| Basic Information | |
|---|---|
| Family ID | F041415 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 41 residues |
| Representative Sequence | QDKVDTYSQPAFFGEIAFMLWLVIKGARPPALDAAALSSAAA |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.03 % |
| % of genes near scaffold ends (potentially truncated) | 93.12 % |
| % of genes from short scaffolds (< 2000 bps) | 88.12 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.750 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (53.750 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.875 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 0.00% Coil/Unstructured: 77.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF15919 | HicB_lk_antitox | 2.50 |
| PF05016 | ParE_toxin | 1.88 |
| PF04397 | LytTR | 1.25 |
| PF00561 | Abhydrolase_1 | 1.25 |
| PF11185 | DUF2971 | 1.25 |
| PF08240 | ADH_N | 1.25 |
| PF01872 | RibD_C | 1.25 |
| PF13649 | Methyltransf_25 | 1.25 |
| PF01022 | HTH_5 | 1.25 |
| PF00248 | Aldo_ket_red | 1.25 |
| PF01850 | PIN | 1.25 |
| PF05163 | DinB | 1.25 |
| PF14329 | DUF4386 | 1.25 |
| PF04542 | Sigma70_r2 | 1.25 |
| PF07859 | Abhydrolase_3 | 1.25 |
| PF12697 | Abhydrolase_6 | 0.62 |
| PF01548 | DEDD_Tnp_IS110 | 0.62 |
| PF08241 | Methyltransf_11 | 0.62 |
| PF04326 | AlbA_2 | 0.62 |
| PF01613 | Flavin_Reduct | 0.62 |
| PF11716 | MDMPI_N | 0.62 |
| PF10012 | DUF2255 | 0.62 |
| PF06723 | MreB_Mbl | 0.62 |
| PF07676 | PD40 | 0.62 |
| PF08282 | Hydrolase_3 | 0.62 |
| PF13271 | DUF4062 | 0.62 |
| PF07690 | MFS_1 | 0.62 |
| PF01432 | Peptidase_M3 | 0.62 |
| PF04014 | MazE_antitoxin | 0.62 |
| PF15956 | DUF4760 | 0.62 |
| PF05724 | TPMT | 0.62 |
| PF12867 | DinB_2 | 0.62 |
| PF13924 | Lipocalin_5 | 0.62 |
| PF09587 | PGA_cap | 0.62 |
| PF13185 | GAF_2 | 0.62 |
| PF13506 | Glyco_transf_21 | 0.62 |
| PF04237 | YjbR | 0.62 |
| PF01402 | RHH_1 | 0.62 |
| PF00072 | Response_reg | 0.62 |
| PF10543 | ORF6N | 0.62 |
| PF13847 | Methyltransf_31 | 0.62 |
| PF07369 | DUF1488 | 0.62 |
| PF12680 | SnoaL_2 | 0.62 |
| PF00107 | ADH_zinc_N | 0.62 |
| PF03681 | Obsolete Pfam Family | 0.62 |
| PF06649 | DUF1161 | 0.62 |
| PF01041 | DegT_DnrJ_EryC1 | 0.62 |
| PF00578 | AhpC-TSA | 0.62 |
| PF03572 | Peptidase_S41 | 0.62 |
| PF07589 | PEP-CTERM | 0.62 |
| PF01040 | UbiA | 0.62 |
| PF12728 | HTH_17 | 0.62 |
| PF12706 | Lactamase_B_2 | 0.62 |
| PF04978 | DUF664 | 0.62 |
| PF13598 | DUF4139 | 0.62 |
| PF03069 | FmdA_AmdA | 0.62 |
| PF01011 | PQQ | 0.62 |
| PF13175 | AAA_15 | 0.62 |
| PF01904 | DUF72 | 0.62 |
| PF13304 | AAA_21 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.25 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.25 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.25 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.25 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.25 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.25 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.25 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.25 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.62 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.62 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.62 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.62 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.62 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.62 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.62 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.62 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.62 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.62 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.62 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.62 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.62 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.62 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.75 % |
| Unclassified | root | N/A | 6.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10033128 | All Organisms → cellular organisms → Bacteria | 4108 | Open in IMG/M |
| 3300002906|JGI25614J43888_10099798 | Not Available | 768 | Open in IMG/M |
| 3300002908|JGI25382J43887_10222205 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300002914|JGI25617J43924_10072851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
| 3300002914|JGI25617J43924_10092191 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300004082|Ga0062384_100058914 | Not Available | 1897 | Open in IMG/M |
| 3300004965|Ga0072321_1195818 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300005174|Ga0066680_10628795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300005451|Ga0066681_10020554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3376 | Open in IMG/M |
| 3300005467|Ga0070706_100657164 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005555|Ga0066692_10470971 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005560|Ga0066670_10150788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1358 | Open in IMG/M |
| 3300005598|Ga0066706_11245843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300006059|Ga0075017_100076881 | All Organisms → cellular organisms → Bacteria | 2290 | Open in IMG/M |
| 3300006162|Ga0075030_100485751 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300006172|Ga0075018_10018271 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300006806|Ga0079220_10259214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1046 | Open in IMG/M |
| 3300006854|Ga0075425_100666073 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300006893|Ga0073928_10218649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1478 | Open in IMG/M |
| 3300007265|Ga0099794_10086747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1550 | Open in IMG/M |
| 3300009012|Ga0066710_101483689 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300009012|Ga0066710_103549296 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009012|Ga0066710_104385760 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009038|Ga0099829_10218851 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 1546 | Open in IMG/M |
| 3300009088|Ga0099830_10735995 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 813 | Open in IMG/M |
| 3300009089|Ga0099828_10606242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300009089|Ga0099828_11291151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300009089|Ga0099828_11541143 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009089|Ga0099828_11718553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300009137|Ga0066709_101704179 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009174|Ga0105241_10564502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1024 | Open in IMG/M |
| 3300010326|Ga0134065_10224389 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010343|Ga0074044_10881130 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010359|Ga0126376_12871791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300011269|Ga0137392_10243030 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300011269|Ga0137392_10641311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300011269|Ga0137392_11268415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300011269|Ga0137392_11271407 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300011270|Ga0137391_10685702 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300011270|Ga0137391_10726958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300011270|Ga0137391_11158781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300011271|Ga0137393_10130604 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300011271|Ga0137393_10642138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300011271|Ga0137393_11188718 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300011271|Ga0137393_11458097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300012096|Ga0137389_10396764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341 | 1178 | Open in IMG/M |
| 3300012096|Ga0137389_10680951 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012189|Ga0137388_10729188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300012189|Ga0137388_11846256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012201|Ga0137365_10069290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2661 | Open in IMG/M |
| 3300012202|Ga0137363_10345632 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300012202|Ga0137363_11153167 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012202|Ga0137363_11515670 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012203|Ga0137399_10297225 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300012203|Ga0137399_10314213 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300012205|Ga0137362_10037258 | All Organisms → cellular organisms → Bacteria | 3893 | Open in IMG/M |
| 3300012205|Ga0137362_10284007 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300012205|Ga0137362_11700435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300012206|Ga0137380_10328991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
| 3300012206|Ga0137380_10520233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300012206|Ga0137380_10566419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 996 | Open in IMG/M |
| 3300012208|Ga0137376_10778476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300012209|Ga0137379_11035435 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012210|Ga0137378_11093610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300012211|Ga0137377_10713986 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300012211|Ga0137377_11409103 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012357|Ga0137384_10211702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1622 | Open in IMG/M |
| 3300012361|Ga0137360_10262158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
| 3300012361|Ga0137360_11450579 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300012362|Ga0137361_11098907 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012362|Ga0137361_11239394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300012362|Ga0137361_11654452 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012362|Ga0137361_11792186 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012363|Ga0137390_10164796 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300012363|Ga0137390_10263460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1709 | Open in IMG/M |
| 3300012363|Ga0137390_10271644 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300012363|Ga0137390_10447263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1268 | Open in IMG/M |
| 3300012363|Ga0137390_10817924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300012582|Ga0137358_10569830 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012582|Ga0137358_10825186 | Not Available | 614 | Open in IMG/M |
| 3300012917|Ga0137395_11156563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012923|Ga0137359_10609182 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012923|Ga0137359_11257086 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 628 | Open in IMG/M |
| 3300012927|Ga0137416_11369674 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012929|Ga0137404_10362515 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300012929|Ga0137404_11733241 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012930|Ga0137407_10025080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4556 | Open in IMG/M |
| 3300012930|Ga0137407_10297996 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300012930|Ga0137407_10511049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300012944|Ga0137410_10059570 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
| 3300012944|Ga0137410_10196302 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300012944|Ga0137410_10196544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300012944|Ga0137410_11084425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 685 | Open in IMG/M |
| 3300012944|Ga0137410_11740417 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300014157|Ga0134078_10015641 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300015054|Ga0137420_1164065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 651 | Open in IMG/M |
| 3300015241|Ga0137418_10096721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2660 | Open in IMG/M |
| 3300015241|Ga0137418_10226667 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1600 | Open in IMG/M |
| 3300015241|Ga0137418_10441203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
| 3300015264|Ga0137403_10376710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1302 | Open in IMG/M |
| 3300017943|Ga0187819_10348865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 855 | Open in IMG/M |
| 3300017946|Ga0187879_10227898 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300017955|Ga0187817_10037912 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300017955|Ga0187817_10223497 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300017995|Ga0187816_10531584 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018032|Ga0187788_10208759 | Not Available | 759 | Open in IMG/M |
| 3300018043|Ga0187887_10881823 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018431|Ga0066655_10720387 | Not Available | 676 | Open in IMG/M |
| 3300018468|Ga0066662_10128137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1870 | Open in IMG/M |
| 3300018468|Ga0066662_10349217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
| 3300018468|Ga0066662_11050985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 810 | Open in IMG/M |
| 3300018468|Ga0066662_11744090 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300019996|Ga0193693_1053457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300020170|Ga0179594_10024753 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300020583|Ga0210401_10541024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300021476|Ga0187846_10472022 | Not Available | 513 | Open in IMG/M |
| 3300021478|Ga0210402_11087635 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300022504|Ga0242642_1038710 | Not Available | 713 | Open in IMG/M |
| 3300022508|Ga0222728_1117676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300024283|Ga0247670_1040650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300024288|Ga0179589_10175163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300024330|Ga0137417_1340526 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300025898|Ga0207692_10390754 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300025903|Ga0207680_10646175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 757 | Open in IMG/M |
| 3300026309|Ga0209055_1036220 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300026310|Ga0209239_1236824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300026313|Ga0209761_1327348 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026327|Ga0209266_1099527 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300026496|Ga0257157_1047688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 718 | Open in IMG/M |
| 3300026499|Ga0257181_1043800 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300026538|Ga0209056_10300250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300027643|Ga0209076_1100070 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027645|Ga0209117_1022074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2047 | Open in IMG/M |
| 3300027671|Ga0209588_1023566 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300027671|Ga0209588_1077742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. YR681 | 1072 | Open in IMG/M |
| 3300027671|Ga0209588_1207273 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027846|Ga0209180_10474506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300027846|Ga0209180_10659542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300027862|Ga0209701_10163541 | Not Available | 1350 | Open in IMG/M |
| 3300027862|Ga0209701_10175686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300027862|Ga0209701_10312989 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300027875|Ga0209283_10206638 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300027903|Ga0209488_10563302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300027910|Ga0209583_10243764 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300028047|Ga0209526_10851943 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300029882|Ga0311368_10326351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1153 | Open in IMG/M |
| 3300029993|Ga0302304_10301536 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300030617|Ga0311356_10661392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1004 | Open in IMG/M |
| 3300030618|Ga0311354_10217644 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300030737|Ga0302310_10060512 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300031128|Ga0170823_10196358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 637 | Open in IMG/M |
| 3300031753|Ga0307477_10324672 | Not Available | 1061 | Open in IMG/M |
| 3300031962|Ga0307479_10018552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6553 | Open in IMG/M |
| 3300031962|Ga0307479_10202079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1957 | Open in IMG/M |
| 3300031962|Ga0307479_11367805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300032180|Ga0307471_101076944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300032205|Ga0307472_100500828 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300032782|Ga0335082_10478014 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032805|Ga0335078_11854599 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 53.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.62% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004965 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100331281 | 3300001593 | Forest Soil | LPQVQDKVDTYSQPAFFGEIALMLWLVIKGARPPALDAADLSSAAG* |
| JGI25614J43888_100997981 | 3300002906 | Grasslands Soil | VFIFSQPALFAELALMLWLVIKGAKPQPLPAAALSPAAA* |
| JGI25382J43887_102222053 | 3300002908 | Grasslands Soil | LRGYCCRKYQDKVFTFTHPTVFGELAFMFWLLIKGATPPALDAAASSFAAG* |
| JGI25617J43924_100728513 | 3300002914 | Grasslands Soil | YDKVYTYTQPAVFGELAFMFWLLIKGAKPPALDAAASSSAAS* |
| JGI25617J43924_100921911 | 3300002914 | Grasslands Soil | VGVLLPQVQDKVDTYSQPAFFGEIALMLWLVIKGGRPPALDATAPSSAAG* |
| Ga0062384_1000589141 | 3300004082 | Bog Forest Soil | PQYREKIFTYGQPAFFGEVALMLWLIIKGAKPPAQDDSAYERSLGD* |
| Ga0072321_11958183 | 3300004965 | Peatlands Soil | GKVSAISFPALLGEPALMLWLVIRGARPPALDATASSSAAG* |
| Ga0066680_106287952 | 3300005174 | Soil | VFTFTQPAVFGELAFMFWLLIKGATPPALDATPSSAAVG* |
| Ga0066681_100205541 | 3300005451 | Soil | YSQPAFFGEIAFMLWLLIRGARPPARDAAATSNPRVESA* |
| Ga0070706_1006571642 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SLTGVLLPQYQDKVDTYSQPAFFGEIAFMLWLVVKGARPLALDGTVSSSAAA* |
| Ga0066692_104709711 | 3300005555 | Soil | QPAVFGELAFMFWLLIKGAKPPALDAAVLSSAAG* |
| Ga0066670_101507883 | 3300005560 | Soil | QPAFFGEIAFMLWLLIKGAKPPALDPTTSSSAFA* |
| Ga0066706_112458432 | 3300005598 | Soil | TYSQPAFFGEIAFMLWLAIKGARPPALDSTALSSAAG* |
| Ga0075017_1000768811 | 3300006059 | Watersheds | LPQYQDKVDTYSQPAFFGELAFMFWLVIKGARPPALDAAASSAAG* |
| Ga0075030_1004857514 | 3300006162 | Watersheds | TYSQPAIIGEIAFMFWLLIKGAKPPALDAAASSLAAA* |
| Ga0075018_100182711 | 3300006172 | Watersheds | VFSYGQPAFFGELAFMFWLVIKGARPPAMDAAASSSAAA* |
| Ga0079220_102592143 | 3300006806 | Agricultural Soil | LPQHLDKVFAISQPATFGEVAFMLWLVIKGAKPPAQDAAAL* |
| Ga0075425_1006660732 | 3300006854 | Populus Rhizosphere | PSQDKLFAYAQPAFFGEIVFMLWLLIKGANPPAPQAAA* |
| Ga0073928_102186494 | 3300006893 | Iron-Sulfur Acid Spring | SQPALFGELAFMLWLVIKGARPPALNTTSPPLAAAYQGIDI* |
| Ga0099794_100867471 | 3300007265 | Vadose Zone Soil | QDKVDTYSQSAYFGEIALMLWLVIKGARPLALDATASSSSAA* |
| Ga0066710_1014836891 | 3300009012 | Grasslands Soil | QDKADTYSQPAFFGEIAFMLWLLIRGARPPALDAAATSNPRVESA |
| Ga0066710_1035492962 | 3300009012 | Grasslands Soil | LPQYQDKVFTYAQPAFFGEVALMLRLVIKGAKPPVLDAAASSSAAG |
| Ga0066710_1043857601 | 3300009012 | Grasslands Soil | PQYYDKVFTYSQPAAFGEVAFMLWLVIKGAKPPALEAAALSSSADA |
| Ga0099829_102188512 | 3300009038 | Vadose Zone Soil | TYAQPAAFGEVAFMLWLVIKGARPPALDATALSSAAG* |
| Ga0099830_107359951 | 3300009088 | Vadose Zone Soil | YSQPAFFGEIAFMLWLLMKGARPPVLDPTTSSSAAA* |
| Ga0099828_106062421 | 3300009089 | Vadose Zone Soil | VFTFTQPAVFGELAFMFWLLIKGARPPALHATASPSAAG* |
| Ga0099828_112911512 | 3300009089 | Vadose Zone Soil | KVFAISQPALFGEVALMLWLVIKGARPQPLDAAALSSSAA* |
| Ga0099828_115411432 | 3300009089 | Vadose Zone Soil | QDKVDTYSQPALFGEIALMLWLVIKGSRPPALDATAFSSAAV* |
| Ga0099828_117185531 | 3300009089 | Vadose Zone Soil | SSPALVGELALMLWLVIKGARPPALDAAASSPAAG* |
| Ga0066709_1017041791 | 3300009137 | Grasslands Soil | VFTFTQPAVFGELAFMFWLLIKGAKPAALDAAASSRL* |
| Ga0105241_105645021 | 3300009174 | Corn Rhizosphere | QNKVFLYSQPALFGELALMLWLVIKGTKSPLDATASSNAAI* |
| Ga0134065_102243892 | 3300010326 | Grasslands Soil | YSQPAFFGEIAFMLWLLIRGARPPALDAAATSNPRVESA* |
| Ga0074044_108811302 | 3300010343 | Bog Forest Soil | QYQNTVNTYSQPAFIGEIAFMLWLVIKGAKPPALDASAPSSVAG* |
| Ga0126376_128717911 | 3300010359 | Tropical Forest Soil | QPAFFGEIAFMLWLAIKGARPPALDAAAPSSAAG* |
| Ga0137392_102430303 | 3300011269 | Vadose Zone Soil | VFIISQPALFGELALMLWLVIKGARPQPLDAAALSSSAA* |
| Ga0137392_106413112 | 3300011269 | Vadose Zone Soil | FTFTQPAVFGELAFMFWLLIKGAMPPALDATASS* |
| Ga0137392_112684151 | 3300011269 | Vadose Zone Soil | LLPQYQDKVDTFTQPAVFGELAFMFWLLIKGAKPPALDAAPSSSAAS* |
| Ga0137392_112714072 | 3300011269 | Vadose Zone Soil | QPAVFGELAFMFWLLIKGARPAAVDAAAASSAAAD* |
| Ga0137391_106857021 | 3300011270 | Vadose Zone Soil | VDTYSQPAVFGEIAFMLWLAIRGAKPPAPDATASSSAAA* |
| Ga0137391_107269581 | 3300011270 | Vadose Zone Soil | DKVFTFTQPAVFGELAFMFWLLIKGARPPALDATPSSSAVG* |
| Ga0137391_111587812 | 3300011270 | Vadose Zone Soil | QPAVFGELAFMFWLLIKGAKPPALDAAPSSSAAS* |
| Ga0137393_101306041 | 3300011271 | Vadose Zone Soil | QYQDKVFTYAQPAFFGEVALVLWLVIKGAKPPALDVTSSSSAVG* |
| Ga0137393_106421381 | 3300011271 | Vadose Zone Soil | DKVFTFTQPAVFGELAFMFWLLIKGAMPPALDATASS* |
| Ga0137393_111887181 | 3300011271 | Vadose Zone Soil | QVQDKVDTYTQPAVFGELAFMLWLLIKGAKPPALDATASSSAAA* |
| Ga0137393_114580971 | 3300011271 | Vadose Zone Soil | QPAVFGELAFMFWLLIKGAKLPALDAAASSSAAG* |
| Ga0137389_103967641 | 3300012096 | Vadose Zone Soil | YSQPAFFGEIAFMLWLVIKGARPPAQDATASSSAAG* |
| Ga0137389_106809513 | 3300012096 | Vadose Zone Soil | TYSQPALFGELAIMLWLVIKGARPPEEATGSSSAPRVSP* |
| Ga0137388_107291881 | 3300012189 | Vadose Zone Soil | QVQDKVFAYSQPAVFGEIAFMLWLVIMGAMPPALDATASSSAAG* |
| Ga0137388_118462561 | 3300012189 | Vadose Zone Soil | YYDKVFTFTQPAVFGELAFMFWLLIKGARPPALDAATSSSADA* |
| Ga0137365_100692905 | 3300012201 | Vadose Zone Soil | VFTFTQPAVFGELAFMFWLLIKGAKPPAEDAAASSSADA* |
| Ga0137363_103456322 | 3300012202 | Vadose Zone Soil | VFTFTQPAVFGELAFMFWLLIKGAKPPALDAAALSSAAG* |
| Ga0137363_111531671 | 3300012202 | Vadose Zone Soil | TYSQPALFGEVAFMLWLVIKGAKPTALDAAASFSAAG* |
| Ga0137363_115156702 | 3300012202 | Vadose Zone Soil | LPQVQDKVDTYSQPAFFGEIAFMLWLVIKGARPPALDLPASPSAAD* |
| Ga0137399_102972253 | 3300012203 | Vadose Zone Soil | PQYYDKVYTLTQPAVIGEIAFMLWLLIKGATPRALDATPSSSSAA* |
| Ga0137399_103142131 | 3300012203 | Vadose Zone Soil | FTYSQPAAFGEVAFMLWLVIKGAKPPALEAAALSSSADA* |
| Ga0137362_100372581 | 3300012205 | Vadose Zone Soil | KVFTFTQPAVFGELAFMFWLLIKGAKPPALDAAASSSAAA* |
| Ga0137362_102840071 | 3300012205 | Vadose Zone Soil | SQPAFFGEIAFMLWLVIKGARPPALDLPASSSAAD* |
| Ga0137362_117004351 | 3300012205 | Vadose Zone Soil | DKVFTYTQPAVFGELAFMFWLLIKGARPAAVDATAASSAAAD* |
| Ga0137380_103289912 | 3300012206 | Vadose Zone Soil | SQPALFGEIVLMLWLVIKGAKPPAVDAATSAAAEAH* |
| Ga0137380_105202331 | 3300012206 | Vadose Zone Soil | KVFTFTQPAVFGELAFMFWLLIKGARPPALDPTALSPAVG* |
| Ga0137380_105664191 | 3300012206 | Vadose Zone Soil | YSQPAIFGEIAFMLWLLIKGAKPPALGATAASAAISQ* |
| Ga0137376_107784762 | 3300012208 | Vadose Zone Soil | YQGKVFAYSQPALFAELALTLWLVIKGAKPQTIEIAVAPSAA* |
| Ga0137379_110354351 | 3300012209 | Vadose Zone Soil | GLRREKSLFLFRQSALFGEIALMLWLVIKGPTPPALDATALSSAAG* |
| Ga0137378_110936101 | 3300012210 | Vadose Zone Soil | AQPAFFGEVALMLRLVIKGAKPPVLDAAASSSAAG* |
| Ga0137377_107139861 | 3300012211 | Vadose Zone Soil | KVFTFTQPAVFGELAFMFWLLIKGAKPPALDAAASWSADA* |
| Ga0137377_114091031 | 3300012211 | Vadose Zone Soil | YQGKVFTISQPAFFGEIALMLWLVIKGAKPQAVGAAASSSAAS* |
| Ga0137384_102117021 | 3300012357 | Vadose Zone Soil | QPALFGELALMLWLVIKGAKPPALDAAASSSSAG* |
| Ga0137360_102621581 | 3300012361 | Vadose Zone Soil | KVFTFTQPAVFGELAFMFWLLIKGARPPALDAAASSSAAG* |
| Ga0137360_114505792 | 3300012361 | Vadose Zone Soil | QPAVFGELAFMFWLLIKGAKPPALDAAASSSAAA* |
| Ga0137361_110989071 | 3300012362 | Vadose Zone Soil | YQDKADTYSQPAFFGEIAFMLWLVIKGARPPALDAAAASSAAG* |
| Ga0137361_112393942 | 3300012362 | Vadose Zone Soil | YYDKVFTYTQPAVFGELAFMFWLVIKGAKPPALHAAASSSAAS* |
| Ga0137361_116544522 | 3300012362 | Vadose Zone Soil | VFTYTQPAVFGEIAFMLWLVIKGAKPPALDAAALSSAPA* |
| Ga0137361_117921861 | 3300012362 | Vadose Zone Soil | KVFLIAQPAFFGEIALMLWLVIKGAKPPVLDTAGSSPAVG* |
| Ga0137390_101647964 | 3300012363 | Vadose Zone Soil | QYYDKVFTYTQPAVFGELAFMFWLLIKGAKPPALDAAPSSSAAS* |
| Ga0137390_102634601 | 3300012363 | Vadose Zone Soil | TGILSVQYYDKVFTYTQPAVFGELAFMFWLLIKGAKPPALDPAASSSAAA* |
| Ga0137390_102716441 | 3300012363 | Vadose Zone Soil | TGILSVQYYDKVFTYTQPAVFGELAFMFWLLIKGAKPPALDATALSSAVA* |
| Ga0137390_104472631 | 3300012363 | Vadose Zone Soil | QPAVFGELVFMFWLLIKGAKPPAQDAAASSSAAG* |
| Ga0137390_108179241 | 3300012363 | Vadose Zone Soil | DKLFTLTQPAVFGERALMLWLVINGARPPAQDAAALLSAAG* |
| Ga0137358_105698302 | 3300012582 | Vadose Zone Soil | LPQVQDKVDTYSQPAFFGEIAFMLWLVIKGARPPALDVPASPAAAD* |
| Ga0137358_108251861 | 3300012582 | Vadose Zone Soil | KVFTYSQPAAFGEVAFMLWLVIKGAKPPALEAAASSPSAA* |
| Ga0137395_111565631 | 3300012917 | Vadose Zone Soil | GVLWPQYQGKVFTISQPAFFGEIALMLWLLIRGAKPQAVGAAAASLSAAG* |
| Ga0137359_106091823 | 3300012923 | Vadose Zone Soil | SQPAFFGEIALMLWFVIKGARPPALDATASSSVPG* |
| Ga0137359_112570862 | 3300012923 | Vadose Zone Soil | QYYDKVFTFTQPAVFGELAFMFWLLIKGAKPPALDPTASSSAAA* |
| Ga0137416_113696742 | 3300012927 | Vadose Zone Soil | HYYDKVYAYTQPAAFGELAFMFWLLIKGAKPPALDASASSSVAA* |
| Ga0137404_103625153 | 3300012929 | Vadose Zone Soil | LLPQYQDKVFTYSQPVFFGEVALMLWLVIKGATPPALDATASSSAAG* |
| Ga0137404_117332412 | 3300012929 | Vadose Zone Soil | DKVDSYSQPAFFGEIAFMLWLVIKGARPSALDATASSAAAG* |
| Ga0137407_100250801 | 3300012930 | Vadose Zone Soil | NVNTYSQPAFFGEIAFMLWLVIKGAKPPAPDTATSSSPLVK* |
| Ga0137407_102979962 | 3300012930 | Vadose Zone Soil | MKITVLFPQVQDKVDTYSQPAFFGKIAFMLWLLIKGARPPALDATPSSSAAR* |
| Ga0137407_105110491 | 3300012930 | Vadose Zone Soil | ILSPQYYDKVFTYSQPASLGEVAFMLWLVIKGAKPPALDATALSSASG* |
| Ga0137410_100595705 | 3300012944 | Vadose Zone Soil | YDNVFTYTQPAVFGELAFMFWLVIKGAKPPALDATASSSVAA* |
| Ga0137410_101963021 | 3300012944 | Vadose Zone Soil | SVLLPRYQDNVNTYSQPAFFGEIAFMLWLVIKGAKPPAPDTATSSSPLVK* |
| Ga0137410_101965441 | 3300012944 | Vadose Zone Soil | QYYDNVFTYTQPAVFGELAFMFWLVIKGAKPPALDATTSSSAAA* |
| Ga0137410_110844252 | 3300012944 | Vadose Zone Soil | YTQPAALGELAFMFGLVIKGAKPPALDATPASSAAG* |
| Ga0137410_117404172 | 3300012944 | Vadose Zone Soil | TYSQPAAFGEVAFMLWLVIKGAKPPALDATASSSAAVN* |
| Ga0134078_100156411 | 3300014157 | Grasslands Soil | KVFAFTQPAVFGKLAFIFWRLIKGAKPPALDATASSSADG* |
| Ga0137420_11640652 | 3300015054 | Vadose Zone Soil | QPATVGELAFMLWLIIKGARPSAPDATASSSAAA* |
| Ga0137418_100967213 | 3300015241 | Vadose Zone Soil | VGVLLPTVQDKVDTYSQPAFFGEIALMLWLAIKGARPPALDATVSSSSAA* |
| Ga0137418_102266671 | 3300015241 | Vadose Zone Soil | QPAFFGEIAFMLWLVIKGARPPALDLPASPSAAD* |
| Ga0137418_104412031 | 3300015241 | Vadose Zone Soil | QPAVFGELAFMFWLVIKGAKPPALDATASSSVAA* |
| Ga0137403_103767102 | 3300015264 | Vadose Zone Soil | LLPQYQDKVFTYSQPAFFGEVALMLWLVIKGARPPALDATASSSSAA* |
| Ga0187819_103488652 | 3300017943 | Freshwater Sediment | FTYSQPALAGELALTLWLVIKGAKPPALDTATPSAAA |
| Ga0187879_102278981 | 3300017946 | Peatland | QYQHKVYTFSQPASFGEIVFMFWLLIKGARPPAVDARTLSAAAD |
| Ga0187817_100379124 | 3300017955 | Freshwater Sediment | LGKVNTYSQPALFGEIAFMLWLVIKGAKPPALDATASTSAAQ |
| Ga0187817_102234971 | 3300017955 | Freshwater Sediment | KVDRYSQPAIIGEIAFMLWLLIKGARLPALDAAASASAA |
| Ga0187816_105315841 | 3300017995 | Freshwater Sediment | ILLPPYYDVVYRYSRPAFFSEIALMFWLLIKGAKPPALDAAALSSAAA |
| Ga0187788_102087592 | 3300018032 | Tropical Peatland | FTYAQPAFFGELAIMLWLVIKGAKPPADAAASSPSAG |
| Ga0187887_108818232 | 3300018043 | Peatland | PQFQDKVDTISQPALFGEIAFMLWLVIKGAKPPALDDTASSAPGPFNARL |
| Ga0066655_107203871 | 3300018431 | Grasslands Soil | YQGKVFAYSQPALFAELALTLWLVIKGAKPQTIEIAVAPSAA |
| Ga0066662_101281371 | 3300018468 | Grasslands Soil | NNVDTYSQPAFFGEIAFMLWLLIKGAKPPALDPTTSSSAFA |
| Ga0066662_103492172 | 3300018468 | Grasslands Soil | DKVDTYSQPAFFGEIAFMFWLLIKGAKPPAQDAAASSSAAG |
| Ga0066662_110509851 | 3300018468 | Grasslands Soil | TYSQPATLGELVFMLWLVTKGARPPALDATTLSSSAV |
| Ga0066662_117440901 | 3300018468 | Grasslands Soil | KVYAYSQPAFFGEIAFMLWLVIKGAKPPAPDATALSSAAG |
| Ga0193693_10534572 | 3300019996 | Soil | NKVFLYAQPAFFAEIALMLWLVIKGAKPPALDAAAVSSAAG |
| Ga0179594_100247531 | 3300020170 | Vadose Zone Soil | YDKVFTYSRPAAFGEVAFMLWLVIKGAKPPALEAAALSSSADA |
| Ga0210401_105410241 | 3300020583 | Soil | LLPQYQHTVFTISQPALAGEVALMLWLVIKGARPPALGAAVALSEVS |
| Ga0187846_104720221 | 3300021476 | Biofilm | SQPAVLGELAFMLWLVVKGAKPPALDAAASSSAVG |
| Ga0210402_110876351 | 3300021478 | Soil | TGVLLPQYYDKVFTYCQPASFGEVALMLWLVIRGAKPPALEAAALSLAVA |
| Ga0242642_10387102 | 3300022504 | Soil | FTYTQPAVLGEVAFMLWLAIKGARPPALDATALPSAAA |
| Ga0222728_11176762 | 3300022508 | Soil | PQYQDQVFTYAQPASIGEVAFMLWLLIKGAKPPAPDAVALSPAPA |
| Ga0247670_10406501 | 3300024283 | Soil | VRTIPPCISQPAAFGELAFIFWLLIKGARPPAFDAAALSSASG |
| Ga0179589_101751631 | 3300024288 | Vadose Zone Soil | ARGSTYAQPASFGEVAFMLWLVIKGARALALDATALSSVVS |
| Ga0137417_13405261 | 3300024330 | Vadose Zone Soil | LPQVQDTHSQPAFFGEIAFMLWLVIKGARPPALDLPASPSA |
| Ga0207692_103907542 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SLTGILMPQYQNKVDTYSQPAFIGEIVFMLWLAIKGAQPPARDTGASSSTTG |
| Ga0207680_106461753 | 3300025903 | Switchgrass Rhizosphere | HQNKVFLYSQPALFGELALMLWLVIKGTKSPLDATASSNAAI |
| Ga0209055_10362201 | 3300026309 | Soil | FTYAQPAFFGEIALMLWLAIKGARPPALDATALSSSAAR |
| Ga0209239_12368242 | 3300026310 | Grasslands Soil | YHDKVFTYAQTAFFGEIALMLWLVIKGARPPALDATASSSAAAR |
| Ga0209761_13273481 | 3300026313 | Grasslands Soil | QNNVDTYSQPAFFGEIAFMLWLLIKGAKPPALDPTTSSSAFA |
| Ga0209266_10995272 | 3300026327 | Soil | VFTYAQPASFGELAFMFWLLIKGARPPALDAAASSSAAA |
| Ga0257157_10476882 | 3300026496 | Soil | LSPQNYDKVFTYSQPAAFGEIALMLWLVIEGARPRALDAAASSSAAA |
| Ga0257181_10438001 | 3300026499 | Soil | PQVQDKVDTYSQPAFFGEIALMLWLVIKGAKPPALGATASSSAA |
| Ga0209056_103002502 | 3300026538 | Soil | PFTQPAVFGELAFMFWLLTKGPTPSALDPTASSRL |
| Ga0209076_11000701 | 3300027643 | Vadose Zone Soil | YSQPAAFGEVAFMLWLVIKGAKPPALEAAALSSSADA |
| Ga0209117_10220742 | 3300027645 | Forest Soil | VGVLLPQVQDKVDTYSQPAFFGEIALMLWLVIKGARPPALDAADLSSAAG |
| Ga0209588_10235664 | 3300027671 | Vadose Zone Soil | SPQYYDKAFTFTQPAVFGEIAFMLWLIIKGARPPALDATASLSSAAG |
| Ga0209588_10777421 | 3300027671 | Vadose Zone Soil | QVQDKAYTYSQPAFFGEIAFMLWLVVKGARPPAVDATASSSAAA |
| Ga0209588_12072732 | 3300027671 | Vadose Zone Soil | VNAYSQSAFFGEIAFMLWLVIKGAKPPALDATALSSAGG |
| Ga0209180_104745062 | 3300027846 | Vadose Zone Soil | QDKVDTYSQPAFFGEIAFMLWLVIKGARPPALDAAALSSAAA |
| Ga0209180_106595421 | 3300027846 | Vadose Zone Soil | YSQPAIFGEIAFMLWLVIKGARPPALDATSLSSSAA |
| Ga0209701_101635411 | 3300027862 | Vadose Zone Soil | LMGVLLPQVQDKVDSYSQPAVIGEIAFMLWLVLKGAKPPALDAAPSSSAAS |
| Ga0209701_101756861 | 3300027862 | Vadose Zone Soil | FTFTQPAVFGELAFMFWLLIKGAKPPALDATASSSAAG |
| Ga0209701_103129892 | 3300027862 | Vadose Zone Soil | ILLPQVQDKVDTYTQPAVLGELAFMFWLLIKGAKPPALDAAASSSAAA |
| Ga0209283_102066381 | 3300027875 | Vadose Zone Soil | VFILSQPALFGEVAFMLWLVIKGAKPPALDAAASSSPAG |
| Ga0209488_105633021 | 3300027903 | Vadose Zone Soil | LLPQYYDKVFTYTQPAVFGEIAFLLWLIIKGARPPALDATASAAAAA |
| Ga0209583_102437641 | 3300027910 | Watersheds | NYDKVFIYTQPAAFGEVALMLWLVIKGAKPPALDAVASSAAAA |
| Ga0209526_108519431 | 3300028047 | Forest Soil | DAYSQPAVLGEVAFMLWLLIKGAKPPAPEARASSAAA |
| Ga0311368_103263511 | 3300029882 | Palsa | SQVNTCCQPAFFGEIAFMLWLLIRGAKSQVPDAEHSSSAIA |
| Ga0302304_103015362 | 3300029993 | Palsa | LPQYQHKVYTFSQPASFGEIVFMFWLLIKGAKPPAVDARTLSAAAD |
| Ga0311356_106613921 | 3300030617 | Palsa | YSQPAVLGEIAFMLWLLIKGAKPPADATDSSAAAA |
| Ga0311354_102176444 | 3300030618 | Palsa | KVYTYTQPAVLGEIALMLWLLIKGAKPPVLAAAASAAP |
| Ga0302310_100605124 | 3300030737 | Palsa | VNTYSQPAVLGEIAFMLWLLIKGAKPPADATGSSAVAAA |
| Ga0170823_101963582 | 3300031128 | Forest Soil | SQPALFAEVALMLWLVIKGAKPPVPALAASSPLVA |
| Ga0170824_1261715601 | 3300031231 | Forest Soil | QDKVNTFSQPAMIGEIVFMFWLLIKGAKPTPIAASASTSEAVV |
| Ga0307477_103246722 | 3300031753 | Hardwood Forest Soil | SLSTPARFGEVALMLWLVIKGSKPQPLHAVASSSVAD |
| Ga0307479_100185521 | 3300031962 | Hardwood Forest Soil | DKAYSYSQPAIIGEIAFMLWLLIKGAKPPALDASAS |
| Ga0307479_102020793 | 3300031962 | Hardwood Forest Soil | YSQPAVFGEIAFMLWLAIKGAKPPALDLAAVSVGR |
| Ga0307479_113678051 | 3300031962 | Hardwood Forest Soil | VLLPQYYGKAYTYTQPAILGEVAFMLWLSIKGARPSALDATALSSAAA |
| Ga0307471_1010769441 | 3300032180 | Hardwood Forest Soil | YYDKVFTYTQPAVIGEIAFMLWLVIKGAKPPALDATGSSSSAA |
| Ga0307472_1005008281 | 3300032205 | Hardwood Forest Soil | HSQPAFFGDVALMLWLVIKGATPPALDSTAASSAAG |
| Ga0335082_104780141 | 3300032782 | Soil | YQDRVFAYSQPALFGELAIMLWLVIKGARPPAEATGLAPATA |
| Ga0335078_118545992 | 3300032805 | Soil | APSHQTQVFTYSQLAFFGEIALMLWLLIRGAKPPSPEAAQV |
| ⦗Top⦘ |