Basic Information | |
---|---|
Family ID | F041405 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 160 |
Average Sequence Length | 41 residues |
Representative Sequence | LVSEIEKAKSVDAAATALAERVRLLKEAARHGLSRREVAP |
Number of Associated Samples | 140 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.38 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.750 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.375 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF01817 | CM_2 | 85.00 |
PF00793 | DAHP_synth_1 | 12.50 |
PF02153 | PDH_N | 1.88 |
PF01144 | CoA_trans | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG1605 | Chorismate mutase | Amino acid transport and metabolism [E] | 85.00 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.88 |
COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.62 |
COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.62 |
COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.75 % |
Unclassified | root | N/A | 1.25 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10777162 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100224082 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300002909|JGI25388J43891_1049071 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 631 | Open in IMG/M |
3300002914|JGI25617J43924_10087049 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300004633|Ga0066395_10481592 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 712 | Open in IMG/M |
3300005436|Ga0070713_100305522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1466 | Open in IMG/M |
3300005437|Ga0070710_11308275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300005467|Ga0070706_100812777 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005533|Ga0070734_10764821 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005537|Ga0070730_10122790 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300005547|Ga0070693_101256939 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300005559|Ga0066700_10571878 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300005568|Ga0066703_10235327 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300005591|Ga0070761_11019191 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005617|Ga0068859_100560069 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300005712|Ga0070764_10525589 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus | 714 | Open in IMG/M |
3300005994|Ga0066789_10044764 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300006050|Ga0075028_100613962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 647 | Open in IMG/M |
3300006172|Ga0075018_10454516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300006173|Ga0070716_101285853 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300006642|Ga0075521_10432018 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 642 | Open in IMG/M |
3300006797|Ga0066659_11351059 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300006903|Ga0075426_10543041 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 865 | Open in IMG/M |
3300007265|Ga0099794_10613744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300007265|Ga0099794_10687263 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300007788|Ga0099795_10174766 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 894 | Open in IMG/M |
3300007788|Ga0099795_10408200 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300009038|Ga0099829_10357505 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300009088|Ga0099830_10201314 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300009088|Ga0099830_10368107 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300009088|Ga0099830_11551727 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300009090|Ga0099827_11839289 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300009143|Ga0099792_10605563 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300009521|Ga0116222_1113931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → environmental samples → uncultured Clostridium sp. | 1164 | Open in IMG/M |
3300009672|Ga0116215_1069416 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
3300009698|Ga0116216_10604843 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 660 | Open in IMG/M |
3300010048|Ga0126373_12080985 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 630 | Open in IMG/M |
3300010326|Ga0134065_10001392 | All Organisms → cellular organisms → Bacteria | 5648 | Open in IMG/M |
3300010335|Ga0134063_10446096 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300010343|Ga0074044_10202794 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300010358|Ga0126370_12116080 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010361|Ga0126378_12933047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300010376|Ga0126381_105102809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300010398|Ga0126383_12947805 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010937|Ga0137776_1124005 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300011120|Ga0150983_12239311 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300011120|Ga0150983_13731615 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300011271|Ga0137393_10520345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
3300012202|Ga0137363_10859449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
3300012205|Ga0137362_10118779 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
3300012207|Ga0137381_10935000 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 749 | Open in IMG/M |
3300012362|Ga0137361_10982987 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 763 | Open in IMG/M |
3300012363|Ga0137390_11640656 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012582|Ga0137358_10609580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300012917|Ga0137395_10828669 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 670 | Open in IMG/M |
3300012925|Ga0137419_11265914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300012927|Ga0137416_10381920 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300012929|Ga0137404_11859407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300012971|Ga0126369_10845691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
3300014325|Ga0163163_11834900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300014658|Ga0181519_10744861 | Not Available | 605 | Open in IMG/M |
3300015053|Ga0137405_1300009 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
3300015053|Ga0137405_1417798 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300015241|Ga0137418_11022503 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300016270|Ga0182036_10198709 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300016270|Ga0182036_10582281 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300016319|Ga0182033_10648447 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300016357|Ga0182032_10877822 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae | 761 | Open in IMG/M |
3300016387|Ga0182040_10765727 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300016404|Ga0182037_11355743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300016445|Ga0182038_10619313 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300017822|Ga0187802_10238133 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus → Rhodothermus profundi | 703 | Open in IMG/M |
3300017946|Ga0187879_10330118 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 846 | Open in IMG/M |
3300017961|Ga0187778_11040177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300017973|Ga0187780_10125853 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300017994|Ga0187822_10338178 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300017995|Ga0187816_10060410 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300018017|Ga0187872_10161453 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300018047|Ga0187859_10463086 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300018062|Ga0187784_11352049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300018088|Ga0187771_11585929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300018088|Ga0187771_11636205 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300020199|Ga0179592_10079891 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300020199|Ga0179592_10082061 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300020199|Ga0179592_10484709 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300020579|Ga0210407_10717714 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300020580|Ga0210403_10077659 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
3300020580|Ga0210403_10471908 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300020580|Ga0210403_11241734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300020580|Ga0210403_11260550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300020583|Ga0210401_11288569 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300021168|Ga0210406_10019505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6347 | Open in IMG/M |
3300021178|Ga0210408_10355971 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300021180|Ga0210396_10126060 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
3300021363|Ga0193699_10163978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300021402|Ga0210385_11247320 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300021403|Ga0210397_11281531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus → Rhodothermus profundi | 569 | Open in IMG/M |
3300021407|Ga0210383_10110418 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
3300021420|Ga0210394_10190413 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300021420|Ga0210394_10980979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus → Rhodothermus profundi | 733 | Open in IMG/M |
3300021559|Ga0210409_10035340 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4768 | Open in IMG/M |
3300021560|Ga0126371_10870945 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300022557|Ga0212123_10259600 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300024288|Ga0179589_10039767 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300025905|Ga0207685_10314821 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300025910|Ga0207684_11170118 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300025932|Ga0207690_10457440 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300026291|Ga0209890_10045840 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
3300026304|Ga0209240_1199780 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300026328|Ga0209802_1224595 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300026360|Ga0257173_1055431 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300026497|Ga0257164_1001311 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
3300026524|Ga0209690_1061067 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300026551|Ga0209648_10361873 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300026557|Ga0179587_10061759 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300026800|Ga0207742_116374 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300026880|Ga0209623_1014188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300027014|Ga0207815_1000638 | All Organisms → cellular organisms → Bacteria | 5396 | Open in IMG/M |
3300027505|Ga0209218_1080940 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300027528|Ga0208985_1020722 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300027565|Ga0209219_1146252 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300027605|Ga0209329_1046367 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300027651|Ga0209217_1079689 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300027674|Ga0209118_1009141 | All Organisms → cellular organisms → Bacteria | 3460 | Open in IMG/M |
3300027903|Ga0209488_10377775 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300027986|Ga0209168_10048718 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
3300027986|Ga0209168_10534496 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300028536|Ga0137415_11398080 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300028906|Ga0308309_11902190 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300029636|Ga0222749_10492444 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300030707|Ga0310038_10333371 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300031545|Ga0318541_10171250 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300031572|Ga0318515_10338364 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300031716|Ga0310813_11601397 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031719|Ga0306917_10383673 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300031720|Ga0307469_10296421 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300031753|Ga0307477_10178362 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300031754|Ga0307475_10607521 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300031754|Ga0307475_10653957 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300031754|Ga0307475_11281664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300031771|Ga0318546_11084086 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031780|Ga0318508_1011202 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300031796|Ga0318576_10455683 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae | 604 | Open in IMG/M |
3300031796|Ga0318576_10549510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300031833|Ga0310917_10565676 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300031859|Ga0318527_10118002 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300031912|Ga0306921_10965417 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300031959|Ga0318530_10349596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300031962|Ga0307479_10408508 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300031962|Ga0307479_11384799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300031962|Ga0307479_11901119 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300032035|Ga0310911_10667898 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300032174|Ga0307470_11282669 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300032205|Ga0307472_100890158 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300032783|Ga0335079_10186665 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
3300032805|Ga0335078_12727850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300032828|Ga0335080_10104004 | All Organisms → cellular organisms → Bacteria | 3151 | Open in IMG/M |
3300033289|Ga0310914_11819447 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300033820|Ga0334817_042124 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.88% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.25% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.25% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.62% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.62% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.62% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_107771622 | 3300001593 | Forest Soil | ANAAVVGSTLVSEIENAKSVEAASAALAARVRSLKQAATHGLSRREVAP* |
JGIcombinedJ26739_1002240824 | 3300002245 | Forest Soil | IENAKSVGAASSALAALVRLLKDAATHGLSRREVAP* |
JGI25388J43891_10490713 | 3300002909 | Grasslands Soil | VSEIEKAKSVDGAAAALAARVRSLKEAARHGLSRREVAP* |
JGI25617J43924_100870491 | 3300002914 | Grasslands Soil | VSEIEKAMSVDAAAAALAERVRSFKQAARHGLSRREVAP* |
Ga0066395_104815921 | 3300004633 | Tropical Forest Soil | AVVGSALVAEIEAAANIEAAAVALRDRVHSLKEAGRKGLSRREASL* |
Ga0070713_1003055223 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LVSEIEQAKSVDAACTALAERVRSLKQAATHGLSRREVAP* |
Ga0070710_113082751 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QAKSVDAAAAALAERVRSLKSAGSQGLSRREAARREVAT* |
Ga0070706_1008127773 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VGSALVSEIEKSASVDAACTALRGRVHALKDAARRGLSRREATL* |
Ga0070734_107648211 | 3300005533 | Surface Soil | GSALVSEIEKAESVDAAAQALGAKIRSLKEAGRKGLSRREVAP* |
Ga0070730_101227904 | 3300005537 | Surface Soil | VSEIEKAPSVEAASAALRERIKGLKEAGRRGLSRREATI* |
Ga0070693_1012569392 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DAAVVGSALVSEIENAKSIEAACGALDARVRSLKQAATHGLSRREVAP* |
Ga0066700_105718783 | 3300005559 | Soil | SEIEKAKSVDGAANALAERVRSLKEAARHGLSRREVAP* |
Ga0066703_102353273 | 3300005568 | Soil | SALVSEIEKAPSVDAAAVALGDRIRALKQAARRGLSRREVAP* |
Ga0070761_110191911 | 3300005591 | Soil | SALVSEIEKAESVDAAAQALGAKIRSLKEAGKKGLSRREVAP* |
Ga0068859_1005600691 | 3300005617 | Switchgrass Rhizosphere | ALVSEIEQAKSVDAAATALAERVRLFKSAGSQGLSRREAASREVAT* |
Ga0070764_105255893 | 3300005712 | Soil | DAAVIGSALVSEIENAKSVDAAATALAARIRLLKEAARHGLSRREVAL* |
Ga0066789_100447644 | 3300005994 | Soil | LVSEIENAKSVDAAAEALATRIRSLKQAASHGLSRREVAP* |
Ga0075028_1006139621 | 3300006050 | Watersheds | AVVGSALVSEIEKASSTAVASAALRERIRALKEAGQKGLSRREATL* |
Ga0075018_104545161 | 3300006172 | Watersheds | ANAKSVADAVTALRAKVSSLKEAGRHGLSRREATP* |
Ga0070716_1012858533 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QAESVDAACSALASRVRSLKQAATHGLSRREVAP* |
Ga0075521_104320183 | 3300006642 | Arctic Peat Soil | IEKAASTATACAALRERIHLLKEAGRKGLSRREATP* |
Ga0066659_113510591 | 3300006797 | Soil | VVGSALVSEIEKAKFVDEAAAALRERVRSLKEAARHGLSRREVAP* |
Ga0075426_105430411 | 3300006903 | Populus Rhizosphere | VSEIEQAKSVDAAAAALAERVRSLKSAGNQGLSRREAASREVAT* |
Ga0099794_106137441 | 3300007265 | Vadose Zone Soil | ERAKSVDGAATALAERVRSLKDAARHGLSRREVAP* |
Ga0099794_106872631 | 3300007265 | Vadose Zone Soil | IEKAQSVDSAASALGARIRSLKEAARHGLSRREVAK* |
Ga0099795_101747663 | 3300007788 | Vadose Zone Soil | LADAAVVGSALVSEIEDAKSVDVASAALATRIRTLKQAATHGLSPREVAP* |
Ga0099795_104082002 | 3300007788 | Vadose Zone Soil | LGGLADATDVGSALVAEIENAESGDAASAALAARVHSLKQAATHGLSRREVAP* |
Ga0099829_103575053 | 3300009038 | Vadose Zone Soil | DAAVVGSALVSEIENAKSVEAAGTALAARVRSLKQAATHGLSRREVAP* |
Ga0099830_102013141 | 3300009088 | Vadose Zone Soil | IEKAKSVEAAAAALSERVRSLKEAARHGLSRREVAP* |
Ga0099830_103681073 | 3300009088 | Vadose Zone Soil | VSEIEKSKSAAAAALAERIRAFKAAAQHGLSRREVAP* |
Ga0099830_115517271 | 3300009088 | Vadose Zone Soil | LVSEIEKASSVDAAAVALGDRIRALKQAARHGLSRREVAP* |
Ga0099827_118392891 | 3300009090 | Vadose Zone Soil | VSEIENAKSVEAASVALAARVRSLKQAATHGLSRREVAP* |
Ga0099792_106055633 | 3300009143 | Vadose Zone Soil | EIENAESVDAACAALAARIRTLKQAATHGLSRREVAP* |
Ga0116222_11139313 | 3300009521 | Peatlands Soil | AAVVGSALVSEIEKAPSPEAAAIALGGRVRALKEAARHGLSRREVAP* |
Ga0116215_10694161 | 3300009672 | Peatlands Soil | KAPSPEAAAIALGGRVRALKEAARHGLSRREVAP* |
Ga0116216_106048431 | 3300009698 | Peatlands Soil | AAVVGSALVSEIEKARSPEAAATALRERVRALKEAARHGLSRREVAP* |
Ga0126373_120809851 | 3300010048 | Tropical Forest Soil | LVSEIEKASTPGAAVGALRDRVHSFKAAARHGLSRREALP* |
Ga0134065_100013927 | 3300010326 | Grasslands Soil | SEIEKAKSVDGAAAALAARVRSLKEAARHGLSRREVAP* |
Ga0134063_104460961 | 3300010335 | Grasslands Soil | ALVSEIEKAKSVDGAAAALAECVRLLKEAARHGLSRREVAP* |
Ga0074044_102027943 | 3300010343 | Bog Forest Soil | LADAAVVGSALVSEIETAPSPVAAATALRARVKILKEAARRGLSRREATP* |
Ga0126370_121160801 | 3300010358 | Tropical Forest Soil | EIEQAKSVDAAAAALAERVRSLKGAASQGLSRREVAT* |
Ga0126378_129330472 | 3300010361 | Tropical Forest Soil | VSEIEKAPTPDAAARALRDRMHSFKEAARHGLSRREALP* |
Ga0126381_1051028092 | 3300010376 | Tropical Forest Soil | SALVAEIEKAPSVQDAADALRERVAKLKEAGRQGLSRREATR* |
Ga0126383_129478052 | 3300010398 | Tropical Forest Soil | SALVTQIEAASNVEAAAAALRDRVHSLKEAGRKGLSRREATL* |
Ga0137776_11240053 | 3300010937 | Sediment | DAAVIGSSLVSEIEKASSIEAGAGTLAARIRSLKQAAQAGMSKREVAP* |
Ga0150983_122393112 | 3300011120 | Forest Soil | EKAPSVEAAAVALGDRLHALKQAARHGLSRREVAP* |
Ga0150983_137316151 | 3300011120 | Forest Soil | ENAKSVEAAGAALGQRIRSLKQAATHGLSRREVAP* |
Ga0137393_105203451 | 3300011271 | Vadose Zone Soil | EIEKAPSVDAASEALGNRIRALKQAARHGLSRREVAP* |
Ga0137389_116704901 | 3300012096 | Vadose Zone Soil | SALVSEIANAKSVEAASAALAARVRSLKQAATHGLSRRPAPAHRGEVAP* |
Ga0137363_108594493 | 3300012202 | Vadose Zone Soil | VGSALVSEIENAKSIDAACAALAARVSSLKQAATHGLSRREVAP* |
Ga0137362_101187794 | 3300012205 | Vadose Zone Soil | ALVSEIEKAMSVDAAAAALAERVRSFKQAARHGLSRREVAP* |
Ga0137381_109350001 | 3300012207 | Vadose Zone Soil | IEKATSVDAAAAALGDRIRALKQAARHGLSRREVAP* |
Ga0137361_109829871 | 3300012362 | Vadose Zone Soil | AVIGSALVSEIEKASSIAAAASALAAKIRPLKEAARHGLSRREVAP* |
Ga0137390_116406561 | 3300012363 | Vadose Zone Soil | EIENAKSVEAASAALAGRIRSLKQAATHGLSRREVAP* |
Ga0137358_106095801 | 3300012582 | Vadose Zone Soil | VSEIEKAKSVDGAATALAERVRSLKDAARHGLSRREVAP* |
Ga0137395_108286693 | 3300012917 | Vadose Zone Soil | SEIEKAQSVDAAAVALGDRVRALKQAARRGLSRREVAP* |
Ga0137419_112659142 | 3300012925 | Vadose Zone Soil | VVGSALVAEIEKAPSIEAACSALRERVHLLKEAGRKGLSRREATI* |
Ga0137416_103819201 | 3300012927 | Vadose Zone Soil | EIEKAKSVEAAAAALSERVRSLKETARHGLSRREVGP* |
Ga0137404_118594071 | 3300012929 | Vadose Zone Soil | LADAAVIGSALVSEIEKAHSVDAAASALAARIRSIKDAARHGLSRREVAP* |
Ga0126369_108456911 | 3300012971 | Tropical Forest Soil | IEKAPTPDAAARALRDRMHSFKEAARHGLSRREALP* |
Ga0163163_118349002 | 3300014325 | Switchgrass Rhizosphere | VVGSALVSEIEQAKSVDAAATALAERVRLFKSAGSQGLSRREAASREVAT* |
Ga0181519_107448612 | 3300014658 | Bog | DAAVIGSALVSEIEKAPSPEAAAAALRTRVRALKEAASRGLSRREAST* |
Ga0137405_13000091 | 3300015053 | Vadose Zone Soil | VSEIEKAPSVEAAAAALGERIRALKQAARHGLSRREVAP* |
Ga0137405_14177984 | 3300015053 | Vadose Zone Soil | LADAAVIGSALVSEIEKAPSIDAAASALAEKIRPLKDAARHGLSRREVAP* |
Ga0137418_110225032 | 3300015241 | Vadose Zone Soil | SEIEKAKSVDAAAAALAERVRSFKEAARHGLSRREVAP* |
Ga0182036_101987093 | 3300016270 | Soil | GSALVSEIEKASSPDAAASALRMRIHSLKEAARHGLSRREATP |
Ga0182036_105822811 | 3300016270 | Soil | IEKAPSVQDAADALRERVAKLKEAGRQGLSRREATR |
Ga0182033_106484471 | 3300016319 | Soil | ALVSEIEKAPTPDGAARALRERLHSFKEAARHGLSRREALP |
Ga0182032_108778223 | 3300016357 | Soil | AAVVGSALVSEIEHAANPDAAAAALCERVRKLKEAGRHGLSRREATS |
Ga0182040_107657271 | 3300016387 | Soil | EIEKAPSVQDAADALRERVAKLKEAGRQGLSRREATR |
Ga0182037_113557432 | 3300016404 | Soil | GSALVSEVEKAPTPDAAARALRDRMHSFKEAARHGLSRREALP |
Ga0182038_106193133 | 3300016445 | Soil | VVGSALVSEIEKASSVDAASAALRDRVRSLKDAARRGLSRREATP |
Ga0187802_102381333 | 3300017822 | Freshwater Sediment | EKASSAESAVSALRERVQKLKEAGRHGLSRREASP |
Ga0187879_103301183 | 3300017946 | Peatland | TEIENANSVDAAAVALAARIRPLKEAARHGLSRREVAR |
Ga0187778_110401772 | 3300017961 | Tropical Peatland | VGSALVSEIEKASSPDAAVNALRDRIRSLKEAGRKGLSRREATS |
Ga0187780_101258531 | 3300017973 | Tropical Peatland | ALVSEIEQAANPDAAASALRERVRKLKEAGRHGLSRREATP |
Ga0187822_103381781 | 3300017994 | Freshwater Sediment | ALVSEIERATSPDAAAAALRDRVQKLKEAARHGLSRREATP |
Ga0187816_100604103 | 3300017995 | Freshwater Sediment | EHAANPDTAALALRERVQTLKEAGRHGLSRREATL |
Ga0187872_101614533 | 3300018017 | Peatland | IERAGSEAAAAKALGTRVRALKQAALQGLSRRGTEA |
Ga0187859_104630861 | 3300018047 | Peatland | SALVTEIENANSVDAAAVALAARIRPLKEAARHGLSRREVAR |
Ga0187784_113520491 | 3300018062 | Tropical Peatland | IEKAASPEAAATTLRERVRALKEAARHGLSRREATP |
Ga0187771_115859292 | 3300018088 | Tropical Peatland | EIEKATNPDAAAAALRARVQTLKEAARHGLSRREAIR |
Ga0187771_116362052 | 3300018088 | Tropical Peatland | EKAATPDAAASALRERVQKLKEAACRGLSRREAKR |
Ga0179592_100798913 | 3300020199 | Vadose Zone Soil | VSEIEKAPSIDAAALALGNRIRALKEAARHGLSRREVAP |
Ga0179592_100820611 | 3300020199 | Vadose Zone Soil | LVSEIEKAKSVDAAAAALAERVRLFKEAARHGLSRREVAP |
Ga0179592_104847091 | 3300020199 | Vadose Zone Soil | DAAVVGSALVSEIEQASSVEAASAALRDRVTVLKEAGRKGLSRREATT |
Ga0210407_107177143 | 3300020579 | Soil | VVGSALVSEIENAKSVEAASTALAARVRLFKQAATHGLSRREVAP |
Ga0210403_100776594 | 3300020580 | Soil | EIEKAKSVDAAAVALGDRIRALKQAARRGLSRREVIP |
Ga0210403_104719083 | 3300020580 | Soil | ALVSEIEKAQSIEDAAASLGARIRALKEAARHGLSRREVAP |
Ga0210403_112417341 | 3300020580 | Soil | CEIEKAQSADAAAFALAERIRSLKEAARHGLSRREAAP |
Ga0210403_112605501 | 3300020580 | Soil | SEIEKSSSVEAACAALRERVSVLKEAGRRGLSRREATI |
Ga0210401_112885692 | 3300020583 | Soil | LVSEIENAKSVEAASVALTTRIRSLKQAATHGLSRREVAP |
Ga0210406_100195059 | 3300021168 | Soil | ADAAVVGSALVSEIEKSSSVEAASAALRERVQMLKEAGRRGLSRREATI |
Ga0210408_103559711 | 3300021178 | Soil | IEKAQSIDAASTSLGAKIRALKEAARHGLSRREVAP |
Ga0210396_101260604 | 3300021180 | Soil | VGSSLVSEIEKAPSVEAACAALRERVRVFKEAGRRGLSRREATI |
Ga0193699_101639784 | 3300021363 | Soil | SLVSEIEQSKTPDLAAAALSERVRLLKSVARNGLSRREVMS |
Ga0210385_112473201 | 3300021402 | Soil | VGSALVSEIEQAKSVDAGAAALAEKVRSLKAAARHGLSRREVAT |
Ga0210397_112815311 | 3300021403 | Soil | SEIEKAESVDAAAQVLGAKIRSLKEAGKKGLSRREVAP |
Ga0210383_101104184 | 3300021407 | Soil | VVGSALVSEIAKATSVDAACAALRDRVHALKDAARRGLSRREATP |
Ga0210394_101904131 | 3300021420 | Soil | VGSALVSEIEKAQSVDAAATALGNRIRALKEAARHGLSRREVAP |
Ga0210394_109809791 | 3300021420 | Soil | EIEKSSSVEAASAALGERVSILKEAGRRGLSRREATI |
Ga0210409_100353401 | 3300021559 | Soil | EIEKAPSVDAAALALGNRIRALKEAARHGLSRREVAP |
Ga0126371_108709453 | 3300021560 | Tropical Forest Soil | EKASTPGAAVGALRDRVHSFKAAARHGLSRREALP |
Ga0212123_102596003 | 3300022557 | Iron-Sulfur Acid Spring | AEVERAGSAAAAAQAVGERVRALKEAARHGISRREADSRRG |
Ga0179589_100397674 | 3300024288 | Vadose Zone Soil | SEIEKAQSVDAAAVALGDCVRALKQAARRGLSRREVAP |
Ga0207685_103148211 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SALVSEIENEKSIDAACAALAARIRSLKQAATHGLSRREVAP |
Ga0207684_111701182 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGGLGNAADVGSALVSEIEKSASVDAACTALRGRVHALKDAARRGLSRREATL |
Ga0207690_104574403 | 3300025932 | Corn Rhizosphere | ALVSEIEQAKSVDAAATALAERVRLFKSAGSQGLSRREAASREVAT |
Ga0209890_100458403 | 3300026291 | Soil | LVSEIENAKSVDAAAEALATRIRSLKQAASHGLSRREVAP |
Ga0209240_11997802 | 3300026304 | Grasslands Soil | VSEIENAKSVEAAGAALAARIRSLKQAATHGLSRREVAP |
Ga0209802_12245951 | 3300026328 | Soil | EIEKAASADAAARAVGERVRALKEAARQGMSRREVSR |
Ga0257173_10554311 | 3300026360 | Soil | GSVLVEEIERAASVDEAASAVAARIRSFKQAASQGLSRREARP |
Ga0257164_10013114 | 3300026497 | Soil | VIGSALVSEIEKAHSVDAAASALAARIRPLKDATRHGLSRREVAP |
Ga0209690_10610671 | 3300026524 | Soil | LVSEIEKAKSVDAAATALAERVRLLKEAARHGLSRREVAP |
Ga0209648_103618731 | 3300026551 | Grasslands Soil | SEIENAKSVEAAGAALAARIRSLKQAATHGLSRREVAP |
Ga0179587_100617591 | 3300026557 | Vadose Zone Soil | ALVSEIEKAKSVDAAAAALAERVRLFKEAARHGLSRREVAP |
Ga0207742_1163741 | 3300026800 | Tropical Forest Soil | AVVGSALVSEIEKASSVETATAALRDRVQKLKEAGRHGLSRREATR |
Ga0209623_10141883 | 3300026880 | Forest Soil | VAEIEHAKTPQQAAKALHERIGILKEAARHGLSKREVAP |
Ga0207815_100063810 | 3300027014 | Tropical Forest Soil | SEIEKASTPEAAARALRDRMHSFKEAARHGLSRREALP |
Ga0209218_10809401 | 3300027505 | Forest Soil | LADAAVIGSALVSEIEKADSVDAAAQALGAKIRSLKEAGKKGLSRREVAP |
Ga0208985_10207223 | 3300027528 | Forest Soil | AAVIGSALVTEIENANSVDAAAAALAARIRPLKQAARLGLSRREVTQ |
Ga0209219_11462522 | 3300027565 | Forest Soil | ANAAVVGSTLVSEIENAKSVEAASAALAARVRSLKQAATHGLSRREVAP |
Ga0209329_10463671 | 3300027605 | Forest Soil | AVIGSALVSDIENARSVDDAATALAARIRSFKEAARHGLSRREVAL |
Ga0209217_10796893 | 3300027651 | Forest Soil | SEVEKASSPDAAANALRNRLRDLKEAGRQGLSRREVAT |
Ga0209118_10091415 | 3300027674 | Forest Soil | GSALVAEIEKAPSVEAAAAALGDRLRALKQAARHGLSRREVAP |
Ga0209488_103777753 | 3300027903 | Vadose Zone Soil | AQSVDAAAAALAERVRSFKEAARHGLSRREAAMHRGEVAT |
Ga0209168_100487181 | 3300027986 | Surface Soil | VVGSALVSEIEKAESVDAAAQALGAKIRSLKEAGKRGLSRREVAP |
Ga0209168_105344962 | 3300027986 | Surface Soil | GGLADAAVIGSALVSEIEKADSVDAAAQALGAKIRSLKEAGKKGLSRREVAP |
Ga0137415_113980802 | 3300028536 | Vadose Zone Soil | EIEKAKSVEAAAAALSERVRSLKETARHGLSRREVGP |
Ga0308309_119021902 | 3300028906 | Soil | TSAPSINAAAAALAERVRSLKEAARRGLSRREVAT |
Ga0222749_104924441 | 3300029636 | Soil | IGSSLVSEIENAKSVEAASAALATRIRSLKQAATHGLSRREVAP |
Ga0310038_103333711 | 3300030707 | Peatlands Soil | GSALVSEIEKASSVEAAAAALADRIRALKQAARHGLSRREVAP |
Ga0318541_101712501 | 3300031545 | Soil | VSEIEKGATVDTTAAALRDRLLQLKEAGRHGLSRRGAG |
Ga0318515_103383643 | 3300031572 | Soil | VIGSALVSEIEKASTPGAAVGALRDRVRSFKAAARHGLSRREALP |
Ga0310813_116013971 | 3300031716 | Soil | GSALVSEIEQAKSVDVGAAALAERIRSLKAAGTQGLSRREPVNRESTSREVAR |
Ga0306917_103836733 | 3300031719 | Soil | SALVSEVEKAPTPDAAARALRDRMHSFKEAARHGLSRREALP |
Ga0307469_102964213 | 3300031720 | Hardwood Forest Soil | SEIEKASSVEAASAALRDRVKMLKEAGRRGLSRREATI |
Ga0307477_101783623 | 3300031753 | Hardwood Forest Soil | AAVVGSALVSEIENAKSVEAASTALAARVRSLKQAATHGLSRREVAP |
Ga0307475_106075211 | 3300031754 | Hardwood Forest Soil | LVSEIENAKSVDAAVTALAARIRSFKEAARHGLSRREVAL |
Ga0307475_106539571 | 3300031754 | Hardwood Forest Soil | GSALVAEIEKAPSIEAASAALRERVKVLKEAGRRGLSRREATI |
Ga0307475_112816641 | 3300031754 | Hardwood Forest Soil | EKALSVEAACAALRDRLKMLKEAGRHGLSRREATI |
Ga0318546_110840861 | 3300031771 | Soil | VSEIEKASTPDAAARALRDRMHSFKEAARHGLSRREAFP |
Ga0318508_10112021 | 3300031780 | Soil | ALVSEIEKASTPGAAVGALRDRVHSFKAAARHGLSRREALP |
Ga0318576_104556831 | 3300031796 | Soil | SALVAEIEKAPSVQDAADALRERVAKLKEAGRQGLSRREATR |
Ga0318576_105495103 | 3300031796 | Soil | IGSALVSEIEKASTPGAAVGALRDRVRSFKAAARHGLSRREALP |
Ga0310917_105656761 | 3300031833 | Soil | SALVSEIEKASTPGAAVGALRDRVRSFKAAARHGLSRREALP |
Ga0318527_101180021 | 3300031859 | Soil | SALVSEIEKASTPGAAVGALRDRVHSFKAAARHGLSRREALP |
Ga0306921_109654173 | 3300031912 | Soil | ALVSEIEKGATVDTTAAALRDRLLQLKEAGRHGLSRRGAG |
Ga0318530_103495963 | 3300031959 | Soil | VVGSALVSEIEKASSPDAAASALRMRIHSLKEAARHGLSRREATP |
Ga0307479_104085084 | 3300031962 | Hardwood Forest Soil | LVSEIEKASSVEAASAALRDRVTVLKEAGRKGLSRREATT |
Ga0307479_113847993 | 3300031962 | Hardwood Forest Soil | VSEIENAKSVEAATAALAARVRSLKQAATHGLSRREVAP |
Ga0307479_119011192 | 3300031962 | Hardwood Forest Soil | EIENAKSVEAASAALAARVRSLKQAATHGLSRREVAP |
Ga0310911_106678983 | 3300032035 | Soil | LADAAVIGSALVSEIEKAPTPDGAARALRERLHSFKEAARHGLSRREALP |
Ga0307470_112826691 | 3300032174 | Hardwood Forest Soil | DAAVVGSALVSEIENAESVDAACTALAERVRLLKQAATHGLSRREVAP |
Ga0307472_1008901581 | 3300032205 | Hardwood Forest Soil | IEKAPSIEAASAALSDRVSVLKEAGRHGLSRREAPI |
Ga0335079_101866654 | 3300032783 | Soil | AEIEKAASVEAAAAALRERAEKLKGAGRHGLSRREATR |
Ga0335078_127278502 | 3300032805 | Soil | VSEIENAATTDAAATALRERTLKLKEAARHGLSRREAIP |
Ga0335080_101040045 | 3300032828 | Soil | VGSALVAEVEKAGSVEAAAAVLRDRVEKLKEAGRHGLSRREATP |
Ga0310914_118194472 | 3300033289 | Soil | VIGSSLVTEIETASNVEAAAAALRDRIRSLKEAGRKGLSRRKATL |
Ga0334817_042124_780_905 | 3300033820 | Soil | ALVSEIEKAASPEAAATALRARVRALKEAARRGLSRREATP |
⦗Top⦘ |