NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041366

Metagenome / Metatranscriptome Family F041366

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041366
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 45 residues
Representative Sequence MELEALQTIDSEVRALGAQIVVLTPELERYTRALHKKLNLTFD
Number of Associated Samples 136
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.12 %
% of genes near scaffold ends (potentially truncated) 95.00 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.750 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.125 % of family members)
Environment Ontology (ENVO) Unclassified
(33.125 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.625 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.70%    β-sheet: 0.00%    Coil/Unstructured: 49.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF13561adh_short_C2 28.12
PF00578AhpC-TSA 9.38
PF00230MIP 2.50
PF02852Pyr_redox_dim 1.25
PF14581SseB_C 1.25
PF00158Sigma54_activat 1.25
PF07883Cupin_2 1.25
PF12833HTH_18 1.25
PF05544Pro_racemase 0.62
PF00498FHA 0.62
PF14376Haem_bd 0.62
PF13478XdhC_C 0.62
PF01850PIN 0.62
PF00378ECH_1 0.62
PF02224Cytidylate_kin 0.62
PF02954HTH_8 0.62
PF01346FKBP_N 0.62
PF03060NMO 0.62
PF10517DM13 0.62
PF00174Oxidored_molyb 0.62
PF07228SpoIIE 0.62
PF00107ADH_zinc_N 0.62
PF08281Sigma70_r4_2 0.62
PF00106adh_short 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 2.50
COG0283Cytidylate kinaseNucleotide transport and metabolism [F] 0.62
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.62
COG0545FKBP-type peptidyl-prolyl cis-trans isomerasePosttranslational modification, protein turnover, chaperones [O] 0.62
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.62
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.62
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.62
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.75 %
UnclassifiedrootN/A6.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002914|JGI25617J43924_10147219All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300005439|Ga0070711_100435595All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300005445|Ga0070708_101295295All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300005467|Ga0070706_101022933All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300005518|Ga0070699_101390614All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005538|Ga0070731_11096067All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005542|Ga0070732_10651147All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005557|Ga0066704_10236655All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300005602|Ga0070762_10563437All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300005764|Ga0066903_106745913All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300006059|Ga0075017_101526338All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006174|Ga0075014_100178480All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300006175|Ga0070712_101764209All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006176|Ga0070765_100049630All Organisms → cellular organisms → Bacteria3415Open in IMG/M
3300006954|Ga0079219_10420215All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300007258|Ga0099793_10360994All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
3300007265|Ga0099794_10411997All Organisms → cellular organisms → Bacteria → Proteobacteria706Open in IMG/M
3300009038|Ga0099829_11593655Not Available539Open in IMG/M
3300009698|Ga0116216_10210761All Organisms → cellular organisms → Bacteria → Proteobacteria1191Open in IMG/M
3300009759|Ga0116101_1135095All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300010046|Ga0126384_11291798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300010048|Ga0126373_12512039All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010336|Ga0134071_10815710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300010343|Ga0074044_10282523All Organisms → cellular organisms → Bacteria → Proteobacteria1093Open in IMG/M
3300010358|Ga0126370_10054017All Organisms → cellular organisms → Bacteria2570Open in IMG/M
3300010359|Ga0126376_11199224All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300010360|Ga0126372_13284995All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300010376|Ga0126381_105038217All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300010401|Ga0134121_10431955Not Available1198Open in IMG/M
3300011120|Ga0150983_12504406All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300011271|Ga0137393_11306293All Organisms → cellular organisms → Bacteria → Proteobacteria614Open in IMG/M
3300012202|Ga0137363_11558671All Organisms → cellular organisms → Bacteria → Proteobacteria552Open in IMG/M
3300012208|Ga0137376_10814345All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300012685|Ga0137397_10048616All Organisms → cellular organisms → Bacteria3042Open in IMG/M
3300012923|Ga0137359_10416499All Organisms → cellular organisms → Bacteria → Proteobacteria1190Open in IMG/M
3300012925|Ga0137419_11524431All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012929|Ga0137404_10604413All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300012971|Ga0126369_12175440All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300014162|Ga0181538_10542274All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300014638|Ga0181536_10320557Not Available714Open in IMG/M
3300016270|Ga0182036_11091920Not Available660Open in IMG/M
3300016270|Ga0182036_11581509Not Available552Open in IMG/M
3300016319|Ga0182033_10973910All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M
3300016341|Ga0182035_11276100All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300016357|Ga0182032_11898122All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300016371|Ga0182034_10026704All Organisms → cellular organisms → Bacteria3543Open in IMG/M
3300016387|Ga0182040_11237261All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M
3300016445|Ga0182038_10280109All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300016445|Ga0182038_11851830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae545Open in IMG/M
3300017933|Ga0187801_10317226Not Available636Open in IMG/M
3300017972|Ga0187781_11179206All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300017988|Ga0181520_10649376All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300018001|Ga0187815_10306433All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300018006|Ga0187804_10374117All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300018007|Ga0187805_10289399All Organisms → cellular organisms → Bacteria → Proteobacteria753Open in IMG/M
3300018042|Ga0187871_10283647All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300018431|Ga0066655_11447493All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300020579|Ga0210407_10343425All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300020580|Ga0210403_10814102All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300020581|Ga0210399_10648849All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300020583|Ga0210401_10329203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1389Open in IMG/M
3300020583|Ga0210401_10371233Not Available1292Open in IMG/M
3300020583|Ga0210401_11608597All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300021088|Ga0210404_10403053All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300021168|Ga0210406_10812722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300021171|Ga0210405_10129133All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300021171|Ga0210405_10501263Not Available951Open in IMG/M
3300021178|Ga0210408_10468234Not Available1003Open in IMG/M
3300021402|Ga0210385_10083549All Organisms → cellular organisms → Bacteria → Proteobacteria2197Open in IMG/M
3300021404|Ga0210389_11125390All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales606Open in IMG/M
3300021405|Ga0210387_10879257All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300021405|Ga0210387_11173715All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300021406|Ga0210386_10055601All Organisms → cellular organisms → Bacteria3153Open in IMG/M
3300021406|Ga0210386_10973588All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300021407|Ga0210383_10633920All Organisms → cellular organisms → Bacteria → Proteobacteria920Open in IMG/M
3300021407|Ga0210383_11563514All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300021420|Ga0210394_10860237All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300021432|Ga0210384_11252058All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300021432|Ga0210384_11362962All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales614Open in IMG/M
3300021433|Ga0210391_10253055All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300021475|Ga0210392_11201348All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300021478|Ga0210402_10012236All Organisms → cellular organisms → Bacteria7383Open in IMG/M
3300021560|Ga0126371_10144181All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300021560|Ga0126371_13028932All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300022507|Ga0222729_1045619All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300022709|Ga0222756_1068189All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300022711|Ga0242674_1052971All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300022712|Ga0242653_1010924All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300025412|Ga0208194_1056548All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300025442|Ga0208034_1055260All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300025459|Ga0208689_1079312All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300025916|Ga0207663_10557433All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300025922|Ga0207646_10037225All Organisms → cellular organisms → Bacteria4387Open in IMG/M
3300026446|Ga0257178_1010698All Organisms → cellular organisms → Bacteria → Proteobacteria1012Open in IMG/M
3300026514|Ga0257168_1116320All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300026809|Ga0207820_107127All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300026866|Ga0207786_114466All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300026879|Ga0207763_1017152All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300026887|Ga0207805_1011981All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300027117|Ga0209732_1009197All Organisms → cellular organisms → Bacteria1644Open in IMG/M
3300027266|Ga0209215_1023316All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300027376|Ga0209004_1018339All Organisms → cellular organisms → Bacteria → Proteobacteria1096Open in IMG/M
3300027684|Ga0209626_1133700All Organisms → cellular organisms → Bacteria → Proteobacteria652Open in IMG/M
3300027767|Ga0209655_10024324All Organisms → cellular organisms → Bacteria → Acidobacteria2032Open in IMG/M
3300027825|Ga0209039_10382871All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027874|Ga0209465_10530973All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300027879|Ga0209169_10185782All Organisms → cellular organisms → Bacteria → Proteobacteria1085Open in IMG/M
3300027898|Ga0209067_10102070Not Available1493Open in IMG/M
3300027911|Ga0209698_10981405All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300028673|Ga0257175_1045621All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300028906|Ga0308309_11430911All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300029636|Ga0222749_10221438All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300029636|Ga0222749_10609063All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300030045|Ga0302282_1270496All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300030760|Ga0265762_1006283All Organisms → cellular organisms → Bacteria → Proteobacteria2127Open in IMG/M
3300031564|Ga0318573_10445855All Organisms → cellular organisms → Bacteria → Proteobacteria696Open in IMG/M
3300031573|Ga0310915_11297363All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300031679|Ga0318561_10815512All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031681|Ga0318572_10609720All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031708|Ga0310686_107409715All Organisms → cellular organisms → Bacteria → Proteobacteria931Open in IMG/M
3300031715|Ga0307476_10490533All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300031754|Ga0307475_10162598All Organisms → cellular organisms → Bacteria → Proteobacteria1777Open in IMG/M
3300031754|Ga0307475_10178156All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300031754|Ga0307475_10896351All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300031754|Ga0307475_11051264All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales638Open in IMG/M
3300031770|Ga0318521_10863494All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300031799|Ga0318565_10619996All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300031805|Ga0318497_10505686All Organisms → cellular organisms → Bacteria → Proteobacteria677Open in IMG/M
3300031823|Ga0307478_10844845All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300031846|Ga0318512_10417935All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium675Open in IMG/M
3300031890|Ga0306925_10110631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella2931Open in IMG/M
3300031910|Ga0306923_12531732All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300031962|Ga0307479_10886184All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300031962|Ga0307479_11371688All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300032001|Ga0306922_12096090All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300032001|Ga0306922_12383130All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300032035|Ga0310911_10854111All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300032066|Ga0318514_10417133All Organisms → cellular organisms → Bacteria → Proteobacteria713Open in IMG/M
3300032076|Ga0306924_12131312All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300032076|Ga0306924_12512200All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300032160|Ga0311301_12516732All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300032180|Ga0307471_100521924All Organisms → cellular organisms → Bacteria → Proteobacteria1338Open in IMG/M
3300032205|Ga0307472_100119466All Organisms → cellular organisms → Bacteria1859Open in IMG/M
3300032261|Ga0306920_100259541All Organisms → cellular organisms → Bacteria → Proteobacteria2591Open in IMG/M
3300032805|Ga0335078_10050140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6173Open in IMG/M
3300032805|Ga0335078_11255594All Organisms → cellular organisms → Bacteria → Proteobacteria850Open in IMG/M
3300032828|Ga0335080_11791290All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300032892|Ga0335081_10354852All Organisms → cellular organisms → Bacteria1909Open in IMG/M
3300032892|Ga0335081_11341543All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium804Open in IMG/M
3300032895|Ga0335074_10123715All Organisms → cellular organisms → Bacteria3343Open in IMG/M
3300032895|Ga0335074_10244860All Organisms → cellular organisms → Bacteria2118Open in IMG/M
3300032895|Ga0335074_10679852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → environmental samples → uncultured Leptolyngbya sp.999Open in IMG/M
3300032895|Ga0335074_10732664All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300032898|Ga0335072_10846020All Organisms → cellular organisms → Bacteria → Proteobacteria866Open in IMG/M
3300032898|Ga0335072_11294496All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300032955|Ga0335076_10931846All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300033158|Ga0335077_10697088All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1046Open in IMG/M
3300033158|Ga0335077_10849853All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300033290|Ga0318519_10973931All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300033405|Ga0326727_10440503All Organisms → cellular organisms → Bacteria1169Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.38%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.50%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.50%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.25%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.25%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.62%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.62%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.62%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026446Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026809Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes)EnvironmentalOpen in IMG/M
3300026866Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300026887Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25617J43924_1014721913300002914Grasslands SoilMMELEALQEIDSEVRALGAQIVALTPELERYARNVHKKLNLSF
Ga0070711_10043559523300005439Corn, Switchgrass And Miscanthus RhizosphereMELEALQRIHSEVRDLGAQIVVLTPELERYTRALHKKLNLTFDIL
Ga0070708_10129529533300005445Corn, Switchgrass And Miscanthus RhizosphereMELEALQEIDSEVRALGARIVALTPELERYTRGLHKKLNLTFDILTDLHLKTAEQ
Ga0070706_10102293323300005467Corn, Switchgrass And Miscanthus RhizosphereMMELEALQAIDSEIKGLGARIVTLTPEIERYTRDVHKKLNLTFDILTDLHL
Ga0070699_10139061413300005518Corn, Switchgrass And Miscanthus RhizosphereMMELEALQEIDTEVRALGGRIVALFPELERYARNVHKKLNLSFDILTDLH
Ga0070731_1109606713300005538Surface SoilMELEALEQIHSDVKALGGEIVVLTPELERYTRAMHKKLNLTFDILTDL
Ga0070732_1065114713300005542Surface SoilMELEALQQIQGEVRALGAQIIVLTPELERYTRALHKKLNL
Ga0066704_1023665513300005557SoilMELEALQGINSEVRALGAQIVVLTPELERYTRALHKKAEPDVRH
Ga0070762_1056343713300005602SoilMELEALQQIDSEARALGARIVALTPELERYRRTVHKNRPSTS*
Ga0066903_10674591333300005764Tropical Forest SoilMMELEALRDIDSEIRALGAWIVALTPELERYTRAVH
Ga0075017_10152633823300006059WatershedsMELEALQQIPSEVRALGGRIVVITPELERYTRALHKKLNLSFDILTDLH
Ga0075014_10017848013300006174WatershedsMALAECNMELEALQEIHSEVRALGAEIVVITPELERYTR
Ga0070712_10176420913300006175Corn, Switchgrass And Miscanthus RhizosphereMELEALQEIDSEVRALGGRIVALTPERERYTRNVHKKLNLTFDILTDLHLKTAEQ
Ga0070765_10004963013300006176SoilMELEALQGIDSEVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKIAE
Ga0079219_1042021513300006954Agricultural SoilMELEALQQIDGEVRALRAQIVVLTPELERYTRALHKRLNLSFDILTGLHLKTAEPF
Ga0099793_1036099413300007258Vadose Zone SoilMMELEAPQEIDSEVRSLGARMLTITPKLERYTRALHRKLQL
Ga0099794_1041199713300007265Vadose Zone SoilMELEALRDINSEVKGLGAQVVVLTPEVERYTRNLHKKLNLPFDILTD
Ga0099829_1159365513300009038Vadose Zone SoilMMELEALQEIDSDVRALGAQIVVLTPELERYTRNVHKKLNLTFHP
Ga0116216_1021076113300009698Peatlands SoilMELEALQQIHADVKALGAEIAVLTPELERYTRALHKKLNLTFDILTD
Ga0116101_113509513300009759PeatlandMMELEALQQIDSEVKEQGGRIVAITPELERYTRAVHKKL
Ga0126384_1129179813300010046Tropical Forest SoilMMELEALQGINSEVKANGARIVALTPEIERYTRSVYKKLNP
Ga0126373_1251203923300010048Tropical Forest SoilMELEALQEIDSEVRALGATIVVITPELERYTRALHKK
Ga0134071_1081571013300010336Grasslands SoilMELEALQGINSEARALGTQIVLTPELERYTRALHKNRKLTFDM
Ga0074044_1028252313300010343Bog Forest SoilMELEALQGINSEVGALEAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTAEEFRL
Ga0126370_1005401753300010358Tropical Forest SoilMMELEALQEINAEITALGARLVAITPEVERYTRNAHR
Ga0126376_1119922423300010359Tropical Forest SoilMMELEALQAIDSEVRRLGARIVTLTPEIQRYTRDVHKKLNLTFDILTDLTNVTNQTD*
Ga0126372_1328499523300010360Tropical Forest SoilMELEALQEIHSQVSGLGAQIVVLTPELERYTRALH
Ga0126381_10503821723300010376Tropical Forest SoilMMELDALQQIHPEVSALGARIVALTPELERYTRTVHKKLNL
Ga0134121_1043195533300010401Terrestrial SoilMELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLKLTFDM
Ga0150983_1250440623300011120Forest SoilMELEALQEVNSEVTNMGARIVVLTPELERYTRSLHKKLNLTFDILTDLH
Ga0137393_1130629313300011271Vadose Zone SoilMMELEALQEIDSEVRALGAQIVALSPELERYTRNVHKK
Ga0137363_1155867133300012202Vadose Zone SoilMELEALQEIDSEVRALGARIVVLTPELERYTRGLHKKLNLTFDILT
Ga0137376_1081434533300012208Vadose Zone SoilMELEALQGINSEVRALGAQIVVLTPELERYTRALHKKLNLSFDILTDLHLKTA
Ga0137397_1004861653300012685Vadose Zone SoilMMELEAPQEIDSEVRSLGARMLTITPKLERYTRALH
Ga0137359_1041649913300012923Vadose Zone SoilMMELEALQEIDSEVRSLGVRMLIITPELERYTRGVHRKLQL
Ga0137419_1152443133300012925Vadose Zone SoilMELEALQGINSEVQALGAKIVVLTPELERYTRALHKKLNLTFDILTDL
Ga0137404_1060441333300012929Vadose Zone SoilMELEALQGINCEVRALGAQIVVLTPELERYTRALHKKLNL
Ga0126369_1217544013300012971Tropical Forest SoilMELEALQEIDSEVRALGARIVALTAELERYTRSLHKKLNLTFDILADLH
Ga0181538_1054227423300014162BogMELEALQQVESEILAQGARLVVITPELERYTRALHRKLNLTFDILT
Ga0181536_1032055713300014638BogMELEALQQVESEIRGLGARLVVITPEIERYTRALHRKLNLTFDILTDL
Ga0182036_1109192013300016270SoilMMELEALQEINAEIRALGARLVAITPELERYTRNVHRKLNLAFDVLTDLH
Ga0182036_1158150913300016270SoilALKEIDSEVNQLGARIVVLTPELERYTRALHNKLNPHGGD
Ga0182033_1097391013300016319SoilMMELEALQEINPEITALGARIVAITPELERYTRNVHRRLNLTFD
Ga0182035_1127610013300016341SoilMMELEALQEIESEVRQLGGRIVALTPQLEKYTRNVHKKLNL
Ga0182032_1189812223300016357SoilMMELEALQEINPEITALGARIVAITPELERYTRNVH
Ga0182034_1002670473300016371SoilMMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTHDILTD
Ga0182040_1123726113300016387SoilMMELEALQEIDSEVRQLGGRIVALTPQLERYTRNVHRKLNLTFDI
Ga0182038_1028010933300016445SoilMELEALQGIYSEVRALGAGLVVITPELERCLSLCS
Ga0182038_1185183023300016445SoilMELEALKEIDSEVNQLGARIVVLTLELDRYTRALHN
Ga0187801_1031722613300017933Freshwater SedimentMELEALKEIDSEVQELRARIVVLTPELERYTRALHNKLNLPFDILTDLHLKT
Ga0187781_1117920623300017972Tropical PeatlandMELEALKEIHSEVKALGAQIVVLTPELERYTRNLHRK
Ga0181520_1064937623300017988BogMELEALQGINSEVRALGAQIVVLTPELERYTGALHKKLNLTFDMLTDLHLKTAQ
Ga0187815_1030643333300018001Freshwater SedimentMELEALQQIDSEVRALGGQIVVITPELERYTRALHKKLNLTFDILT
Ga0187804_1037411733300018006Freshwater SedimentMELEALQPIHSEVRALGARIVVITPELERYTRALH
Ga0187805_1028939923300018007Freshwater SedimentMELEALQQIHSEVKALGAQIVVITPELERYTRALHRKLNLTYDILT
Ga0187871_1028364713300018042PeatlandMELEALQGINSEVRALGAQIVVLTPELERYTHALHKKLNLTFDILT
Ga0066655_1144749313300018431Grasslands SoilMMELEALQAVNSEVNALGARIVALTPQLERYTRNVYKKLGLTFDDKHSGYC
Ga0210407_1034342513300020579SoilMELEALQEVNSEVTNMGAHIVVLTPELERYTRGLHKKLNLTFDILTDLHLKTAERFG
Ga0210403_1081410233300020580SoilMELEALQQIYGEVRALGAQIVVLTPELERYTRALHKKLNLSF
Ga0210399_1064884913300020581SoilMELEALQGIYSEVKDLGAQIVVLTPELERHTRALHKKLNLT
Ga0210401_1032920313300020583SoilCNMELEALQQIDSEVRALGARIVALTPELERYRRTVHKNRPSTS
Ga0210401_1037123313300020583SoilMELEALQEIDSEVRAALGAQIVALTPELERYTRGVHKKDCG
Ga0210401_1160859733300020583SoilMELEALQEIDSVVRMLGVRIVALTPELERYSHSLHKKL
Ga0210404_1040305333300021088SoilMELEALQGINSEVRALGAQIVVLTPELERYTRALHKKLNLTFDMLTDLHLKT
Ga0210406_1081272213300021168SoilYCNTELEALQQIDSEARALGAHIVALTPELERYTRTVHKN
Ga0210405_1012913313300021171SoilMELEALQGIDSEVRALGAQIVVLTPELERYTRALHKKL
Ga0210405_1050126323300021171SoilVTLLHEMELEALQEIDSEVRAALGAQIVALTPELERYTRGVHKKDCG
Ga0210408_1046823433300021178SoilMMELEALQEVDPEIRALGARIVALTTELERYTRSVHKKLNLT
Ga0210385_1008354943300021402SoilMELEALQEVNSEVTNMGANIVVLTPELERYTRSLHKKLNLTFDILTDLHLKTTAQSALV
Ga0210389_1112539033300021404SoilMELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLKLTFDMLTDLHLKTAEQ
Ga0210387_1087925733300021405SoilMELEALQGIYSEVKDLGAQIVVLTPELERYTRALHKKLNL
Ga0210387_1117371523300021405SoilMELEALQEIHSEVRALGAQIVVMTPELERYTRALHKKLNLTFDIL
Ga0210386_1005560143300021406SoilMELEALQQVHSEVKALGAQIVVITPELERYTRALHRKLN
Ga0210386_1097358833300021406SoilMELEALQQIYGEVRALGAQIVVLTPELERYTRALHKKLNLS
Ga0210383_1063392013300021407SoilMELEALQEVNSEVTNMGAHIVVLTPELERYTRGLHKRLNLTFDILT
Ga0210383_1156351413300021407SoilMELEALQTIDSEVRALGAQIVVLTPELERYTRALHKKLNLTFD
Ga0210394_1086023723300021420SoilMELEALQEIHSEVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTA
Ga0210384_1125205813300021432SoilMELEALKRIHSEVKDLGEQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTAEQFRL
Ga0210384_1136296233300021432SoilMELEALQGIHSEVRSLGAQIVVLTPELERYTRALHKKLNLSFDILTDLHL
Ga0210391_1025305513300021433SoilMELEALQEIHSEVRALGAQIVVLTPELERYTRALHKKLNLTFEILTDLH
Ga0210392_1120134823300021475SoilMELEALQGIHSDVRALGAQIVVITPELERYTRAMHKKLNLTFDILTDL
Ga0210402_1001223633300021478SoilMMELEALQEIGSEVRSLGADVDLLIITPELERYTRGVHRKLQLTFDA
Ga0126371_1014418113300021560Tropical Forest SoilMMELEALQTVDSEVRALGARTVALTPELERYTRNMHRKLSL
Ga0126371_1302893223300021560Tropical Forest SoilMELEALQAIDSEVETLGARIVALTPELDRYTRVVHKKQNLTFDILTDLH
Ga0222729_104561923300022507SoilMELEALQGIHSDVRALGAQIVVITPELERYTRAMHKKLNLTFD
Ga0222756_106818913300022709SoilMELEALQGINSEVRALGAQIVVLTPELERYTRALH
Ga0242674_105297113300022711SoilMELEALQGVNSEVKTLGAQIVVLTPELERYTRGLHKKLKLTFDILTDL
Ga0242653_101092433300022712SoilMELEALQQIHGEVRALGAQIVVLTPELERYTRALHKKLNLSFDILTDLHLKTAE
Ga0208194_105654823300025412PeatlandMELEALQQIHPEVRAAGAELVVITPELERYTRAMHKKLNLTFDILT
Ga0208034_105526033300025442PeatlandMELEALQQIHSEVRALGAQIVVVTPELERYTRALHKKLNLSFDILTDL
Ga0208689_107931213300025459PeatlandMELEALQQIHSEVGALGARIAVITPELERYTRALHKKLNLSFDI
Ga0207663_1055743333300025916Corn, Switchgrass And Miscanthus RhizosphereMELEALQRIHSEVRDLGAQIVVLTPELERYTRALH
Ga0207646_1003722513300025922Corn, Switchgrass And Miscanthus RhizosphereMLELEALQEMDFEVRALGGRIVALSPELERYTRNVHKKLNLSFDIL
Ga0257178_101069833300026446SoilMELEALQGINCEVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTAEQF
Ga0257168_111632033300026514SoilMMELQALQEIDSEVRALGAQIVVLTPELERYRRNVH
Ga0207820_10712713300026809Tropical Forest SoilMELEALADVNSEVKALGAQIVVLTPELERYPRNLHNKLNLPFDIL
Ga0207786_11446613300026866Tropical Forest SoilMELEALRDINPEVTALGAQCVVLTPELERYTRNLHN
Ga0207763_101715223300026879Tropical Forest SoilMELEALRDINPEVTALGAQCVVLTPELERYTRNLHNKLNLPFDILTDLHLKT
Ga0207805_101198113300026887Tropical Forest SoilMELEALRDINPEVTALGAQCVVLTPELERYTRNLHNKLNLPFDILTDLHLK
Ga0209732_100919733300027117Forest SoilMELEALQGINSEVRALGAQIVVLTPELERYTRALHKKLNLTFDMLTD
Ga0209215_102331613300027266Forest SoilMELEALQEIQSEVSALGAQIVVLTPELERYTRNLHKKLNLTFDILTDF
Ga0209004_101833933300027376Forest SoilMELEALQQIYGEVKALGAQIVVLTPELERYTRALHKKLNLSFD
Ga0209626_113370033300027684Forest SoilMELEALQEIHSEVRALGAQMVVLTPELERYTRALHKKLNLT
Ga0209655_1002432453300027767Bog Forest SoilMELEALKEIGPEVRELGARIVVLTPELERYTRALHKKLNLP
Ga0209039_1038287133300027825Bog Forest SoilMELEALQEIHSEVRALGAEIIVITPELERYTRALHK
Ga0209465_1053097313300027874Tropical Forest SoilMMELEALQTADSEVRALGARTVALTPELERYTRNMHRKLSLTFDILTDLHLKAA
Ga0209169_1018578243300027879SoilMELEALQEVNSEVTNMGAHIVVLTPELERYTRGLHKKLNLTFDILTDLHL
Ga0209067_1010207033300027898WatershedsMELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLK
Ga0209698_1098140513300027911WatershedsMELEALQQIHSEVRALGARIVVITPELERYTRALHKKLNLSFD
Ga0257175_104562113300028673SoilMELEALQGINSEFRALGAQIVVLTPELERYTRALHKKLNLTF
Ga0308309_1143091133300028906SoilMELEALQGIYSEVKDLGAQIVVLTPELERYTRALHKKL
Ga0222749_1022143833300029636SoilMELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLKLTFDMLTDLHLKTAEQFR
Ga0222749_1060906323300029636SoilMELEALQQVHSEVRALGAEIVVITPELERYTRALHKKLNLT
Ga0302282_127049613300030045FenMELEALKEIDSEVQALGARIAVLTPELERYTRALRKKLNLPFDILTDL
Ga0265762_100628313300030760SoilMELEALQEVDGEVRKLGARILVITPELERYTRALHKKLN
Ga0318573_1044585513300031564SoilMMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTHDILTDLHLTTAEEFRLV
Ga0310915_1129736313300031573SoilMMELEALQGFNCEVRAVGARIVALTPEVQRYTRGVYKKLNLTFDIL
Ga0318561_1081551213300031679SoilMMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLHLKTAEEFRL
Ga0318572_1060972013300031681SoilMELEALQEIYAEVRALGARLVVITPELERYTRALRSKLNLSLDLLTDLHLK
Ga0310686_10740971513300031708SoilMELEALQEVHSQIRALGVQVVAITPELERYTRLVHRKSNLAFDI
Ga0307476_1049053333300031715Hardwood Forest SoilMELEALEQIHSDVKALGGEIVVLTPELERYTRAMHKKLNLT
Ga0307475_1016259863300031754Hardwood Forest SoilMELEALQNINSEVKALGAQIVVLTPELERYTRNLHKKLNLTFDI
Ga0307475_1017815613300031754Hardwood Forest SoilVIHSEVRSLGAQIVVLTPELERYTRALHKKLNLSFDILTDL
Ga0307475_1089635113300031754Hardwood Forest SoilMELEALQQIQGEVGALGAQIIVLTPELERYTRALHKKLNLSFDILTDLHLKTAEE
Ga0307475_1105126433300031754Hardwood Forest SoilMMELEALQEIDSEVRALGGRIVALTPERERYTRNVHKKL
Ga0318521_1086349413300031770SoilMMELEALQQIDSEVRGLGAQIVALTPELERYSRNVHKKLNLTLDVLTDLHLRTAE
Ga0318565_1061999613300031799SoilMMELEALQQIDSEVRGLGAQIVALTPELERYTRNVHKKLNLTFDVLTDLH
Ga0318497_1050568633300031805SoilMELEALQQIYPEVKALGAQIVVLTPELEHYTRALHKKLNLTFD
Ga0307478_1084484533300031823Hardwood Forest SoilMELEALQGIHSDVRALGAQIVVITPELERYTRAMHKKLNLTF
Ga0318512_1041793533300031846SoilMMELEALQTVDSEVRALGARTVALTPELERYTRSLHRKLT
Ga0306925_1011063113300031890SoilMMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLHLKTAEE
Ga0306923_1253173233300031910SoilMELEALKEIDSEVNQLGARIVVLTPELERYTRALHNKLN
Ga0307479_1088618413300031962Hardwood Forest SoilMELEALQQIHGEVRALGAQIVVLTPELERYTRALHKK
Ga0307479_1137168833300031962Hardwood Forest SoilMELEALQQIHGEVRALGAQIVVLTPELERYTRALHKKLNLSFDILTDLHLK
Ga0306922_1209609033300032001SoilMELEALREIDSGVRELGARIVVLTPELERYTRALHKKLNLPFDILTDLH
Ga0306922_1238313023300032001SoilMMELEALQEIDSEVRQLGGRIVALTPQLERYTRNVHKKLNLTYDI
Ga0310911_1085411123300032035SoilMMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLHLTTAEEFRL
Ga0318514_1041713313300032066SoilMMELEALQQIDSEVRGLGAQIVTLTPELERYTRNVHKKLNLTFDVLTDLHL
Ga0306924_1213131233300032076SoilMELEALSEIDSGVRALGARIVVLTPELERYTRALHKKLNLA
Ga0306924_1251220013300032076SoilMMELEALQQIDSEVRGLGAQIVALTPELERYSRNVHKKLNL
Ga0311301_1251673213300032160Peatlands SoilVHAEVKALGAQIVVITPELERYTRALHRKLNLTYDILTDLHLKT
Ga0307471_10052192413300032180Hardwood Forest SoilMMELEALQEIDSEVRALGGRIVALTPERERYTRNVYKKLSLTFDILTDLHLKTA
Ga0307472_10011946643300032205Hardwood Forest SoilMMELEALQEIDSEVRALGGRIVALTPERERYTRNVHK
Ga0306920_10025954123300032261SoilMMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLI
Ga0335078_10050140103300032805SoilMELEALQQIHADVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKIA
Ga0335078_1125559433300032805SoilMELEALKEIDSEVRALGARIVVLTPELERYTRALYKKLNLPYDI
Ga0335080_1179129013300032828SoilMELEALQQVDSQIRSLGARIVAITPELERYTRALH
Ga0335081_1035485243300032892SoilMELEALQQIHSEVRALGARIVVITPELERYTRALHKKLNLSFDILTDLH
Ga0335081_1134154313300032892SoilMELEALQETYSEISAQGAELVVITPELERYTRALHRKLNLSFDILTAL
Ga0335074_1012371543300032895SoilMELEALKEIDSEVRALGARIVVLTPELERYTRALYKKLNLPYDILTDLHLKTAEEY
Ga0335074_1024486043300032895SoilMELEALQEIVPDVTALGGRIVALTPELERYTRMLHKKLNLTFDILTRFSHR
Ga0335074_1067985213300032895SoilMELEALQQIHSEVRALGAQIVVLTPELERYTRALHKKLNLTYD
Ga0335074_1073266433300032895SoilMELEALKEIDSEVRALGAQIVVLTPELERYTRALHKKLNLPFD
Ga0335072_1084602013300032898SoilMELEALQQVESEIRGLGARLVVITPEIERYTRAMHRKLN
Ga0335072_1129449633300032898SoilMDLEALQGINSEVRALGAQTVVLTPELERYTRALHKKLNLTFDMQT
Ga0335076_1093184613300032955SoilMHAEVRALGAEIVVITPEMERYTRALHKKLNLTFDILTDLHL
Ga0335077_1069708833300033158SoilMELEALQETYSEISAQGAELVVITPELERYTRALHRK
Ga0335077_1084985313300033158SoilMELEALKEIDSEVRALGARIVVLTPEMERYTRALHK
Ga0318519_1097393113300033290SoilMMELEALQGFNCEVRAVGARIVALTPEVQRYTRGVYKKLNLTFDILT
Ga0326727_1044050323300033405Peat SoilMELEALQEIYSEVRALGAELVVITPELERYTRALHKKLNLTFDILTD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.