 3300005327|Ga0070658_10488813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1062 | Open in IMG/M |
| 3300005327|Ga0070658_10537602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1011 | Open in IMG/M |
| 3300005327|Ga0070658_11419118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 602 | Open in IMG/M |
| 3300005327|Ga0070658_11624343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 560 | Open in IMG/M |
| 3300005327|Ga0070658_11968243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 504 | Open in IMG/M |
| 3300005328|Ga0070676_11201392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300005330|Ga0070690_100272703 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300005331|Ga0070670_101740958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 574 | Open in IMG/M |
| 3300005336|Ga0070680_100447234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1103 | Open in IMG/M |
| 3300005339|Ga0070660_100173459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1742 | Open in IMG/M |
| 3300005339|Ga0070660_101316153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 613 | Open in IMG/M |
| 3300005344|Ga0070661_100337948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1179 | Open in IMG/M |
| 3300005344|Ga0070661_101316508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 606 | Open in IMG/M |
| 3300005345|Ga0070692_10099863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1589 | Open in IMG/M |
| 3300005347|Ga0070668_100750708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 864 | Open in IMG/M |
| 3300005364|Ga0070673_100557449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1042 | Open in IMG/M |
| 3300005366|Ga0070659_100153874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1877 | Open in IMG/M |
| 3300005366|Ga0070659_100321769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1293 | Open in IMG/M |
| 3300005366|Ga0070659_100528264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1008 | Open in IMG/M |
| 3300005366|Ga0070659_100603282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 944 | Open in IMG/M |
| 3300005366|Ga0070659_100830811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 804 | Open in IMG/M |
| 3300005435|Ga0070714_100817720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 903 | Open in IMG/M |
| 3300005435|Ga0070714_101986449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 567 | Open in IMG/M |
| 3300005455|Ga0070663_100361648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1177 | Open in IMG/M |
| 3300005455|Ga0070663_101043209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 712 | Open in IMG/M |
| 3300005456|Ga0070678_101139675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 721 | Open in IMG/M |
| 3300005457|Ga0070662_100114378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2060 | Open in IMG/M |
| 3300005458|Ga0070681_10149018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 2267 | Open in IMG/M |
| 3300005530|Ga0070679_100490046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1173 | Open in IMG/M |
| 3300005530|Ga0070679_100636434 | Not Available | 1009 | Open in IMG/M |
| 3300005530|Ga0070679_100873084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 843 | Open in IMG/M |
| 3300005539|Ga0068853_102076439 | Not Available | 551 | Open in IMG/M |
| 3300005543|Ga0070672_101665556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 573 | Open in IMG/M |
| 3300005543|Ga0070672_102086903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 511 | Open in IMG/M |
| 3300005548|Ga0070665_100040881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4660 | Open in IMG/M |
| 3300005548|Ga0070665_102321176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 539 | Open in IMG/M |
| 3300005564|Ga0070664_101719067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 595 | Open in IMG/M |
| 3300005577|Ga0068857_100215665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1752 | Open in IMG/M |
| 3300005578|Ga0068854_100012745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5505 | Open in IMG/M |
| 3300005578|Ga0068854_101065287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 719 | Open in IMG/M |
| 3300005578|Ga0068854_101546247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 603 | Open in IMG/M |
| 3300005614|Ga0068856_100032271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 5126 | Open in IMG/M |
| 3300006954|Ga0079219_11413414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 623 | Open in IMG/M |
| 3300009093|Ga0105240_10086114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3848 | Open in IMG/M |
| 3300009093|Ga0105240_10980699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 905 | Open in IMG/M |
| 3300010147|Ga0126319_1275622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 610 | Open in IMG/M |
| 3300010152|Ga0126318_10175065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 657 | Open in IMG/M |
| 3300010152|Ga0126318_11125539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 714 | Open in IMG/M |
| 3300010399|Ga0134127_10452214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1284 | Open in IMG/M |
| 3300010400|Ga0134122_10138391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1968 | Open in IMG/M |
| 3300012212|Ga0150985_104204372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1025 | Open in IMG/M |
| 3300012212|Ga0150985_111170974 | Not Available | 588 | Open in IMG/M |
| 3300012212|Ga0150985_116645682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 619 | Open in IMG/M |
| 3300012469|Ga0150984_121698523 | Not Available | 1493 | Open in IMG/M |
| 3300012512|Ga0157327_1007980 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300012958|Ga0164299_11609832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 512 | Open in IMG/M |
| 3300013100|Ga0157373_10036535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3525 | Open in IMG/M |
| 3300013100|Ga0157373_10137277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1720 | Open in IMG/M |
| 3300013100|Ga0157373_11085758 | Not Available | 600 | Open in IMG/M |
| 3300013102|Ga0157371_10084878 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300013104|Ga0157370_11166095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 695 | Open in IMG/M |
| 3300013105|Ga0157369_10000256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 73068 | Open in IMG/M |
| 3300013105|Ga0157369_10000343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 61648 | Open in IMG/M |
| 3300013105|Ga0157369_10425883 | Not Available | 1376 | Open in IMG/M |
| 3300013105|Ga0157369_10579209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300013105|Ga0157369_11493517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 687 | Open in IMG/M |
| 3300014968|Ga0157379_10597801 | Not Available | 1030 | Open in IMG/M |
| 3300015371|Ga0132258_10920583 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300015374|Ga0132255_100330585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 2201 | Open in IMG/M |
| 3300015374|Ga0132255_101550072 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300015374|Ga0132255_103576593 | Not Available | 661 | Open in IMG/M |
| 3300019361|Ga0173482_10607159 | Not Available | 551 | Open in IMG/M |
| 3300020069|Ga0197907_11499487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 678 | Open in IMG/M |
| 3300020082|Ga0206353_10079487 | Not Available | 625 | Open in IMG/M |
| 3300020082|Ga0206353_10289942 | Not Available | 601 | Open in IMG/M |
| 3300022883|Ga0247786_1066843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 745 | Open in IMG/M |
| 3300025315|Ga0207697_10436561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300025904|Ga0207647_10175122 | Not Available | 1248 | Open in IMG/M |
| 3300025904|Ga0207647_10249093 | Not Available | 1019 | Open in IMG/M |
| 3300025907|Ga0207645_11042006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 553 | Open in IMG/M |
| 3300025909|Ga0207705_10033622 | All Organisms → cellular organisms → Bacteria | 3664 | Open in IMG/M |
| 3300025909|Ga0207705_10168497 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300025909|Ga0207705_10286623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1261 | Open in IMG/M |
| 3300025909|Ga0207705_11282990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 560 | Open in IMG/M |
| 3300025911|Ga0207654_11331019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 524 | Open in IMG/M |
| 3300025912|Ga0207707_10291841 | Not Available | 1411 | Open in IMG/M |
| 3300025912|Ga0207707_11644919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 504 | Open in IMG/M |
| 3300025913|Ga0207695_10062772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3833 | Open in IMG/M |
| 3300025917|Ga0207660_10625554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 877 | Open in IMG/M |
| 3300025920|Ga0207649_10440398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 982 | Open in IMG/M |
| 3300025920|Ga0207649_10537856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 892 | Open in IMG/M |
| 3300025920|Ga0207649_10863966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 708 | Open in IMG/M |
| 3300025921|Ga0207652_10776881 | Not Available | 851 | Open in IMG/M |
| 3300025921|Ga0207652_10856509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 805 | Open in IMG/M |
| 3300025923|Ga0207681_10544014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 955 | Open in IMG/M |
| 3300025925|Ga0207650_10046882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3184 | Open in IMG/M |
| 3300025925|Ga0207650_10078782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2494 | Open in IMG/M |
| 3300025932|Ga0207690_10261078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1342 | Open in IMG/M |
| 3300025932|Ga0207690_10394335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1103 | Open in IMG/M |
| 3300025932|Ga0207690_10589688 | Not Available | 906 | Open in IMG/M |
| 3300025932|Ga0207690_10628120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 879 | Open in IMG/M |
| 3300025937|Ga0207669_10424888 | Not Available | 1047 | Open in IMG/M |
| 3300025937|Ga0207669_10855094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300025940|Ga0207691_10650807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HDW15A | 890 | Open in IMG/M |
| 3300025941|Ga0207711_10802759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 876 | Open in IMG/M |
| 3300025945|Ga0207679_10365159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1262 | Open in IMG/M |
| 3300025949|Ga0207667_10169312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2245 | Open in IMG/M |
| 3300025981|Ga0207640_10771189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 831 | Open in IMG/M |
| 3300026041|Ga0207639_11480591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 637 | Open in IMG/M |
| 3300026067|Ga0207678_10059153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3297 | Open in IMG/M |
| 3300026078|Ga0207702_10014519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 6538 | Open in IMG/M |
| 3300027288|Ga0208525_1010208 | Not Available | 1024 | Open in IMG/M |
| 3300028379|Ga0268266_10172286 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300028608|Ga0247819_10688303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 624 | Open in IMG/M |
| 3300028889|Ga0247827_10113726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1380 | Open in IMG/M |
| 3300030336|Ga0247826_11610962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 529 | Open in IMG/M |
| 3300031538|Ga0310888_10430441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 779 | Open in IMG/M |
| 3300031538|Ga0310888_10539212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 702 | Open in IMG/M |
| 3300031562|Ga0310886_10028812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2319 | Open in IMG/M |
| 3300031731|Ga0307405_10405740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1068 | Open in IMG/M |
| 3300031852|Ga0307410_10616024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 907 | Open in IMG/M |
| 3300031858|Ga0310892_10053673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2013 | Open in IMG/M |
| 3300031892|Ga0310893_10242695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 743 | Open in IMG/M |
| 3300031901|Ga0307406_11299535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300031938|Ga0308175_100083749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2884 | Open in IMG/M |
| 3300031938|Ga0308175_100420022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1402 | Open in IMG/M |
| 3300031938|Ga0308175_100573690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1210 | Open in IMG/M |
| 3300031938|Ga0308175_100964912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 941 | Open in IMG/M |
| 3300031938|Ga0308175_101948225 | Not Available | 658 | Open in IMG/M |
| 3300031939|Ga0308174_10272000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1324 | Open in IMG/M |
| 3300031996|Ga0308176_10820659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 973 | Open in IMG/M |
| 3300031996|Ga0308176_12915091 | Not Available | 507 | Open in IMG/M |
| 3300032002|Ga0307416_102367667 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300032002|Ga0307416_102882798 | Not Available | 575 | Open in IMG/M |
| 3300032003|Ga0310897_10650857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 525 | Open in IMG/M |
| 3300032004|Ga0307414_12200940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 515 | Open in IMG/M |
| 3300032012|Ga0310902_10229219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1107 | Open in IMG/M |
| 3300032013|Ga0310906_10606299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 755 | Open in IMG/M |
| 3300032017|Ga0310899_10691721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 517 | Open in IMG/M |
| 3300032074|Ga0308173_10892385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 822 | Open in IMG/M |
| 3300032075|Ga0310890_10434740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 983 | Open in IMG/M |
| 3300032075|Ga0310890_11070899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 651 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 20.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 14.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 7.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.63% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2001200001 | Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150 | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2001385030 | 2001200001 | Soil | MYGNDNHIDEVELKRLGIRRVEKDLFQRGEYLYPSLHEAIAAAKKDEKA |
| 4NP_01012030 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MGTNDNRIDEMELARLGIRPVEGQVFQWGEYIFSNLHDALVAARRAEKR |
| rootH2_103393401 | 3300003320 | Sugarcane Root And Bulk Soil | MMPEAVKGNSMNEKDSQMDDVELERLGIRRVEREVYQRGEYVYSNLRDAIAAARREMKL* |
| Ga0062593_1000439935 | 3300004114 | Soil | MTSNDNQIDEVELARLGIRRVEAHVFQRGEYIYSNLRDAVAAAKREQRP* |
| Ga0062593_1006399411 | 3300004114 | Soil | MTDNDNQIDEVELARLGIRRVERDVFQRGEYIYSNLRDAIAAAKREERP* |
| Ga0062593_1020034512 | 3300004114 | Soil | MTSNDNQIDEMELARLGIRRVEKHVFQWGEYIYSNLSDALAAAKRGVKS* |
| Ga0063356_1010002983 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTSNDNQIDEVELARLGIRRVERDVFQWGEYIYSNLRDAVAAAKREEAK* |
| Ga0063356_1016642733 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTSNDNQIDEVELARLGIRRVEPHVFQWGEYLYSNVGDAIAAARRGKKR* |
| Ga0063356_1050102592 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTSNDNQIDEVELARLGIRRVEKHVFQRGEYIYSNLNDALAAAKRDERA* |
| Ga0062592_1006203773 | 3300004480 | Soil | MPKNDDHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA* |
| Ga0062594_1009345143 | 3300005093 | Soil | MGTNDNRIDALELARLGIRPVEGQVFQWGEYIFSNLHDALAAARRAEKR* |
| Ga0062594_1015267892 | 3300005093 | Soil | MTSNHNQIDDAELARLGIRRVETQVFQVGEYIYSNLSDALASAKRRDRK* |
| Ga0062594_1024998053 | 3300005093 | Soil | MPKNDDHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAA |
| Ga0066823_100172024 | 3300005163 | Soil | LTHPNSVKDDYVTAKENRIDDAELARLGIRRVESQVFQVGEYVYSNLSDALASAKRRDSK |
| Ga0066869_100021806 | 3300005165 | Soil | VTAKENRIDDAELARLGIRRVESQVFQVGEYVYSNLSDALASAKRRDSK* |
| Ga0070658_101571151 | 3300005327 | Corn Rhizosphere | MTHNDNQIDDAELARLGIRRVEREVYQWGEYIYGNLADALAAARREAKA* |
| Ga0070658_102236395 | 3300005327 | Corn Rhizosphere | MTDNDNHMDDAELAKLGIRRVERQVYQRGEYVYSNLADALAAARRPVKS* |
| Ga0070658_104888133 | 3300005327 | Corn Rhizosphere | MTPEPSRGNSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0070658_105376023 | 3300005327 | Corn Rhizosphere | MTSNDNQIDEVELARLGIRRVERHVFQRGEYVYSNLTDAIAAAKREEKQ* |
| Ga0070658_114191182 | 3300005327 | Corn Rhizosphere | MMPEPSQGNSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0070658_116243432 | 3300005327 | Corn Rhizosphere | MNHTDIKVDDAELTKLGIRRVERQVYQWGEYVYSNLGDALAAARRPAKS* |
| Ga0070658_119682432 | 3300005327 | Corn Rhizosphere | MMPEPTQGKSMNENDNRIDDSELKRLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0070676_112013922 | 3300005328 | Miscanthus Rhizosphere | MPASKNQIDDAELDRLGIRRVEAQVFQVGEYVYSNLSDALASAKRRDRK* |
| Ga0070690_1002727033 | 3300005330 | Switchgrass Rhizosphere | SKRMPMTSNHNQIDDAELARLGIRRVETQVFQVGEYIYSNLSDALASAKRRDRK* |
| Ga0070670_1017409582 | 3300005331 | Switchgrass Rhizosphere | MTSNSNQVDEVELARLGIRRVERSVFQRGEYVYSNLKDAIDAAKRDARS* |
| Ga0070680_1004472342 | 3300005336 | Corn Rhizosphere | MASNDDEIDEAELARLGIRRVEGKVYQRGEYIFSNVRDAIAAAKREGNT* |
| Ga0070660_1001734594 | 3300005339 | Corn Rhizosphere | MNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0070660_1013161531 | 3300005339 | Corn Rhizosphere | NQIDEVELARLGIRRVEAHVFQRGEYIYSNLRDAVAAAKREQRP* |
| Ga0070661_1003379483 | 3300005344 | Corn Rhizosphere | MTGNDNHIDEVELARLGIRRVERHVYQRGEYIYSNLGDAIAAAKREQKR* |
| Ga0070661_1013165082 | 3300005344 | Corn Rhizosphere | MTSTDNQIDDAELARLGIRRVETQVFQVGEYIYSNLSDALASAKRRDRK* |
| Ga0070692_100998633 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNNDNDIDEVELARLGIRRMERHVFQVGEYIYSNLRDAIAAAERAQKS* |
| Ga0070668_1007507082 | 3300005347 | Switchgrass Rhizosphere | VTAKENQIEDSELARLGIRRVESQVFQVGEYVYSNLSDALASAKRRDRK* |
| Ga0070673_1005574494 | 3300005364 | Switchgrass Rhizosphere | MTSSDNKIDDAELARLGIRRVESQVFQVGEYVYSNLSDALASARRRDRK* |
| Ga0070659_1001538743 | 3300005366 | Corn Rhizosphere | MPGGWIRSACPVEKHQGTSMTENDTQMNDADLERLGIRRIERYVFQRGEYIYSNLRDAIAAAKRDGKS* |
| Ga0070659_1003217693 | 3300005366 | Corn Rhizosphere | MTNNDNDIDEVELARLGIRRMERHVFQVGEYIYSNLRDAIADAERAQKS* |
| Ga0070659_1005282642 | 3300005366 | Corn Rhizosphere | MTNNDNDIDDVELARLGIRRVEQHVFQFGEYIYSNLGDAIAAAKRAQKA* |
| Ga0070659_1006032823 | 3300005366 | Corn Rhizosphere | MTSNENQIDEAELTRLGIRRVERHVFQWREYIYSNLGDAIAAAKREEKR* |
| Ga0070659_1008308113 | 3300005366 | Corn Rhizosphere | MNNTNDNQIDEMELARLGIRRVEKHVFQWGEYIYSNLSDALAAAKRGVKP* |
| Ga0070714_1008177202 | 3300005435 | Agricultural Soil | MTGTDHQMNDTELAKLGIRRVERQVYQWGEYVYSNLGDALAAARRPAKS* |
| Ga0070714_1019864491 | 3300005435 | Agricultural Soil | MTSDDNKIDDSELTRLGIRRVEREVYQRGEYIYSNLRDAVAAARRDDKR* |
| Ga0070663_1003616483 | 3300005455 | Corn Rhizosphere | MSENDNPVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0070663_1010432093 | 3300005455 | Corn Rhizosphere | MTSEPNQGKSMSENDNPVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0070678_1011396752 | 3300005456 | Miscanthus Rhizosphere | MTSNDNQIDEVELARLGIRRVEAHVFQRGEYIHSNLRDAVAAAKREQRP* |
| Ga0070662_1001143785 | 3300005457 | Corn Rhizosphere | VTQSPPNEERVMPKNDDHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0070681_101490185 | 3300005458 | Corn Rhizosphere | MKTNDNHIDELELARLGIRAVEGQVFQWGEYIFSNLRDAVAAAKAAEKR* |
| Ga0070679_1004900462 | 3300005530 | Corn Rhizosphere | MTGNNHQIDEAELTRLGIRRVERHVYQRGEYVYSNLGDAIAAAKREEKA* |
| Ga0070679_1006364341 | 3300005530 | Corn Rhizosphere | SNDDEIDEAELARLGIRRVEGKVYQRGEYIFSNVRDAIAAAKREGNT* |
| Ga0070679_1008730842 | 3300005530 | Corn Rhizosphere | MSSNDNEIDQVELARLGIRRVERHVFQWGEYIYSNLSDALAAAKRGEKS* |
| Ga0068853_1020764392 | 3300005539 | Corn Rhizosphere | MADNDKKIDETELARLGIRRVERQVFQRGEYIYGSLDDALAAAKRDEPA* |
| Ga0070672_1016655562 | 3300005543 | Miscanthus Rhizosphere | PMTSNHNQIDDAELARLGIRRVETQVFQVGEYIYSNLSDALASAKRRDRK* |
| Ga0070672_1020869032 | 3300005543 | Miscanthus Rhizosphere | MTSNDNQIDEVELARLGIRRVEGQVFQWGEYVYSNVGDAIAAAKRGVKK* |
| Ga0070665_1000408817 | 3300005548 | Switchgrass Rhizosphere | MTSNDNEIDEVELARLGIKRVERAVFQFGDYTYTNARDAVAAAKRGQAS* |
| Ga0070665_1023211762 | 3300005548 | Switchgrass Rhizosphere | MTSTNDNQIDELELARLGIRRVEGNVFQWGEYIYSNVRDAIAAAKRGERP* |
| Ga0070664_1017190671 | 3300005564 | Corn Rhizosphere | MTSNHNQIDDTELARLGIRRVERHVFQRGEYIYSNLGDAVAAARREQKA* |
| Ga0068857_1002156654 | 3300005577 | Corn Rhizosphere | MTSNENQIDEAELTRLGIRRVERHVFQWREYIYSNLSDAIAAAKREEKR* |
| Ga0068854_1000127455 | 3300005578 | Corn Rhizosphere | MNENDNRIDDSELERLGIRRVEREVYQQGEYIYSNLRDALAAANLEMKS* |
| Ga0068854_1010652871 | 3300005578 | Corn Rhizosphere | NSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0068854_1015462472 | 3300005578 | Corn Rhizosphere | MTSNDNQIDEVELARLGIRRVERHVYQRGEYIYSNLGDAIAAAKREQKR* |
| Ga0068856_1000322712 | 3300005614 | Corn Rhizosphere | MSENDNKVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0079219_114134141 | 3300006954 | Agricultural Soil | MTTTNDNQIDEAELTRLGIRRVERHVFQWREYIYSNLSDAIAAA |
| Ga0105240_100861145 | 3300009093 | Corn Rhizosphere | MTPEPSQGNSMNENDNRIDDSELERLGIRRVEREVYQQGEYIYSNLRDALAAANLEMKS* |
| Ga0105240_109806992 | 3300009093 | Corn Rhizosphere | MTPEPNQGKSMSENDNPVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0126319_12756222 | 3300010147 | Soil | LTHPNSVKDDYVTTKENRIDDAELARLGIRRVESQVFQVGEYVYSNLSDALASAKRRDSK |
| Ga0126318_101750652 | 3300010152 | Soil | MTSDDNKIDDSELTRLGIRRVEREVYQRGEYIYSNLRDAVAAARRDEKR* |
| Ga0126318_111255392 | 3300010152 | Soil | MNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAAKREAKS* |
| Ga0134127_104522143 | 3300010399 | Terrestrial Soil | MTTTKDNQIDEAELARLGIRRVEKHVFQRGEYIYSNLGDAIAAAKRDEKR* |
| Ga0134122_101383913 | 3300010400 | Terrestrial Soil | MTTNDNDIDEMELTRLGIRRVEKHVFQWGEYIYSNVRDAVAAAKRGERP* |
| Ga0150985_1042043723 | 3300012212 | Avena Fatua Rhizosphere | MNNTNDNQIDETELARLGIRRVEKHVFQWGEYIYSNLSDALAAAKRGVKS* |
| Ga0150985_1111709742 | 3300012212 | Avena Fatua Rhizosphere | MSSNDNQIDEVELARLGIRHVEEHVFQRGEYIYSSLREAIAAAKRDEKK* |
| Ga0150985_1166456822 | 3300012212 | Avena Fatua Rhizosphere | MTTNDNQIDDAELARLGIRRVEAQVFQVGEYIYSNLRDARAAAKRAERR* |
| Ga0150984_1216985234 | 3300012469 | Avena Fatua Rhizosphere | MSKSDPNQEEHMSNNDNQIDELELARLGIRRVERHVFQRGDYIYSNLGDALAAAKRDEKS |
| Ga0157327_10079803 | 3300012512 | Arabidopsis Rhizosphere | MPKNDEQIDDAELTRLGIRRVDRHVFQRGEYIYSNLGDALAAAKREGKA* |
| Ga0164299_116098322 | 3300012958 | Soil | VTAKENRIDDAELARLGIRRVETQVFQVGEYIYSNLSDAVASAKRRDSR* |
| Ga0157373_100365359 | 3300013100 | Corn Rhizosphere | MTSEPNQGNSMNQNDNQIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAARREVKS* |
| Ga0157373_101372772 | 3300013100 | Corn Rhizosphere | MASNEDEIDEAELARLGIRRVEGKVYQRGEYIFSNVRDAIAAAKREGNT* |
| Ga0157373_110857583 | 3300013100 | Corn Rhizosphere | MTPEPSRGNSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAAN |
| Ga0157371_100848785 | 3300013102 | Corn Rhizosphere | MTPEPNQGKRMNENDNKVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0157370_111660953 | 3300013104 | Corn Rhizosphere | RSHERAPMMPEPSQGNSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0157369_100002566 | 3300013105 | Corn Rhizosphere | VKLPVQGNSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0157369_1000034329 | 3300013105 | Corn Rhizosphere | MTRKPDQGNTMHENDNQIDEVELSRLGIRRVERHVFQRGEYIYSNLRDALAAAKREVKP* |
| Ga0157369_104258834 | 3300013105 | Corn Rhizosphere | MTATDHQMNDTELAKLGIRRVERQVYQWGEYVYSNLGDALAAARRPAKS* |
| Ga0157369_105792094 | 3300013105 | Corn Rhizosphere | MTPEPNQGKSMSENDNKVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS* |
| Ga0157369_114935171 | 3300013105 | Corn Rhizosphere | NENQIDEAELTRLGIRRVERHVFQWREYIYSNLGDAIAAAKREEKR* |
| Ga0157379_105978013 | 3300014968 | Switchgrass Rhizosphere | MTSNHNQIDDAELARLGIRRVETQVFQVGEYVYSNLSDALASARRRDRK* |
| Ga0132258_109205833 | 3300015371 | Arabidopsis Rhizosphere | MSNNDNQVDELELARLGIRRVERQVFQRGEYIYSNLSDAISAAKRDERS* |
| Ga0132255_1003305851 | 3300015374 | Arabidopsis Rhizosphere | NDDQIDDAELARLGIRRVEGKVYQRGEYIFSNVRDAIAAAKREGNT* |
| Ga0132255_1015500723 | 3300015374 | Arabidopsis Rhizosphere | MPKNDDHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDAVAAAKREDKA* |
| Ga0132255_1035765931 | 3300015374 | Arabidopsis Rhizosphere | EGPSMGTNDNRIDALELARLGIRPVEGQVFQWGEYIFSNLHDALAAARRAEKR* |
| Ga0173482_106071593 | 3300019361 | Soil | MTSNDNQIDEMELARLGIRRVEKHVFQWGEYIYSNLSDALAAAKRGVKS |
| Ga0197907_114994873 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS |
| Ga0206353_100794872 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANLEMKS |
| Ga0206353_102899421 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANR |
| Ga0247786_10668432 | 3300022883 | Soil | MTSNDNQIDEVELARLGIRRVEAHVFQRGEYIYSNLRDAVAAAKREQRP |
| Ga0207697_104365612 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSNHNQIDDAELARLGIRRVETQVFQVGEYIYSNLSDALASAKRRDRK |
| Ga0207647_101751222 | 3300025904 | Corn Rhizosphere | MTNNDNDIDEVELARLGIRRMERHVFQVGEYIYSNLRDAIAAAERAQKS |
| Ga0207647_102490931 | 3300025904 | Corn Rhizosphere | MTGTDHQMNDTELAKLGIRRVERQVYQWGEYVYSNLGDALAA |
| Ga0207645_110420061 | 3300025907 | Miscanthus Rhizosphere | GSNMTSNDNQIDEVELARLGIRRVEGQVFQWGEYVYSNVGDAIAAAKRGVKK |
| Ga0207705_100336225 | 3300025909 | Corn Rhizosphere | LTGVRFTKRCIMTNNDNDIDEVELARLGIRRMERHVFQVGEYIYSNLRDAIAAAERAQKS |
| Ga0207705_101684972 | 3300025909 | Corn Rhizosphere | MTGTDHQMNDTELAKLGIRRVERQVYQWGEYVYSNLGDALAAARRPAKS |
| Ga0207705_102866233 | 3300025909 | Corn Rhizosphere | MTSNDNQIDEVELARLGIRRVERHVFQRGEYVYSNLTDAIAAAKREEKQ |
| Ga0207705_112829902 | 3300025909 | Corn Rhizosphere | MNHTDIKVDDAELTKLGIRRVERQVYQWGEYVYSNLGDALAAARRPAKS |
| Ga0207654_113310192 | 3300025911 | Corn Rhizosphere | MMPEPSQGNSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS |
| Ga0207707_102918414 | 3300025912 | Corn Rhizosphere | MKTNDNHIDELELARLGIRAVEGQVFQWGEYIFSNLRDAVAAAKAAEKR |
| Ga0207707_116449191 | 3300025912 | Corn Rhizosphere | SNDNQIDEMELARLGIRRVEKHVFQWGEYIYSNLSDALAAAKRGVKP |
| Ga0207695_100627724 | 3300025913 | Corn Rhizosphere | MNENDNRIDDSELERLGIRRVEREVYQQGEYIYSNLRDALAAANLEMKS |
| Ga0207660_106255542 | 3300025917 | Corn Rhizosphere | MASNDDEIDEAELARLGIRRVEGKVYQRGEYIFSNVRDAIAAAKREGNT |
| Ga0207649_104403983 | 3300025920 | Corn Rhizosphere | MTGNDNHIDEVELARLGIRRVERHVYQRGEYIYSNLGDAIAAAKREQKR |
| Ga0207649_105378562 | 3300025920 | Corn Rhizosphere | MTSNHNQIDDTELARLGIRRVERHVFQRGEYIYSNLGDAVAAARREQKA |
| Ga0207649_108639662 | 3300025920 | Corn Rhizosphere | MTSNENQIDEVELTRLGIRRVERHVFQRGEYVYSNLTDAIAAAKREEKQ |
| Ga0207652_107768811 | 3300025921 | Corn Rhizosphere | MTGNNHQIDEAELTRLGIRRVERHVYQRGEYVYSNLGDAIAAAKREEKA |
| Ga0207652_108565091 | 3300025921 | Corn Rhizosphere | PRSGTRTIFLQQGRQTMNHTDIKVDDAELTKLGIRRVERQVYQWGEYVYSNLGDALAAARRPAKS |
| Ga0207681_105440143 | 3300025923 | Switchgrass Rhizosphere | MPKNDDHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0207650_100468826 | 3300025925 | Switchgrass Rhizosphere | MTDNDNQIDEVELARLGIRRVERDVFQRGEYIYSNLRDAIAAAKREERP |
| Ga0207650_100787822 | 3300025925 | Switchgrass Rhizosphere | MTSNSNQVDEVELARLGIRRVERSVFQRGEYVYSNLKDAIDAAKRDARS |
| Ga0207690_102610783 | 3300025932 | Corn Rhizosphere | MTSNENQIDEAELTRLGIRRVERHVFQWREYIYSNLGDAIAAAKREEKR |
| Ga0207690_103943352 | 3300025932 | Corn Rhizosphere | MTNNDNDIDEVELARLGIRRMERHVFQVGEYIYSNLRDAIADAERAQKS |
| Ga0207690_105896883 | 3300025932 | Corn Rhizosphere | MTENDTQMNDADLERLGIRRIERYVFQRGEYIYSNLRDAIAAAKRDGKS |
| Ga0207690_106281203 | 3300025932 | Corn Rhizosphere | MNNTNDNQIDEMELARLGIRRVEKHVFQWGEYIYSNLSDALAAAKRGVKP |
| Ga0207669_104248884 | 3300025937 | Miscanthus Rhizosphere | VTAKENQIEDSELARLGIRRVESQVFQVGEYVYSNLSDALASAKRR |
| Ga0207669_108550941 | 3300025937 | Miscanthus Rhizosphere | PVPASKRMPMTSNHNQIDDAELARLGIRRVETQVFQVGEYIYSNLSDALASAKRRDRK |
| Ga0207691_106508071 | 3300025940 | Miscanthus Rhizosphere | MTSSDNKIDDAELARLGIRRVESQVFQVGEYVYSNLSDALASARRRD |
| Ga0207711_108027592 | 3300025941 | Switchgrass Rhizosphere | MTSSDNKIDDAELARLGIRRVESQVFQVGEYVYSNLSDALASARRRDRK |
| Ga0207679_103651591 | 3300025945 | Corn Rhizosphere | SNDNQIDEVELARLGIRRVEAHVFQRGEYIYSNLRDAVAAAKREQRP |
| Ga0207667_101693123 | 3300025949 | Corn Rhizosphere | MSENDNPVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS |
| Ga0207640_107711893 | 3300025981 | Corn Rhizosphere | NSMNENDNRIDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS |
| Ga0207639_114805913 | 3300026041 | Corn Rhizosphere | MTSNDNQIDEVELARLGIRRVEKHVFQRGEYIYNNLNDALAAAKRDERA |
| Ga0207678_100591534 | 3300026067 | Corn Rhizosphere | MTDNDNHMDDAELAKLGIRRVERQVYQRGEYVYSNLADALAAARRPVKS |
| Ga0207702_100145199 | 3300026078 | Corn Rhizosphere | MSENDNKVDDSELERLGIRRVEREVYQRGEYIYSNLRDALAAANREMKS |
| Ga0208525_10102082 | 3300027288 | Soil | VTAKENRIDDAELARLGIRRVESQVFQVGEYVYSNLSDALASAKRRDSK |
| Ga0268266_101722863 | 3300028379 | Switchgrass Rhizosphere | MTSNDNEIDEVELARLGIKRVERAVFQFGDYTYTNARDAVAAAKRGQAS |
| Ga0247819_106883032 | 3300028608 | Soil | MTSNDNQIDEVELARLGITRIERDVFQWGEYIYSNVRDAVAAAKRAETK |
| Ga0247827_101137261 | 3300028889 | Soil | MPKNDDHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAALE |
| Ga0247826_116109622 | 3300030336 | Soil | VTQSPPNEERVMPKNDDQIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0310888_104304411 | 3300031538 | Soil | PLTPHGQGTQMTSNDNQVDEVELARLGIRRVERNVFQRGEYIYSNVRDAIAAAKRGEEK |
| Ga0310888_105392123 | 3300031538 | Soil | MTSNDNQIDEVELARLGIRRVERHVFQWGEYIYSNVRDAVAAARRGEAK |
| Ga0310886_100288125 | 3300031562 | Soil | MPKNDDQIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0307405_104057402 | 3300031731 | Rhizosphere | MTNNDNQIDETELARLGIRRVERHVFQWGEYIYSNVGDALAAARREDKR |
| Ga0307410_106160243 | 3300031852 | Rhizosphere | MTSNDNQIDEMELARLGIKRVERAVFQFGVYTYSNVRDAIAAAKRDGRS |
| Ga0310892_100536735 | 3300031858 | Soil | MPKNDDHIDDAELRRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0310893_102426953 | 3300031892 | Soil | QIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0307406_112995351 | 3300031901 | Rhizosphere | TPIPEGSSMYGNDNHIDEVELKRLGIRWVEKDVFQRGEYLYPSLHEAIAAAKKDEKA |
| Ga0308175_1000837496 | 3300031938 | Soil | MTSNDNQIDEVELARLGIRRVERHVFQRGEYVYSNLMDAIAAAKREEKQ |
| Ga0308175_1004200223 | 3300031938 | Soil | MSSNDNQIDEVELARLGIRHVEEHVFQRGEYIYSSLREAIAAAKRDEKK |
| Ga0308175_1005736903 | 3300031938 | Soil | MTDNDNKIDDAELARLGIRRVERQVYQWGEYVYSNLGDALAAARRPVKS |
| Ga0308175_1009649122 | 3300031938 | Soil | MNDNQVDEVELARLGIRRVEKHVFQWGEYIYSNVQDAVAAAKREQKS |
| Ga0308175_1019482252 | 3300031938 | Soil | MTDNDNQIDDAELARLGIRRVERQVYQWGEYVYSNLGDALAAARRPAKS |
| Ga0308174_102720004 | 3300031939 | Soil | MSSNDNQIDEVELARLGIRHVEEHVFQRGEYIYSSLSEAIAAAKRDEKK |
| Ga0308176_108206591 | 3300031996 | Soil | LTTPIQQGRFMTHNDNQIDDAELARLGIRRVEREVYQWGEYIYGNLADALAAARREAKA |
| Ga0308176_129150912 | 3300031996 | Soil | MTNNDNQIDDAELAKLGIRRVERQVYQWGEYVYSNLGDALAAARRPVKS |
| Ga0307416_1023676671 | 3300032002 | Rhizosphere | IDEVELKRLGIRWVEKDVFQRGEYLYPSLHEAIAAAKKDEKA |
| Ga0307416_1028827983 | 3300032002 | Rhizosphere | MACNDDEIDEAELARLGIRRVEGKVYQRGEYIFSNVRDAIAAAKREGNT |
| Ga0310897_106508572 | 3300032003 | Soil | MTSNDNQVDEVELARLGIRRVERNVFQRGEYIYSNVRDAIAAAKRGEEK |
| Ga0307414_122009401 | 3300032004 | Rhizosphere | MTSNDNQIDEIELARLGIRRVERHVFQWGEYIYSNVRDAVAAARRGEA |
| Ga0310902_102292192 | 3300032012 | Soil | MTTMSSNDNQIDEVELARLGIRRVEGQVFQWGEYVYSNVGDAIAAAKRGVKK |
| Ga0310906_106062991 | 3300032013 | Soil | RSRQPTPVTQSPPNEERVMPKNDDHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0310899_106917212 | 3300032017 | Soil | VTQSPQNEERVMPKNDDQIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| Ga0308173_108923852 | 3300032074 | Soil | MTDNDNQMGEAELARLGIRRVERHVFQWGEYIYSNLRDAVAAARRGEKP |
| Ga0310890_104347402 | 3300032075 | Soil | MTSNDNQIDEIELARLGIRRVEKHVFQWGEYIYSNVRDAVAAARRGEAK |
| Ga0310890_110708991 | 3300032075 | Soil | DHIDDAELTRLGIRRVERHVFQRGEYIYSNLGDALAAAKREGKA |
| ⦗Top⦘ |