| Basic Information | |
|---|---|
| Family ID | F041366 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MELEALQTIDSEVRALGAQIVVLTPELERYTRALHKKLNLTFD |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.12 % |
| % of genes near scaffold ends (potentially truncated) | 95.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.750 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.125 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.125 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.625 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 28.12 |
| PF00578 | AhpC-TSA | 9.38 |
| PF00230 | MIP | 2.50 |
| PF02852 | Pyr_redox_dim | 1.25 |
| PF14581 | SseB_C | 1.25 |
| PF00158 | Sigma54_activat | 1.25 |
| PF07883 | Cupin_2 | 1.25 |
| PF12833 | HTH_18 | 1.25 |
| PF05544 | Pro_racemase | 0.62 |
| PF00498 | FHA | 0.62 |
| PF14376 | Haem_bd | 0.62 |
| PF13478 | XdhC_C | 0.62 |
| PF01850 | PIN | 0.62 |
| PF00378 | ECH_1 | 0.62 |
| PF02224 | Cytidylate_kin | 0.62 |
| PF02954 | HTH_8 | 0.62 |
| PF01346 | FKBP_N | 0.62 |
| PF03060 | NMO | 0.62 |
| PF10517 | DM13 | 0.62 |
| PF00174 | Oxidored_molyb | 0.62 |
| PF07228 | SpoIIE | 0.62 |
| PF00107 | ADH_zinc_N | 0.62 |
| PF08281 | Sigma70_r4_2 | 0.62 |
| PF00106 | adh_short | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 2.50 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.62 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.62 |
| COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.62 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.62 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.62 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.75 % |
| Unclassified | root | N/A | 6.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10147219 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005439|Ga0070711_100435595 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005445|Ga0070708_101295295 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005467|Ga0070706_101022933 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005518|Ga0070699_101390614 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005538|Ga0070731_11096067 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005542|Ga0070732_10651147 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005557|Ga0066704_10236655 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300005602|Ga0070762_10563437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300005764|Ga0066903_106745913 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006059|Ga0075017_101526338 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006174|Ga0075014_100178480 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300006175|Ga0070712_101764209 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006176|Ga0070765_100049630 | All Organisms → cellular organisms → Bacteria | 3415 | Open in IMG/M |
| 3300006954|Ga0079219_10420215 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300007258|Ga0099793_10360994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300007265|Ga0099794_10411997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300009038|Ga0099829_11593655 | Not Available | 539 | Open in IMG/M |
| 3300009698|Ga0116216_10210761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
| 3300009759|Ga0116101_1135095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300010046|Ga0126384_11291798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300010048|Ga0126373_12512039 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010336|Ga0134071_10815710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300010343|Ga0074044_10282523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
| 3300010358|Ga0126370_10054017 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300010359|Ga0126376_11199224 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010360|Ga0126372_13284995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300010376|Ga0126381_105038217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300010401|Ga0134121_10431955 | Not Available | 1198 | Open in IMG/M |
| 3300011120|Ga0150983_12504406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300011271|Ga0137393_11306293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300012202|Ga0137363_11558671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300012208|Ga0137376_10814345 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012685|Ga0137397_10048616 | All Organisms → cellular organisms → Bacteria | 3042 | Open in IMG/M |
| 3300012923|Ga0137359_10416499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1190 | Open in IMG/M |
| 3300012925|Ga0137419_11524431 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012929|Ga0137404_10604413 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012971|Ga0126369_12175440 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300014162|Ga0181538_10542274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300014638|Ga0181536_10320557 | Not Available | 714 | Open in IMG/M |
| 3300016270|Ga0182036_11091920 | Not Available | 660 | Open in IMG/M |
| 3300016270|Ga0182036_11581509 | Not Available | 552 | Open in IMG/M |
| 3300016319|Ga0182033_10973910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300016341|Ga0182035_11276100 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300016357|Ga0182032_11898122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300016371|Ga0182034_10026704 | All Organisms → cellular organisms → Bacteria | 3543 | Open in IMG/M |
| 3300016387|Ga0182040_11237261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300016445|Ga0182038_10280109 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300016445|Ga0182038_11851830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 545 | Open in IMG/M |
| 3300017933|Ga0187801_10317226 | Not Available | 636 | Open in IMG/M |
| 3300017972|Ga0187781_11179206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300017988|Ga0181520_10649376 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300018001|Ga0187815_10306433 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018006|Ga0187804_10374117 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300018007|Ga0187805_10289399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300018042|Ga0187871_10283647 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300018431|Ga0066655_11447493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300020579|Ga0210407_10343425 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300020580|Ga0210403_10814102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300020581|Ga0210399_10648849 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300020583|Ga0210401_10329203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1389 | Open in IMG/M |
| 3300020583|Ga0210401_10371233 | Not Available | 1292 | Open in IMG/M |
| 3300020583|Ga0210401_11608597 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021088|Ga0210404_10403053 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300021168|Ga0210406_10812722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300021171|Ga0210405_10129133 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300021171|Ga0210405_10501263 | Not Available | 951 | Open in IMG/M |
| 3300021178|Ga0210408_10468234 | Not Available | 1003 | Open in IMG/M |
| 3300021402|Ga0210385_10083549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2197 | Open in IMG/M |
| 3300021404|Ga0210389_11125390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 606 | Open in IMG/M |
| 3300021405|Ga0210387_10879257 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300021405|Ga0210387_11173715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300021406|Ga0210386_10055601 | All Organisms → cellular organisms → Bacteria | 3153 | Open in IMG/M |
| 3300021406|Ga0210386_10973588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300021407|Ga0210383_10633920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300021407|Ga0210383_11563514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300021420|Ga0210394_10860237 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300021432|Ga0210384_11252058 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021432|Ga0210384_11362962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 614 | Open in IMG/M |
| 3300021433|Ga0210391_10253055 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300021475|Ga0210392_11201348 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300021478|Ga0210402_10012236 | All Organisms → cellular organisms → Bacteria | 7383 | Open in IMG/M |
| 3300021560|Ga0126371_10144181 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300021560|Ga0126371_13028932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300022507|Ga0222729_1045619 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300022709|Ga0222756_1068189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300022711|Ga0242674_1052971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300022712|Ga0242653_1010924 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300025412|Ga0208194_1056548 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300025442|Ga0208034_1055260 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300025459|Ga0208689_1079312 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300025916|Ga0207663_10557433 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300025922|Ga0207646_10037225 | All Organisms → cellular organisms → Bacteria | 4387 | Open in IMG/M |
| 3300026446|Ga0257178_1010698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
| 3300026514|Ga0257168_1116320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300026809|Ga0207820_107127 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300026866|Ga0207786_114466 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300026879|Ga0207763_1017152 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300026887|Ga0207805_1011981 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300027117|Ga0209732_1009197 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300027266|Ga0209215_1023316 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300027376|Ga0209004_1018339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300027684|Ga0209626_1133700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300027767|Ga0209655_10024324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2032 | Open in IMG/M |
| 3300027825|Ga0209039_10382871 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027874|Ga0209465_10530973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300027879|Ga0209169_10185782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300027898|Ga0209067_10102070 | Not Available | 1493 | Open in IMG/M |
| 3300027911|Ga0209698_10981405 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300028673|Ga0257175_1045621 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300028906|Ga0308309_11430911 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300029636|Ga0222749_10221438 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300029636|Ga0222749_10609063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300030045|Ga0302282_1270496 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300030760|Ga0265762_1006283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2127 | Open in IMG/M |
| 3300031564|Ga0318573_10445855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300031573|Ga0310915_11297363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300031679|Ga0318561_10815512 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031681|Ga0318572_10609720 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031708|Ga0310686_107409715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300031715|Ga0307476_10490533 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031754|Ga0307475_10162598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1777 | Open in IMG/M |
| 3300031754|Ga0307475_10178156 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300031754|Ga0307475_10896351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300031754|Ga0307475_11051264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 638 | Open in IMG/M |
| 3300031770|Ga0318521_10863494 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031799|Ga0318565_10619996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300031805|Ga0318497_10505686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300031823|Ga0307478_10844845 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031846|Ga0318512_10417935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 675 | Open in IMG/M |
| 3300031890|Ga0306925_10110631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 2931 | Open in IMG/M |
| 3300031910|Ga0306923_12531732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300031962|Ga0307479_10886184 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031962|Ga0307479_11371688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300032001|Ga0306922_12096090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300032001|Ga0306922_12383130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300032035|Ga0310911_10854111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300032066|Ga0318514_10417133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300032076|Ga0306924_12131312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300032076|Ga0306924_12512200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300032160|Ga0311301_12516732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300032180|Ga0307471_100521924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1338 | Open in IMG/M |
| 3300032205|Ga0307472_100119466 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300032261|Ga0306920_100259541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2591 | Open in IMG/M |
| 3300032805|Ga0335078_10050140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6173 | Open in IMG/M |
| 3300032805|Ga0335078_11255594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300032828|Ga0335080_11791290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300032892|Ga0335081_10354852 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300032892|Ga0335081_11341543 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 804 | Open in IMG/M |
| 3300032895|Ga0335074_10123715 | All Organisms → cellular organisms → Bacteria | 3343 | Open in IMG/M |
| 3300032895|Ga0335074_10244860 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300032895|Ga0335074_10679852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → environmental samples → uncultured Leptolyngbya sp. | 999 | Open in IMG/M |
| 3300032895|Ga0335074_10732664 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300032898|Ga0335072_10846020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300032898|Ga0335072_11294496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300032955|Ga0335076_10931846 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300033158|Ga0335077_10697088 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1046 | Open in IMG/M |
| 3300033158|Ga0335077_10849853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300033290|Ga0318519_10973931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300033405|Ga0326727_10440503 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.25% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026866 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_101472191 | 3300002914 | Grasslands Soil | MMELEALQEIDSEVRALGAQIVALTPELERYARNVHKKLNLSF |
| Ga0070711_1004355952 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MELEALQRIHSEVRDLGAQIVVLTPELERYTRALHKKLNLTFDIL |
| Ga0070708_1012952953 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MELEALQEIDSEVRALGARIVALTPELERYTRGLHKKLNLTFDILTDLHLKTAEQ |
| Ga0070706_1010229332 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMELEALQAIDSEIKGLGARIVTLTPEIERYTRDVHKKLNLTFDILTDLHL |
| Ga0070699_1013906141 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MMELEALQEIDTEVRALGGRIVALFPELERYARNVHKKLNLSFDILTDLH |
| Ga0070731_110960671 | 3300005538 | Surface Soil | MELEALEQIHSDVKALGGEIVVLTPELERYTRAMHKKLNLTFDILTDL |
| Ga0070732_106511471 | 3300005542 | Surface Soil | MELEALQQIQGEVRALGAQIIVLTPELERYTRALHKKLNL |
| Ga0066704_102366551 | 3300005557 | Soil | MELEALQGINSEVRALGAQIVVLTPELERYTRALHKKAEPDVRH |
| Ga0070762_105634371 | 3300005602 | Soil | MELEALQQIDSEARALGARIVALTPELERYRRTVHKNRPSTS* |
| Ga0066903_1067459133 | 3300005764 | Tropical Forest Soil | MMELEALRDIDSEIRALGAWIVALTPELERYTRAVH |
| Ga0075017_1015263382 | 3300006059 | Watersheds | MELEALQQIPSEVRALGGRIVVITPELERYTRALHKKLNLSFDILTDLH |
| Ga0075014_1001784801 | 3300006174 | Watersheds | MALAECNMELEALQEIHSEVRALGAEIVVITPELERYTR |
| Ga0070712_1017642091 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MELEALQEIDSEVRALGGRIVALTPERERYTRNVHKKLNLTFDILTDLHLKTAEQ |
| Ga0070765_1000496301 | 3300006176 | Soil | MELEALQGIDSEVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKIAE |
| Ga0079219_104202151 | 3300006954 | Agricultural Soil | MELEALQQIDGEVRALRAQIVVLTPELERYTRALHKRLNLSFDILTGLHLKTAEPF |
| Ga0099793_103609941 | 3300007258 | Vadose Zone Soil | MMELEAPQEIDSEVRSLGARMLTITPKLERYTRALHRKLQL |
| Ga0099794_104119971 | 3300007265 | Vadose Zone Soil | MELEALRDINSEVKGLGAQVVVLTPEVERYTRNLHKKLNLPFDILTD |
| Ga0099829_115936551 | 3300009038 | Vadose Zone Soil | MMELEALQEIDSDVRALGAQIVVLTPELERYTRNVHKKLNLTFHP |
| Ga0116216_102107611 | 3300009698 | Peatlands Soil | MELEALQQIHADVKALGAEIAVLTPELERYTRALHKKLNLTFDILTD |
| Ga0116101_11350951 | 3300009759 | Peatland | MMELEALQQIDSEVKEQGGRIVAITPELERYTRAVHKKL |
| Ga0126384_112917981 | 3300010046 | Tropical Forest Soil | MMELEALQGINSEVKANGARIVALTPEIERYTRSVYKKLNP |
| Ga0126373_125120392 | 3300010048 | Tropical Forest Soil | MELEALQEIDSEVRALGATIVVITPELERYTRALHKK |
| Ga0134071_108157101 | 3300010336 | Grasslands Soil | MELEALQGINSEARALGTQIVLTPELERYTRALHKNRKLTFDM |
| Ga0074044_102825231 | 3300010343 | Bog Forest Soil | MELEALQGINSEVGALEAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTAEEFRL |
| Ga0126370_100540175 | 3300010358 | Tropical Forest Soil | MMELEALQEINAEITALGARLVAITPEVERYTRNAHR |
| Ga0126376_111992242 | 3300010359 | Tropical Forest Soil | MMELEALQAIDSEVRRLGARIVTLTPEIQRYTRDVHKKLNLTFDILTDLTNVTNQTD* |
| Ga0126372_132849952 | 3300010360 | Tropical Forest Soil | MELEALQEIHSQVSGLGAQIVVLTPELERYTRALH |
| Ga0126381_1050382172 | 3300010376 | Tropical Forest Soil | MMELDALQQIHPEVSALGARIVALTPELERYTRTVHKKLNL |
| Ga0134121_104319553 | 3300010401 | Terrestrial Soil | MELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLKLTFDM |
| Ga0150983_125044062 | 3300011120 | Forest Soil | MELEALQEVNSEVTNMGARIVVLTPELERYTRSLHKKLNLTFDILTDLH |
| Ga0137393_113062931 | 3300011271 | Vadose Zone Soil | MMELEALQEIDSEVRALGAQIVALSPELERYTRNVHKK |
| Ga0137363_115586713 | 3300012202 | Vadose Zone Soil | MELEALQEIDSEVRALGARIVVLTPELERYTRGLHKKLNLTFDILT |
| Ga0137376_108143453 | 3300012208 | Vadose Zone Soil | MELEALQGINSEVRALGAQIVVLTPELERYTRALHKKLNLSFDILTDLHLKTA |
| Ga0137397_100486165 | 3300012685 | Vadose Zone Soil | MMELEAPQEIDSEVRSLGARMLTITPKLERYTRALH |
| Ga0137359_104164991 | 3300012923 | Vadose Zone Soil | MMELEALQEIDSEVRSLGVRMLIITPELERYTRGVHRKLQL |
| Ga0137419_115244313 | 3300012925 | Vadose Zone Soil | MELEALQGINSEVQALGAKIVVLTPELERYTRALHKKLNLTFDILTDL |
| Ga0137404_106044133 | 3300012929 | Vadose Zone Soil | MELEALQGINCEVRALGAQIVVLTPELERYTRALHKKLNL |
| Ga0126369_121754401 | 3300012971 | Tropical Forest Soil | MELEALQEIDSEVRALGARIVALTAELERYTRSLHKKLNLTFDILADLH |
| Ga0181538_105422742 | 3300014162 | Bog | MELEALQQVESEILAQGARLVVITPELERYTRALHRKLNLTFDILT |
| Ga0181536_103205571 | 3300014638 | Bog | MELEALQQVESEIRGLGARLVVITPEIERYTRALHRKLNLTFDILTDL |
| Ga0182036_110919201 | 3300016270 | Soil | MMELEALQEINAEIRALGARLVAITPELERYTRNVHRKLNLAFDVLTDLH |
| Ga0182036_115815091 | 3300016270 | Soil | ALKEIDSEVNQLGARIVVLTPELERYTRALHNKLNPHGGD |
| Ga0182033_109739101 | 3300016319 | Soil | MMELEALQEINPEITALGARIVAITPELERYTRNVHRRLNLTFD |
| Ga0182035_112761001 | 3300016341 | Soil | MMELEALQEIESEVRQLGGRIVALTPQLEKYTRNVHKKLNL |
| Ga0182032_118981222 | 3300016357 | Soil | MMELEALQEINPEITALGARIVAITPELERYTRNVH |
| Ga0182034_100267047 | 3300016371 | Soil | MMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTHDILTD |
| Ga0182040_112372611 | 3300016387 | Soil | MMELEALQEIDSEVRQLGGRIVALTPQLERYTRNVHRKLNLTFDI |
| Ga0182038_102801093 | 3300016445 | Soil | MELEALQGIYSEVRALGAGLVVITPELERCLSLCS |
| Ga0182038_118518302 | 3300016445 | Soil | MELEALKEIDSEVNQLGARIVVLTLELDRYTRALHN |
| Ga0187801_103172261 | 3300017933 | Freshwater Sediment | MELEALKEIDSEVQELRARIVVLTPELERYTRALHNKLNLPFDILTDLHLKT |
| Ga0187781_111792062 | 3300017972 | Tropical Peatland | MELEALKEIHSEVKALGAQIVVLTPELERYTRNLHRK |
| Ga0181520_106493762 | 3300017988 | Bog | MELEALQGINSEVRALGAQIVVLTPELERYTGALHKKLNLTFDMLTDLHLKTAQ |
| Ga0187815_103064333 | 3300018001 | Freshwater Sediment | MELEALQQIDSEVRALGGQIVVITPELERYTRALHKKLNLTFDILT |
| Ga0187804_103741173 | 3300018006 | Freshwater Sediment | MELEALQPIHSEVRALGARIVVITPELERYTRALH |
| Ga0187805_102893992 | 3300018007 | Freshwater Sediment | MELEALQQIHSEVKALGAQIVVITPELERYTRALHRKLNLTYDILT |
| Ga0187871_102836471 | 3300018042 | Peatland | MELEALQGINSEVRALGAQIVVLTPELERYTHALHKKLNLTFDILT |
| Ga0066655_114474931 | 3300018431 | Grasslands Soil | MMELEALQAVNSEVNALGARIVALTPQLERYTRNVYKKLGLTFDDKHSGYC |
| Ga0210407_103434251 | 3300020579 | Soil | MELEALQEVNSEVTNMGAHIVVLTPELERYTRGLHKKLNLTFDILTDLHLKTAERFG |
| Ga0210403_108141023 | 3300020580 | Soil | MELEALQQIYGEVRALGAQIVVLTPELERYTRALHKKLNLSF |
| Ga0210399_106488491 | 3300020581 | Soil | MELEALQGIYSEVKDLGAQIVVLTPELERHTRALHKKLNLT |
| Ga0210401_103292031 | 3300020583 | Soil | CNMELEALQQIDSEVRALGARIVALTPELERYRRTVHKNRPSTS |
| Ga0210401_103712331 | 3300020583 | Soil | MELEALQEIDSEVRAALGAQIVALTPELERYTRGVHKKDCG |
| Ga0210401_116085973 | 3300020583 | Soil | MELEALQEIDSVVRMLGVRIVALTPELERYSHSLHKKL |
| Ga0210404_104030533 | 3300021088 | Soil | MELEALQGINSEVRALGAQIVVLTPELERYTRALHKKLNLTFDMLTDLHLKT |
| Ga0210406_108127221 | 3300021168 | Soil | YCNTELEALQQIDSEARALGAHIVALTPELERYTRTVHKN |
| Ga0210405_101291331 | 3300021171 | Soil | MELEALQGIDSEVRALGAQIVVLTPELERYTRALHKKL |
| Ga0210405_105012632 | 3300021171 | Soil | VTLLHEMELEALQEIDSEVRAALGAQIVALTPELERYTRGVHKKDCG |
| Ga0210408_104682343 | 3300021178 | Soil | MMELEALQEVDPEIRALGARIVALTTELERYTRSVHKKLNLT |
| Ga0210385_100835494 | 3300021402 | Soil | MELEALQEVNSEVTNMGANIVVLTPELERYTRSLHKKLNLTFDILTDLHLKTTAQSALV |
| Ga0210389_111253903 | 3300021404 | Soil | MELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLKLTFDMLTDLHLKTAEQ |
| Ga0210387_108792573 | 3300021405 | Soil | MELEALQGIYSEVKDLGAQIVVLTPELERYTRALHKKLNL |
| Ga0210387_111737152 | 3300021405 | Soil | MELEALQEIHSEVRALGAQIVVMTPELERYTRALHKKLNLTFDIL |
| Ga0210386_100556014 | 3300021406 | Soil | MELEALQQVHSEVKALGAQIVVITPELERYTRALHRKLN |
| Ga0210386_109735883 | 3300021406 | Soil | MELEALQQIYGEVRALGAQIVVLTPELERYTRALHKKLNLS |
| Ga0210383_106339201 | 3300021407 | Soil | MELEALQEVNSEVTNMGAHIVVLTPELERYTRGLHKRLNLTFDILT |
| Ga0210383_115635141 | 3300021407 | Soil | MELEALQTIDSEVRALGAQIVVLTPELERYTRALHKKLNLTFD |
| Ga0210394_108602372 | 3300021420 | Soil | MELEALQEIHSEVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTA |
| Ga0210384_112520581 | 3300021432 | Soil | MELEALKRIHSEVKDLGEQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTAEQFRL |
| Ga0210384_113629623 | 3300021432 | Soil | MELEALQGIHSEVRSLGAQIVVLTPELERYTRALHKKLNLSFDILTDLHL |
| Ga0210391_102530551 | 3300021433 | Soil | MELEALQEIHSEVRALGAQIVVLTPELERYTRALHKKLNLTFEILTDLH |
| Ga0210392_112013482 | 3300021475 | Soil | MELEALQGIHSDVRALGAQIVVITPELERYTRAMHKKLNLTFDILTDL |
| Ga0210402_100122363 | 3300021478 | Soil | MMELEALQEIGSEVRSLGADVDLLIITPELERYTRGVHRKLQLTFDA |
| Ga0126371_101441811 | 3300021560 | Tropical Forest Soil | MMELEALQTVDSEVRALGARTVALTPELERYTRNMHRKLSL |
| Ga0126371_130289322 | 3300021560 | Tropical Forest Soil | MELEALQAIDSEVETLGARIVALTPELDRYTRVVHKKQNLTFDILTDLH |
| Ga0222729_10456192 | 3300022507 | Soil | MELEALQGIHSDVRALGAQIVVITPELERYTRAMHKKLNLTFD |
| Ga0222756_10681891 | 3300022709 | Soil | MELEALQGINSEVRALGAQIVVLTPELERYTRALH |
| Ga0242674_10529711 | 3300022711 | Soil | MELEALQGVNSEVKTLGAQIVVLTPELERYTRGLHKKLKLTFDILTDL |
| Ga0242653_10109243 | 3300022712 | Soil | MELEALQQIHGEVRALGAQIVVLTPELERYTRALHKKLNLSFDILTDLHLKTAE |
| Ga0208194_10565482 | 3300025412 | Peatland | MELEALQQIHPEVRAAGAELVVITPELERYTRAMHKKLNLTFDILT |
| Ga0208034_10552603 | 3300025442 | Peatland | MELEALQQIHSEVRALGAQIVVVTPELERYTRALHKKLNLSFDILTDL |
| Ga0208689_10793121 | 3300025459 | Peatland | MELEALQQIHSEVGALGARIAVITPELERYTRALHKKLNLSFDI |
| Ga0207663_105574333 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MELEALQRIHSEVRDLGAQIVVLTPELERYTRALH |
| Ga0207646_100372251 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLELEALQEMDFEVRALGGRIVALSPELERYTRNVHKKLNLSFDIL |
| Ga0257178_10106983 | 3300026446 | Soil | MELEALQGINCEVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKTAEQF |
| Ga0257168_11163203 | 3300026514 | Soil | MMELQALQEIDSEVRALGAQIVVLTPELERYRRNVH |
| Ga0207820_1071271 | 3300026809 | Tropical Forest Soil | MELEALADVNSEVKALGAQIVVLTPELERYPRNLHNKLNLPFDIL |
| Ga0207786_1144661 | 3300026866 | Tropical Forest Soil | MELEALRDINPEVTALGAQCVVLTPELERYTRNLHN |
| Ga0207763_10171522 | 3300026879 | Tropical Forest Soil | MELEALRDINPEVTALGAQCVVLTPELERYTRNLHNKLNLPFDILTDLHLKT |
| Ga0207805_10119811 | 3300026887 | Tropical Forest Soil | MELEALRDINPEVTALGAQCVVLTPELERYTRNLHNKLNLPFDILTDLHLK |
| Ga0209732_10091973 | 3300027117 | Forest Soil | MELEALQGINSEVRALGAQIVVLTPELERYTRALHKKLNLTFDMLTD |
| Ga0209215_10233161 | 3300027266 | Forest Soil | MELEALQEIQSEVSALGAQIVVLTPELERYTRNLHKKLNLTFDILTDF |
| Ga0209004_10183393 | 3300027376 | Forest Soil | MELEALQQIYGEVKALGAQIVVLTPELERYTRALHKKLNLSFD |
| Ga0209626_11337003 | 3300027684 | Forest Soil | MELEALQEIHSEVRALGAQMVVLTPELERYTRALHKKLNLT |
| Ga0209655_100243245 | 3300027767 | Bog Forest Soil | MELEALKEIGPEVRELGARIVVLTPELERYTRALHKKLNLP |
| Ga0209039_103828713 | 3300027825 | Bog Forest Soil | MELEALQEIHSEVRALGAEIIVITPELERYTRALHK |
| Ga0209465_105309731 | 3300027874 | Tropical Forest Soil | MMELEALQTADSEVRALGARTVALTPELERYTRNMHRKLSLTFDILTDLHLKAA |
| Ga0209169_101857824 | 3300027879 | Soil | MELEALQEVNSEVTNMGAHIVVLTPELERYTRGLHKKLNLTFDILTDLHL |
| Ga0209067_101020703 | 3300027898 | Watersheds | MELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLK |
| Ga0209698_109814051 | 3300027911 | Watersheds | MELEALQQIHSEVRALGARIVVITPELERYTRALHKKLNLSFD |
| Ga0257175_10456211 | 3300028673 | Soil | MELEALQGINSEFRALGAQIVVLTPELERYTRALHKKLNLTF |
| Ga0308309_114309113 | 3300028906 | Soil | MELEALQGIYSEVKDLGAQIVVLTPELERYTRALHKKL |
| Ga0222749_102214383 | 3300029636 | Soil | MELEALQGIDSEVRALGAQIVVLTPELERYTRALHTKLKLTFDMLTDLHLKTAEQFR |
| Ga0222749_106090632 | 3300029636 | Soil | MELEALQQVHSEVRALGAEIVVITPELERYTRALHKKLNLT |
| Ga0302282_12704961 | 3300030045 | Fen | MELEALKEIDSEVQALGARIAVLTPELERYTRALRKKLNLPFDILTDL |
| Ga0265762_10062831 | 3300030760 | Soil | MELEALQEVDGEVRKLGARILVITPELERYTRALHKKLN |
| Ga0318573_104458551 | 3300031564 | Soil | MMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTHDILTDLHLTTAEEFRLV |
| Ga0310915_112973631 | 3300031573 | Soil | MMELEALQGFNCEVRAVGARIVALTPEVQRYTRGVYKKLNLTFDIL |
| Ga0318561_108155121 | 3300031679 | Soil | MMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLHLKTAEEFRL |
| Ga0318572_106097201 | 3300031681 | Soil | MELEALQEIYAEVRALGARLVVITPELERYTRALRSKLNLSLDLLTDLHLK |
| Ga0310686_1074097151 | 3300031708 | Soil | MELEALQEVHSQIRALGVQVVAITPELERYTRLVHRKSNLAFDI |
| Ga0307476_104905333 | 3300031715 | Hardwood Forest Soil | MELEALEQIHSDVKALGGEIVVLTPELERYTRAMHKKLNLT |
| Ga0307475_101625986 | 3300031754 | Hardwood Forest Soil | MELEALQNINSEVKALGAQIVVLTPELERYTRNLHKKLNLTFDI |
| Ga0307475_101781561 | 3300031754 | Hardwood Forest Soil | VIHSEVRSLGAQIVVLTPELERYTRALHKKLNLSFDILTDL |
| Ga0307475_108963511 | 3300031754 | Hardwood Forest Soil | MELEALQQIQGEVGALGAQIIVLTPELERYTRALHKKLNLSFDILTDLHLKTAEE |
| Ga0307475_110512643 | 3300031754 | Hardwood Forest Soil | MMELEALQEIDSEVRALGGRIVALTPERERYTRNVHKKL |
| Ga0318521_108634941 | 3300031770 | Soil | MMELEALQQIDSEVRGLGAQIVALTPELERYSRNVHKKLNLTLDVLTDLHLRTAE |
| Ga0318565_106199961 | 3300031799 | Soil | MMELEALQQIDSEVRGLGAQIVALTPELERYTRNVHKKLNLTFDVLTDLH |
| Ga0318497_105056863 | 3300031805 | Soil | MELEALQQIYPEVKALGAQIVVLTPELEHYTRALHKKLNLTFD |
| Ga0307478_108448453 | 3300031823 | Hardwood Forest Soil | MELEALQGIHSDVRALGAQIVVITPELERYTRAMHKKLNLTF |
| Ga0318512_104179353 | 3300031846 | Soil | MMELEALQTVDSEVRALGARTVALTPELERYTRSLHRKLT |
| Ga0306925_101106311 | 3300031890 | Soil | MMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLHLKTAEE |
| Ga0306923_125317323 | 3300031910 | Soil | MELEALKEIDSEVNQLGARIVVLTPELERYTRALHNKLN |
| Ga0307479_108861841 | 3300031962 | Hardwood Forest Soil | MELEALQQIHGEVRALGAQIVVLTPELERYTRALHKK |
| Ga0307479_113716883 | 3300031962 | Hardwood Forest Soil | MELEALQQIHGEVRALGAQIVVLTPELERYTRALHKKLNLSFDILTDLHLK |
| Ga0306922_120960903 | 3300032001 | Soil | MELEALREIDSGVRELGARIVVLTPELERYTRALHKKLNLPFDILTDLH |
| Ga0306922_123831302 | 3300032001 | Soil | MMELEALQEIDSEVRQLGGRIVALTPQLERYTRNVHKKLNLTYDI |
| Ga0310911_108541112 | 3300032035 | Soil | MMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLHLTTAEEFRL |
| Ga0318514_104171331 | 3300032066 | Soil | MMELEALQQIDSEVRGLGAQIVTLTPELERYTRNVHKKLNLTFDVLTDLHL |
| Ga0306924_121313123 | 3300032076 | Soil | MELEALSEIDSGVRALGARIVVLTPELERYTRALHKKLNLA |
| Ga0306924_125122001 | 3300032076 | Soil | MMELEALQQIDSEVRGLGAQIVALTPELERYSRNVHKKLNL |
| Ga0311301_125167321 | 3300032160 | Peatlands Soil | VHAEVKALGAQIVVITPELERYTRALHRKLNLTYDILTDLHLKT |
| Ga0307471_1005219241 | 3300032180 | Hardwood Forest Soil | MMELEALQEIDSEVRALGGRIVALTPERERYTRNVYKKLSLTFDILTDLHLKTA |
| Ga0307472_1001194664 | 3300032205 | Hardwood Forest Soil | MMELEALQEIDSEVRALGGRIVALTPERERYTRNVHK |
| Ga0306920_1002595412 | 3300032261 | Soil | MMELEALQEIHSQVSGLGAQIVVLTPELERYTRALHNKLNLTYDILTDLI |
| Ga0335078_1005014010 | 3300032805 | Soil | MELEALQQIHADVRALGAQIVVLTPELERYTRALHKKLNLTFDILTDLHLKIA |
| Ga0335078_112555943 | 3300032805 | Soil | MELEALKEIDSEVRALGARIVVLTPELERYTRALYKKLNLPYDI |
| Ga0335080_117912901 | 3300032828 | Soil | MELEALQQVDSQIRSLGARIVAITPELERYTRALH |
| Ga0335081_103548524 | 3300032892 | Soil | MELEALQQIHSEVRALGARIVVITPELERYTRALHKKLNLSFDILTDLH |
| Ga0335081_113415431 | 3300032892 | Soil | MELEALQETYSEISAQGAELVVITPELERYTRALHRKLNLSFDILTAL |
| Ga0335074_101237154 | 3300032895 | Soil | MELEALKEIDSEVRALGARIVVLTPELERYTRALYKKLNLPYDILTDLHLKTAEEY |
| Ga0335074_102448604 | 3300032895 | Soil | MELEALQEIVPDVTALGGRIVALTPELERYTRMLHKKLNLTFDILTRFSHR |
| Ga0335074_106798521 | 3300032895 | Soil | MELEALQQIHSEVRALGAQIVVLTPELERYTRALHKKLNLTYD |
| Ga0335074_107326643 | 3300032895 | Soil | MELEALKEIDSEVRALGAQIVVLTPELERYTRALHKKLNLPFD |
| Ga0335072_108460201 | 3300032898 | Soil | MELEALQQVESEIRGLGARLVVITPEIERYTRAMHRKLN |
| Ga0335072_112944963 | 3300032898 | Soil | MDLEALQGINSEVRALGAQTVVLTPELERYTRALHKKLNLTFDMQT |
| Ga0335076_109318461 | 3300032955 | Soil | MHAEVRALGAEIVVITPEMERYTRALHKKLNLTFDILTDLHL |
| Ga0335077_106970883 | 3300033158 | Soil | MELEALQETYSEISAQGAELVVITPELERYTRALHRK |
| Ga0335077_108498531 | 3300033158 | Soil | MELEALKEIDSEVRALGARIVVLTPEMERYTRALHK |
| Ga0318519_109739311 | 3300033290 | Soil | MMELEALQGFNCEVRAVGARIVALTPEVQRYTRGVYKKLNLTFDILT |
| Ga0326727_104405032 | 3300033405 | Peat Soil | MELEALQEIYSEVRALGAELVVITPELERYTRALHKKLNLTFDILTD |
| ⦗Top⦘ |