NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041365

Metagenome / Metatranscriptome Family F041365

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041365
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 43 residues
Representative Sequence IEVVSPAMTREYEDFLKNAQLSVMSDPESLRLMRATHVKEPA
Number of Associated Samples 122
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 5.62 %
% of genes near scaffold ends (potentially truncated) 88.75 %
% of genes from short scaffolds (< 2000 bps) 93.12 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.125 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.125 % of family members)
Environment Ontology (ENVO) Unclassified
(36.875 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.125 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.86%    β-sheet: 0.00%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF07883Cupin_2 23.12
PF02615Ldh_2 13.12
PF02798GST_N 9.38
PF00857Isochorismatase 3.75
PF03118RNA_pol_A_CTD 1.25
PF12681Glyoxalase_2 1.25
PF13417GST_N_3 1.25
PF00216Bac_DNA_binding 1.25
PF16952Gln-synt_N_2 0.62
PF00126HTH_1 0.62
PF05199GMC_oxred_C 0.62
PF03476MOSC_N 0.62
PF08031BBE 0.62
PF05013FGase 0.62
PF02787CPSase_L_D3 0.62
PF02738MoCoBD_1 0.62
PF00202Aminotran_3 0.62
PF12697Abhydrolase_6 0.62
PF07690MFS_1 0.62
PF13193AMP-binding_C 0.62
PF01968Hydantoinase_A 0.62
PF02771Acyl-CoA_dh_N 0.62
PF05721PhyH 0.62
PF02910Succ_DH_flav_C 0.62
PF13602ADH_zinc_N_2 0.62
PF00903Glyoxalase 0.62
PF13610DDE_Tnp_IS240 0.62
PF13410GST_C_2 0.62
PF13432TPR_16 0.62
PF10415FumaraseC_C 0.62
PF13085Fer2_3 0.62
PF13561adh_short_C2 0.62
PF05117DUF695 0.62
PF05532CsbD 0.62
PF00106adh_short 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG2055Malate/lactate/ureidoglycolate dehydrogenase, LDH2 familyEnergy production and conversion [C] 13.12
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 3.75
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 3.75
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 1.25
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 1.25
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.62
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.62
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.62
COG3217N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domainDefense mechanisms [V] 0.62
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.62
COG3741N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 0.62
COG3931Predicted N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 0.62
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.12 %
All OrganismsrootAll Organisms41.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001641|JGI20238J16299_101994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300004091|Ga0062387_101426778Not Available552Open in IMG/M
3300004156|Ga0062589_101133321All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300005332|Ga0066388_108690246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300005458|Ga0070681_10035427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5014Open in IMG/M
3300005614|Ga0068856_101765489Not Available631Open in IMG/M
3300005764|Ga0066903_104752437Not Available723Open in IMG/M
3300005764|Ga0066903_104814815All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005841|Ga0068863_101285321Not Available738Open in IMG/M
3300005843|Ga0068860_100204022Not Available1917Open in IMG/M
3300006028|Ga0070717_10221654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1662Open in IMG/M
3300006174|Ga0075014_100205579Not Available995Open in IMG/M
3300006176|Ga0070765_101323979Not Available679Open in IMG/M
3300006806|Ga0079220_10317611Not Available972Open in IMG/M
3300006806|Ga0079220_12088717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium507Open in IMG/M
3300006871|Ga0075434_101090145Not Available812Open in IMG/M
3300006881|Ga0068865_101269593Not Available654Open in IMG/M
3300006918|Ga0079216_11383268Not Available581Open in IMG/M
3300009101|Ga0105247_10439061Not Available938Open in IMG/M
3300009148|Ga0105243_11276278Not Available751Open in IMG/M
3300009162|Ga0075423_12520115All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300009545|Ga0105237_10765072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium972Open in IMG/M
3300009551|Ga0105238_10682388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1039Open in IMG/M
3300009792|Ga0126374_10468725All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300009826|Ga0123355_10445705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1635Open in IMG/M
3300009826|Ga0123355_10877500Not Available980Open in IMG/M
3300009826|Ga0123355_11077530All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300009826|Ga0123355_11125382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria813Open in IMG/M
3300009826|Ga0123355_11268296Not Available743Open in IMG/M
3300009826|Ga0123355_11735819Not Available593Open in IMG/M
3300009826|Ga0123355_11940671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. Marseille-P9652549Open in IMG/M
3300010048|Ga0126373_12554007Not Available569Open in IMG/M
3300010048|Ga0126373_12577297Not Available567Open in IMG/M
3300010049|Ga0123356_10071429All Organisms → cellular organisms → Bacteria → Proteobacteria3258Open in IMG/M
3300010049|Ga0123356_12972596Not Available592Open in IMG/M
3300010146|Ga0126320_1448514Not Available819Open in IMG/M
3300010162|Ga0131853_10295694All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300010361|Ga0126378_12208895Not Available628Open in IMG/M
3300010361|Ga0126378_12449573Not Available596Open in IMG/M
3300010366|Ga0126379_10426655All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300010366|Ga0126379_12761557Not Available587Open in IMG/M
3300010366|Ga0126379_12850447Not Available578Open in IMG/M
3300010366|Ga0126379_13091429Not Available557Open in IMG/M
3300010369|Ga0136643_10581495All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010373|Ga0134128_10724493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1104Open in IMG/M
3300010376|Ga0126381_100083905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4019Open in IMG/M
3300010376|Ga0126381_102015124Not Available832Open in IMG/M
3300010401|Ga0134121_12185514Not Available590Open in IMG/M
3300011444|Ga0137463_1358488All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300012208|Ga0137376_11176959Not Available655Open in IMG/M
3300012211|Ga0137377_11589401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300012212|Ga0150985_102747374Not Available1499Open in IMG/M
3300012212|Ga0150985_106856267Not Available773Open in IMG/M
3300012212|Ga0150985_116433675Not Available691Open in IMG/M
3300012212|Ga0150985_118208726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium574Open in IMG/M
3300012349|Ga0137387_10691978Not Available738Open in IMG/M
3300012361|Ga0137360_10448837All Organisms → cellular organisms → Bacteria → Proteobacteria1093Open in IMG/M
3300012361|Ga0137360_10816347Not Available803Open in IMG/M
3300012362|Ga0137361_10438243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1200Open in IMG/M
3300012469|Ga0150984_108277871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium519Open in IMG/M
3300012469|Ga0150984_111925074Not Available1062Open in IMG/M
3300012469|Ga0150984_122830872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium521Open in IMG/M
3300012582|Ga0137358_10549680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria776Open in IMG/M
3300012923|Ga0137359_10468689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp.1113Open in IMG/M
3300012957|Ga0164303_11353967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300012971|Ga0126369_13290909Not Available529Open in IMG/M
3300012971|Ga0126369_13439175All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012984|Ga0164309_11966211Not Available501Open in IMG/M
3300013104|Ga0157370_10891271Not Available807Open in IMG/M
3300016294|Ga0182041_10736752Not Available876Open in IMG/M
3300016341|Ga0182035_11032689Not Available729Open in IMG/M
3300016357|Ga0182032_11984348Not Available510Open in IMG/M
3300016387|Ga0182040_11422440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300016422|Ga0182039_10220842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1525Open in IMG/M
3300016422|Ga0182039_11805648Not Available560Open in IMG/M
3300016445|Ga0182038_10076684All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300016445|Ga0182038_11867273Not Available543Open in IMG/M
3300017955|Ga0187817_10010584All Organisms → cellular organisms → Bacteria → Proteobacteria5285Open in IMG/M
3300018007|Ga0187805_10097790Not Available1326Open in IMG/M
3300018060|Ga0187765_11166566Not Available538Open in IMG/M
3300018084|Ga0184629_10497611Not Available635Open in IMG/M
3300018090|Ga0187770_10792893Not Available758Open in IMG/M
3300020582|Ga0210395_11010201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria616Open in IMG/M
3300021181|Ga0210388_10708827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria876Open in IMG/M
3300021377|Ga0213874_10135236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M
3300021475|Ga0210392_10552799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria851Open in IMG/M
3300021476|Ga0187846_10441826Not Available533Open in IMG/M
3300021560|Ga0126371_13594890Not Available523Open in IMG/M
3300022523|Ga0242663_1053085Not Available719Open in IMG/M
3300022532|Ga0242655_10068722All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300022722|Ga0242657_1250467Not Available508Open in IMG/M
3300025627|Ga0208220_1031967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1625Open in IMG/M
3300025927|Ga0207687_10021383Not Available4298Open in IMG/M
3300026023|Ga0207677_11674809All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300026035|Ga0207703_11446943Not Available661Open in IMG/M
3300026035|Ga0207703_12135502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium536Open in IMG/M
3300026088|Ga0207641_11586525Not Available656Open in IMG/M
3300027070|Ga0208365_1008798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1235Open in IMG/M
3300027074|Ga0208092_102613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1024Open in IMG/M
3300028906|Ga0308309_11746884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium527Open in IMG/M
3300030993|Ga0308190_1125853Not Available587Open in IMG/M
3300031058|Ga0308189_10357669Not Available590Open in IMG/M
3300031231|Ga0170824_126968719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1135Open in IMG/M
3300031474|Ga0170818_107057481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1279Open in IMG/M
3300031544|Ga0318534_10159514Not Available1303Open in IMG/M
3300031544|Ga0318534_10523533Not Available677Open in IMG/M
3300031546|Ga0318538_10508012Not Available653Open in IMG/M
3300031549|Ga0318571_10134627Not Available841Open in IMG/M
3300031549|Ga0318571_10332018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria579Open in IMG/M
3300031564|Ga0318573_10163457Not Available1171Open in IMG/M
3300031668|Ga0318542_10146590Not Available1170Open in IMG/M
3300031668|Ga0318542_10166335Not Available1102Open in IMG/M
3300031679|Ga0318561_10368964Not Available788Open in IMG/M
3300031679|Ga0318561_10515454Not Available658Open in IMG/M
3300031679|Ga0318561_10589702Not Available612Open in IMG/M
3300031681|Ga0318572_10009449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4569Open in IMG/M
3300031719|Ga0306917_10729986Not Available778Open in IMG/M
3300031724|Ga0318500_10148153Not Available1103Open in IMG/M
3300031736|Ga0318501_10117561Not Available1343Open in IMG/M
3300031744|Ga0306918_10005690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00886694Open in IMG/M
3300031744|Ga0306918_11107789Not Available613Open in IMG/M
3300031744|Ga0306918_11358842Not Available545Open in IMG/M
3300031751|Ga0318494_10363424Not Available838Open in IMG/M
3300031765|Ga0318554_10224375Not Available1070Open in IMG/M
3300031765|Ga0318554_10770241Not Available538Open in IMG/M
3300031768|Ga0318509_10697376Not Available564Open in IMG/M
3300031771|Ga0318546_11325111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales506Open in IMG/M
3300031777|Ga0318543_10218613Not Available847Open in IMG/M
3300031780|Ga0318508_1008981All Organisms → cellular organisms → Bacteria2204Open in IMG/M
3300031792|Ga0318529_10101328Not Available1300Open in IMG/M
3300031792|Ga0318529_10184354Not Available966Open in IMG/M
3300031795|Ga0318557_10380999Not Available648Open in IMG/M
3300031798|Ga0318523_10279146Not Available834Open in IMG/M
3300031799|Ga0318565_10119335Not Available1272Open in IMG/M
3300031846|Ga0318512_10120345Not Available1249Open in IMG/M
3300031846|Ga0318512_10487203Not Available624Open in IMG/M
3300031860|Ga0318495_10079045All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300031879|Ga0306919_11223472Not Available570Open in IMG/M
3300031890|Ga0306925_11215524All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M
3300031894|Ga0318522_10150297Not Available877Open in IMG/M
3300031910|Ga0306923_12104537All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300031912|Ga0306921_10150501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2723Open in IMG/M
3300031912|Ga0306921_11077718Not Available902Open in IMG/M
3300031947|Ga0310909_10695019Not Available845Open in IMG/M
3300031981|Ga0318531_10099687Not Available1279Open in IMG/M
3300031996|Ga0308176_11576549Not Available700Open in IMG/M
3300032025|Ga0318507_10143293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1019Open in IMG/M
3300032035|Ga0310911_10348375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria855Open in IMG/M
3300032054|Ga0318570_10044859All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300032059|Ga0318533_10259600Not Available1255Open in IMG/M
3300032076|Ga0306924_10086867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3515Open in IMG/M
3300032076|Ga0306924_11742787Not Available651Open in IMG/M
3300032076|Ga0306924_12542226Not Available512Open in IMG/M
3300032089|Ga0318525_10392718Not Available711Open in IMG/M
3300032180|Ga0307471_101659772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria794Open in IMG/M
3300032205|Ga0307472_100137377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1761Open in IMG/M
3300033134|Ga0335073_10360387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1718Open in IMG/M
3300033289|Ga0310914_11312577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium626Open in IMG/M
3300033290|Ga0318519_10580427Not Available680Open in IMG/M
3300034661|Ga0314782_146467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium576Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.75%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut6.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.50%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.88%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.25%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.25%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.25%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.25%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.25%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.25%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.62%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.62%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.62%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.62%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.62%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.62%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001641Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010369Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3)Host-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027074Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20238J16299_10199423300001641Forest SoilAPDPVSVTMPAREYEDFLKNARTEIMGDPEAVRLMRATHVKEPV*
Ga0062387_10142677823300004091Bog Forest SoilLMIEVVSPAMAREYEDFLRNAQLSVMNDPESLRLMRATHIKVQA*
Ga0062589_10113332123300004156SoilMIEVASPDMEQEYKAFLQNARTEVMSDPESVRLMRATHIKEPA*
Ga0066388_10869024623300005332Tropical Forest SoilRLMIEVVSPEMAREYEGFLKNARTEIMGDPEAVRLMRATHVKEPG*
Ga0070681_1003542713300005458Corn RhizosphereMIEVVSPPMAEEYENFLKTAHLTVMSDAESLRLMRATHIKEPV*
Ga0068856_10176548923300005614Corn RhizosphereSPTMAREYEDFLKNAQMSVMNDAESLRLMRATHIKEHD*
Ga0066903_10475243713300005764Tropical Forest SoilMAREYEDFVKNAGTKMRSDPEALRLMRATHIAKEAV*
Ga0066903_10481481523300005764Tropical Forest SoilMIEIAPPAMAQEYEDFLKGAQTAMMSDPESLRLMRATHLKE
Ga0068863_10128532113300005841Switchgrass RhizosphereIEVASPDMEQEYKAFLQNARTEVMSDPESVRLMRATHIKEPV*
Ga0068860_10020402213300005843Switchgrass RhizosphereVSPTMAQEYVDFLNSAQPAVMNDPEALRLMRATHIKESA*
Ga0070717_1022165433300006028Corn, Switchgrass And Miscanthus RhizosphereVATPEMAREYKDFLENAQLSVMNDPGSLRLMRATHIEERA*
Ga0075014_10020557923300006174WatershedsLENRLMIEVVSPAMAREYEDFLKSAQTAMMGDPESLRLMRATHIKQPA*
Ga0070765_10132397913300006176SoilMIEVVSPDMAREYQEFLAGDQRSMMSDPESLRLMRATHMKEPA
Ga0079220_1031761113300006806Agricultural SoilLMIEVVSPTMAREYEDFLKNAQMSVMNDAESLRLMRATHIKEHA*
Ga0079220_1208871723300006806Agricultural SoilWIENRLMIEIAPPEMVREYQEFLKDSRTGVMNDPESVRLMRATHIKEPA*
Ga0075434_10109014513300006871Populus RhizosphereVASPDMEQEYKDFLQNARPEVMSDPEAVRLMRATHIKEPA*
Ga0068865_10126959313300006881Miscanthus RhizosphereIAPPEMVREYQEFLKDSRTGVMNDPESVRLMRATHIKEPA*
Ga0079216_1138326823300006918Agricultural SoilRLMVEVATPAMAQEYRDFLNGAQTATMSDPESARLMRATHLKEPAKKPA*
Ga0105247_1043906123300009101Switchgrass RhizosphereATPAMAQEYMDFLQGMHQAAMNDPESVRLMRATHIKETA*
Ga0105243_1127627833300009148Miscanthus RhizosphereVVSPTMAREYEDFLKNAQLSVMDDPESLRRMRATHIKEPA*
Ga0075423_1252011523300009162Populus RhizosphereMIEVVSPEIAREYEDFLKNARTEIMGDPEAVRLMRATHVEEPA*
Ga0105237_1076507233300009545Corn RhizosphereVSPAMAREYEDFLKNAQLSVMNDPESLRRMRATHIKEPA*
Ga0105238_1068238813300009551Corn RhizosphereATPAMAQEYMDFLQVMHQAAMNDPESVRLMRATHIKETA*
Ga0126374_1046872513300009792Tropical Forest SoilMIEIAPPAMAQEYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA*
Ga0123355_1044570533300009826Termite GutEVVSPAMAREYEDFLRNAQLSVMNDPESLRLMRATHIEERV*
Ga0123355_1087750013300009826Termite GutMAQEYLDFLKGARTEMMSDPEAIRLMRATHVKEPAK*
Ga0123355_1107753013300009826Termite GutMIEVVSPAMAQEYEDFLRNAQHSVMNDPESLRLMRATHIEERV*
Ga0123355_1112538213300009826Termite GutLDFLTGARTAMMSDPESTRLMQATHVKEPAKKPG*
Ga0123355_1126829613300009826Termite GutTPAMAQEYLDFLKGARPEMMSDPESIRLMRATHAKELVK*
Ga0123355_1173581913300009826Termite GutMIEVVSPAMAREYEDFLRNAQLSVMNDPESLRLMRATHIEERV*
Ga0123355_1194067123300009826Termite GutEVVSPAMAQEYQDFLKNAQMSVMNDPESLRLMRATHLAPQPAA*
Ga0126373_1255400713300010048Tropical Forest SoilEFWVENRFMIEVAPPAMAKEYLEFLKRPRTTLMNDPESLRLMRTTHAKEREPA*
Ga0126373_1257729713300010048Tropical Forest SoilNRLMIEVVSPAMAREYQDFLQNAQLSAMSDPESRRLMRATHVARQHSA*
Ga0123356_1007142953300010049Termite GutSPAMAREYEDFLRNAQLSVMNDPESLRLMRATHIEERV*
Ga0123356_1297259623300010049Termite GutWLENRLMLEVVSPAMAREYEDFLRNAQLSVMNDPESLRLMRARHIEERV*
Ga0126320_144851433300010146SoilENRLMIEVVSPAMAREYENFLKNAQMSVMNDAESLRLMRATHIKEQA*
Ga0131853_1029569433300010162Termite GutATPAMAQEYVDFLKGAHTATMSDPESTRLMQATHVKEPAK*
Ga0126378_1220889513300010361Tropical Forest SoilMIEGVSPAMACEYEDFLKNAQLSLMSDPESLRLMRATLIKEPA*
Ga0126378_1244957323300010361Tropical Forest SoilAREYEDFLKGAQTAMMSDPESLRLMRATHLKAPVKEPA*
Ga0126379_1042665533300010366Tropical Forest SoilLMIEVVSPPMAREYEDFLQNAQLSLMSDPESRRRMRATHVARQHSA*
Ga0126379_1276155713300010366Tropical Forest SoilVASPAMMQEYLGFLSSVQPATMNDPEALRLMRATHVKEPA*
Ga0126379_1285044723300010366Tropical Forest SoilVVWPAMAREYQHFLKGAQTAMMSDPASLRLMRATHLKESVKEPA*
Ga0126379_1309142913300010366Tropical Forest SoilPAMASEYENFLRNAQPSVMNDPEALRLMRATHIEAQA*
Ga0136643_1058149513300010369Termite GutMIEVVSPAMAREYEDFLRNAQLSVMNDPESLRLMRATHIEERS*
Ga0134128_1072449333300010373Terrestrial SoilAREYEDFLKNAQMSVMNDAESLRLMRATHIKEQV*
Ga0126381_10008390523300010376Tropical Forest SoilMIEIASPKTAREYEDFLKSARTEVIGDSDAVRLIRATHVND*
Ga0126381_10201512413300010376Tropical Forest SoilMIEGVSPAMACEYEDFLKNAQLSLMSDPESLRLMRATHIKEPA*
Ga0134121_1218551423300010401Terrestrial SoilLMLEVVSPTMAQEYVDFLNSAQPAVMNDPEALRLMRATHIKESA*
Ga0137463_135848823300011444SoilMIEVAPPDMEQEYKAFLQNARPEVMGDPESVRLMRATHIKEPA*
Ga0137376_1117695923300012208Vadose Zone SoilMIEIATPKMVREYKRFLKSSQVSQMSDPEALRLMRATHIKEPA*
Ga0137377_1158940123300012211Vadose Zone SoilLENRLMIEVVSPEMAREYEVFLKNARTEIMGDPEAVRLMRATHVKEPA*
Ga0150985_10274737433300012212Avena Fatua RhizosphereAPPEMVREYQEFLKNSRTEVMSDPESVRLMRATHIKEPA*
Ga0150985_10685626723300012212Avena Fatua RhizosphereVIEFWIENRLMIEIAPPEMVREYQEFLKDSRTEVMSDPESVRLMRATHIKEPA*
Ga0150985_11643367513300012212Avena Fatua RhizosphereNRLMIEIAPPEMVREYQEFLKNSRTEVMSDPESVRLMRATHIKESA*
Ga0150985_11820872613300012212Avena Fatua RhizosphereVIEFWIENRLMIEIAPPEMAREYQEFLKNARTDVMNDPEAVRLMRATHIKEPA*
Ga0137387_1069197823300012349Vadose Zone SoilLMIEVVSPAMEREYLDFLKGAQTSMMSDPESLRLMRATHVKETA*
Ga0137360_1044883713300012361Vadose Zone SoilEDRVKGAQPSMMSDPKALRLMRATHLREPVKEPA*
Ga0137360_1081634733300012361Vadose Zone SoilENRLMIEVVPPAMVREYEDLVKDAQTSMRSDAESLRLMRATHIKEPA*
Ga0137361_1043824343300012362Vadose Zone SoilPEMAREYEVFLKNARTEIMGDPEAVRLMRATHVKEPA*
Ga0150984_10827787123300012469Avena Fatua RhizosphereAREYQEFLKNARTEVMSDPDSVRLMRATHIKEPA*
Ga0150984_11192507413300012469Avena Fatua RhizosphereIENRLMIEIAPPEMVREYQEFLKDSRTEVMSYPESVRLMRATHIKEPA*
Ga0150984_12283087213300012469Avena Fatua RhizosphereMAREYQEFLKSARTGVMNDPESVRLMRATHIKEPA*
Ga0137358_1054968023300012582Vadose Zone SoilMIEVVSPEMAREYEVFLKNARTEIMGDPEAVRFMRATHVKEPA*
Ga0137359_1046868923300012923Vadose Zone SoilEYEDRVKGAQPSMMSDRKALRLMRATHLREPVKEPA*
Ga0164303_1135396723300012957SoilLRIDVVSPERVGEYEDFLKNARTEIMGDPETVRLMRATHVKEPV*
Ga0126369_1329090913300012971Tropical Forest SoilKMVREYKTFLKNAQVSQMSDPESLRLMRATHIKEPA*
Ga0126369_1343917513300012971Tropical Forest SoilMIEIAPPAMAQEYEDFLKGAQTAMMSDPESLRLMRATHLKERV
Ga0164309_1196621123300012984SoilLIEVVSPAMAREYEDFLKGAQTSMMRDPESLRLMRATHVKEPT*
Ga0157370_1089127123300013104Corn RhizosphereIEVAPPALRAESENFTHTAATGMRNDPEALRLMRATHIKEPA*
Ga0182041_1073675223300016294SoilAMAREYEDFLKGAQTATMSDPESLRLMRATHLKEPVQEPA
Ga0182035_1103268923300016341SoilRLMIEVVSPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0182032_1198434813300016357SoilMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0182040_1142244013300016387SoilNRLMIEVVSPEMAREYKDFLKNARTEIMGDPEAMRLMRATHVKEPAKE
Ga0182039_1022084213300016422SoilRLMIEVVSPAMAREYEDFLKNAQLSVMSDPESLRLMRVTHTKEPA
Ga0182039_1180564823300016422SoilASPAMAREYEDFLKGAQTAMMSDPEALRLMRATHLKEPVKEPA
Ga0182038_1007668413300016445SoilMAREYEDFLKGAQTAMMSDPEALRLMRATHLKEPVKEPA
Ga0182038_1186727333300016445SoilAREYEGFLKTTQLSMMNDPESLRLMRATHAKEPGR
Ga0187817_1001058453300017955Freshwater SedimentYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0187805_1009779013300018007Freshwater SedimentFWLENRLMIEVAPPDMAQEYEDFLKSAATSMRNDPEALRLMRATHLKEPA
Ga0187765_1116656613300018060Tropical PeatlandAMAKEYLEFLKRPRTALMNDPESLRLMRATHAKARETV
Ga0184629_1049761123300018084Groundwater SedimentMVEVASPAMAREYEDFLNTAQVSAMNDPESLRAMRESYLEKQPS
Ga0187770_1079289323300018090Tropical PeatlandWLENRLMIEVAPPDMAREYENFLGGAAKTMRNDPEALRLMRATHIKEPA
Ga0210395_1101020123300020582SoilEVATPAMTEEYLEFLKSARTTTMSDPASIRLMQATHLKEPAK
Ga0210388_1070882723300021181SoilVSPEMAREYEDFLKNSRTEIMGDPEAVRLMRATHVKEPV
Ga0213874_1013523613300021377Plant RootsMIEVVSPEMAREYEGFLKNARTEIMGDPEAVRLMRATHVKEPA
Ga0210392_1055279913300021475SoilVSPEMAREYEDFLKNARTEIMGDPEAVRLMRATHVKEPV
Ga0187846_1044182613300021476BiofilmVVSPAMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPMKEPA
Ga0126371_1359489023300021560Tropical Forest SoilMMEVVSPAMARECEDFLTNAQLSVMSDPESLPLMGVTHIKAPA
Ga0242663_105308513300022523SoilMIEVVSPAMAREYQDFVKNAATAMRSDPEALRLMRATHIAPQAPP
Ga0242655_1006872223300022532SoilMIEVVSPEMAREYEDFLKNARTEIMGDPEAVRLMRATHVKEPV
Ga0242657_125046723300022722SoilMIEVAPPDMAREYEDFLANAAPAMRNDAEALRLMRATHIKEPA
Ga0208220_103196713300025627Arctic Peat SoilDMAAEYENFLKTAANSMRNDPEALRLMRATHIKEPA
Ga0207687_10021383133300025927Miscanthus RhizosphereWLENRLMLEVVSPTMAQEYVDFLKSAQPAVMNDPEALRLMRATHIKESA
Ga0207677_1167480923300026023Miscanthus RhizosphereVVSPAMAREYEDFLKNAQLSVMDDPESLRQMRATHIKEPA
Ga0207703_1144694313300026035Switchgrass RhizosphereSPTMAQEYVDFLNSAQPAVMNDPEALRLMRATHIKESA
Ga0207703_1213550223300026035Switchgrass RhizosphereRFMIEVASPDMEQEYKDFLQNARPEVMSDPEAVRLMRATHIKEPA
Ga0207641_1158652513300026088Switchgrass RhizosphereMEQEYKAFLQNARTEVMSDPESVRLMRATHIKEPV
Ga0208365_100879823300027070Forest SoilMPAREYEDFLKNARTEIMGDPEAVRLMRATHVEEPV
Ga0208092_10261313300027074Forest SoilLMIEVVSPEMAREYEDFLKNARTEIMGDPEAVRLMRATHVKEPV
Ga0308309_1174688413300028906SoilMIEVAPPDMAQEYEDFLKTAATSMRNDPEALRLMRATHIKEPA
Ga0308190_112585333300030993SoilIEIAPPEMAREYQEFLKSARTEVMSDPEAVRLMRATHIKEPA
Ga0308189_1035766923300031058SoilIEIAPPEMAREYQEFLKNARTEVMNDPESVRLMRATHVKEPA
Ga0170824_12696871913300031231Forest SoilPRRPSAENRLMIEVVSPEMAREYEDFLKNARTEIMGDPEAVRLMRATHVKEPV
Ga0170818_10705748143300031474Forest SoilRLMIEVVSLEMAREYEVFLKNARTEIMGDPEAVRLMRATHVKEPA
Ga0318534_1015951423300031544SoilIEVVSPAMAREYEDFLKSAQTAMMSDPESLRLMRATHLKEPAQEPA
Ga0318534_1052353323300031544SoilYEGFLKGAQTAMMSDPEALRLMRATHLKEPVKEPA
Ga0318538_1050801223300031546SoilNRLMIEVVSPAMAREYQDFVKNAGTKMRSDPEALRLMRATHIAPAA
Ga0318571_1013462723300031549SoilLMIEVVSPAMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318571_1033201823300031549SoilREYKDFLKNARTEIMGDPEAMRLMRATHVKEPAKE
Ga0318573_1016345713300031564SoilSPVMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318542_1014659013300031668SoilVVSPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318542_1016633513300031668SoilENRLMIEVAPPAMAQEYEDFLKGAQTAMMSDPESLRLMRATHLKEPVTEPA
Ga0318561_1036896413300031679SoilSPAMAREYEDFLKGAQTAMMSDPESLRLMRATHLKKPVKEPA
Ga0318561_1051545413300031679SoilEYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318561_1058970223300031679SoilENRLMIEVVSPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLNEPVKELA
Ga0318572_1000944913300031681SoilMIEGVSPAMACEYEDFLKNAQLSLMSDPESLRLMRATQIKEPA
Ga0306917_1072998623300031719SoilAMAREYEDFLKSAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318500_1014815323300031724SoilSPAMAREYEDFLKGAQPAMMSDPESLRLMRATHLKEPVKEPA
Ga0318501_1011756123300031736SoilREYEDFLKGAQTAMMSDPESLRLMRATHLKKPVKEPA
Ga0306918_1000569013300031744SoilENRLMIEVASPAMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0306918_1110778913300031744SoilLMIEVVSPAMAREYEDFLKSAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0306918_1135884223300031744SoilMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKELA
Ga0318494_1036342423300031751SoilVVSPAMAREYEDFLKGAQTAMMSDSESLRLMRATHLKKPVKEPA
Ga0318554_1022437513300031765SoilEYEDFLKGAQTAMMSDPEALRLMRATHLKEPVKEPA
Ga0318554_1077024113300031765SoilNRLMIEVVSPAMAREYEDFLKNPQLSVMNDPESLRLMRATHIKELA
Ga0318509_1069737623300031768SoilVASPAMAREYEDFLKGAQTAMMSDPEALRLMRATHLKEPVKEPA
Ga0318546_1132511113300031771SoilNRLMIEIASPEMTAEYENFLKGTRPEVMSDPESVKLMRATHIEEPA
Ga0318543_1021861313300031777SoilREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKELA
Ga0318508_100898123300031780SoilMIEVVSPVMAREHEDFLKGAQTAMTSDPESLRLMRATHLKEPVKEPA
Ga0318529_1010132833300031792SoilRLMIEVAPPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318529_1018435413300031792SoilEVVSPAMAREYEEFLKGAQTAMMSDPEALRLMRATHLKEPVKEPA
Ga0318557_1038099913300031795SoilIEVASPAMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318523_1027914613300031798SoilIEVVSPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318565_1011933513300031799SoilAREYEDFLKGAQTAWMSDPESLRLMRATHLKEPVKEPVKEPA
Ga0318512_1012034513300031846SoilEYEDFLKGAQTAMMSDPESLRLMRATHLKKPVKEPA
Ga0318512_1048720313300031846SoilIEVVSPAMAREYEDFLKNAQLSVMSDPESLRLMRVTHTKEPA
Ga0318495_1007904513300031860SoilREYENFLKDAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0306919_1122347213300031879SoilEFWLENRLMIEVVSPAMAREYEDFLKNAQLSVMSDPESLRLMRVTHTKEPA
Ga0306925_1121552413300031890SoilLMIEVVSPAMAREYEGFLKTTQLSMMNDPESLRLMRATHAKEPGR
Ga0318522_1015029713300031894SoilVSPAMGREYESFLKDAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0306923_1210453723300031910SoilIEFWLENRLMIEVVSPAMTREYEDFLKNAQLSVMSDPESLRLMRATHVKEPA
Ga0306921_1015050113300031912SoilIEVVSPAMTREYEDFLKNAQLSVMSDPESLRLMRATHVKEPA
Ga0306921_1107771813300031912SoilREYEEFLKGAQTAMMSDPESLRLMRATHLNEPVKELA
Ga0310909_1069501913300031947SoilMIKVVSPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKELA
Ga0318531_1009968723300031981SoilIEVAPPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0308176_1157654923300031996SoilFWLENRLMIEVVSPTMAREYEDFLKNAQMSVMNDAESLRLMRATHIKERA
Ga0318507_1014329333300032025SoilSPAMAREYEDFLKNPQLSVMNDPESLRLMRATHIKELA
Ga0310911_1034837513300032035SoilLMIEVVSPEMAREYEDFLKNARTEIMGDPEAVRLMRPTHVKEPV
Ga0318570_1004485913300032054SoilMIEVVSPAMAREYENFLKDAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318533_1025960023300032059SoilMAREYEDFLKSAQTAMMSDPESLRLMRATHLKEPAQEPA
Ga0306924_1008686743300032076SoilVSPAMTQEYEDFIKNAQLSVMSDPESLRLMRATHVKELA
Ga0306924_1174278723300032076SoilIEVVSPAMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPVQEPA
Ga0306924_1254222623300032076SoilMIEVVSPAMAREYEDFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0318525_1039271823300032089SoilNRLMIEVAPPAMAREYEEFLKGAQTAMMSDPESLRLMRATHLKEPVKEPA
Ga0307471_10165977223300032180Hardwood Forest SoilENRLMIEVVSPEMAREYEDFLKNARTEIMGDPEAVRLMRATHVKEPV
Ga0307472_10013737733300032205Hardwood Forest SoilMAREYEAFLKNARTEIMGDPEAVRLMRATHVKEPV
Ga0335073_1036038713300033134SoilMVQEYQDFLKSVAPATMSDPESLRLMRATHIKEPA
Ga0310914_1131257723300033289SoilWLENRLMIEVVSPAMAREYQDFVKNAGTKMRSDPEALRLMRATHIAPAA
Ga0318519_1058042713300033290SoilYEDFLKGAQTAMMSDPESLRLMRATHLKEPVQEPA
Ga0314782_146467_439_5703300034661SoilMIEIAPPEMVREYQEFLKNSRTEVMSDPESVRLMRATHIKESA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.