| Basic Information | |
|---|---|
| Family ID | F041351 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGDLRL |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.62 % |
| % of genes near scaffold ends (potentially truncated) | 98.12 % |
| % of genes from short scaffolds (< 2000 bps) | 91.25 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.250 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (45.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.625 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.54% β-sheet: 2.82% Coil/Unstructured: 74.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF04055 | Radical_SAM | 23.75 |
| PF09351 | DUF1993 | 8.12 |
| PF00535 | Glycos_transf_2 | 5.62 |
| PF04392 | ABC_sub_bind | 3.12 |
| PF07690 | MFS_1 | 3.12 |
| PF02569 | Pantoate_ligase | 2.50 |
| PF09837 | DUF2064 | 1.25 |
| PF00144 | Beta-lactamase | 1.25 |
| PF13366 | PDDEXK_3 | 1.25 |
| PF00083 | Sugar_tr | 0.62 |
| PF00441 | Acyl-CoA_dh_1 | 0.62 |
| PF00296 | Bac_luciferase | 0.62 |
| PF00890 | FAD_binding_2 | 0.62 |
| PF13586 | DDE_Tnp_1_2 | 0.62 |
| PF14246 | TetR_C_7 | 0.62 |
| PF16658 | RF3_C | 0.62 |
| PF03702 | AnmK | 0.62 |
| PF00903 | Glyoxalase | 0.62 |
| PF10609 | ParA | 0.62 |
| PF00994 | MoCF_biosynth | 0.62 |
| PF00579 | tRNA-synt_1b | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.12 |
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 2.50 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.25 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.25 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.25 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.62 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.62 |
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.50 % |
| Unclassified | root | N/A | 22.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003368|JGI26340J50214_10077731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10009456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3133 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10247761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300004152|Ga0062386_100467933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1021 | Open in IMG/M |
| 3300004152|Ga0062386_100718138 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300004152|Ga0062386_100724217 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005532|Ga0070739_10088497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1791 | Open in IMG/M |
| 3300005557|Ga0066704_10402894 | Not Available | 908 | Open in IMG/M |
| 3300005559|Ga0066700_10366049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1017 | Open in IMG/M |
| 3300005560|Ga0066670_10320103 | Not Available | 944 | Open in IMG/M |
| 3300005568|Ga0066703_10808321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005598|Ga0066706_11383821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300005602|Ga0070762_10733625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300005607|Ga0070740_10100851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1312 | Open in IMG/M |
| 3300005764|Ga0066903_107894427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300005921|Ga0070766_10067717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2047 | Open in IMG/M |
| 3300006175|Ga0070712_100261239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1387 | Open in IMG/M |
| 3300006904|Ga0075424_102205928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300010046|Ga0126384_11267630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 682 | Open in IMG/M |
| 3300010048|Ga0126373_11209102 | Not Available | 822 | Open in IMG/M |
| 3300010335|Ga0134063_10637706 | Not Available | 546 | Open in IMG/M |
| 3300010360|Ga0126372_10338449 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1343 | Open in IMG/M |
| 3300010360|Ga0126372_12140416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300010362|Ga0126377_10250269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1725 | Open in IMG/M |
| 3300010366|Ga0126379_11028662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300010366|Ga0126379_12574499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300010373|Ga0134128_11125779 | Not Available | 866 | Open in IMG/M |
| 3300010376|Ga0126381_100024886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 7070 | Open in IMG/M |
| 3300010376|Ga0126381_102265054 | Not Available | 781 | Open in IMG/M |
| 3300010376|Ga0126381_102864227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300010398|Ga0126383_11182033 | Not Available | 855 | Open in IMG/M |
| 3300010398|Ga0126383_12024513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300010399|Ga0134127_12005527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300012096|Ga0137389_10342943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
| 3300012203|Ga0137399_10215204 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300012208|Ga0137376_11677303 | Not Available | 526 | Open in IMG/M |
| 3300012361|Ga0137360_10717889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 858 | Open in IMG/M |
| 3300012362|Ga0137361_10148554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2092 | Open in IMG/M |
| 3300012683|Ga0137398_10641736 | Not Available | 736 | Open in IMG/M |
| 3300012917|Ga0137395_10973872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300012929|Ga0137404_10950416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300012985|Ga0164308_11513569 | Not Available | 616 | Open in IMG/M |
| 3300012988|Ga0164306_11897727 | Not Available | 518 | Open in IMG/M |
| 3300015373|Ga0132257_102744222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300016294|Ga0182041_11007681 | Not Available | 753 | Open in IMG/M |
| 3300016341|Ga0182035_10409674 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1141 | Open in IMG/M |
| 3300016357|Ga0182032_10941436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300016371|Ga0182034_10030308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3370 | Open in IMG/M |
| 3300016371|Ga0182034_10035911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3147 | Open in IMG/M |
| 3300016404|Ga0182037_11555443 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300016422|Ga0182039_10216548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 1538 | Open in IMG/M |
| 3300016445|Ga0182038_11218076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300016445|Ga0182038_11302599 | Not Available | 649 | Open in IMG/M |
| 3300016445|Ga0182038_11856581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300017955|Ga0187817_10528303 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300017966|Ga0187776_10999578 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300017970|Ga0187783_10532160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300018006|Ga0187804_10467648 | Not Available | 564 | Open in IMG/M |
| 3300020579|Ga0210407_10093770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2274 | Open in IMG/M |
| 3300021168|Ga0210406_10415137 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1076 | Open in IMG/M |
| 3300021170|Ga0210400_10230257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1511 | Open in IMG/M |
| 3300021171|Ga0210405_11354567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300021180|Ga0210396_11719589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300021405|Ga0210387_10491775 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300021420|Ga0210394_10366029 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300021432|Ga0210384_11904181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300021476|Ga0187846_10199038 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300021479|Ga0210410_11166185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300021560|Ga0126371_10026210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5423 | Open in IMG/M |
| 3300022508|Ga0222728_1032550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300022708|Ga0242670_1066036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300023046|Ga0233356_1048561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300025931|Ga0207644_11413013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300025938|Ga0207704_10749809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
| 3300026335|Ga0209804_1311123 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300026489|Ga0257160_1026352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300026547|Ga0209156_10381060 | Not Available | 596 | Open in IMG/M |
| 3300027030|Ga0208240_1008960 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300027073|Ga0208366_1033498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300027173|Ga0208097_1039146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300027610|Ga0209528_1137684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300027737|Ga0209038_10229166 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300027874|Ga0209465_10284268 | Not Available | 828 | Open in IMG/M |
| 3300027915|Ga0209069_10829890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300031093|Ga0308197_10024035 | Not Available | 1364 | Open in IMG/M |
| 3300031122|Ga0170822_16651216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300031544|Ga0318534_10254248 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300031545|Ga0318541_10130171 | Not Available | 1371 | Open in IMG/M |
| 3300031546|Ga0318538_10482801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 671 | Open in IMG/M |
| 3300031546|Ga0318538_10624680 | Not Available | 584 | Open in IMG/M |
| 3300031546|Ga0318538_10761654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300031572|Ga0318515_10125088 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1361 | Open in IMG/M |
| 3300031682|Ga0318560_10273368 | Not Available | 909 | Open in IMG/M |
| 3300031708|Ga0310686_104805289 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300031713|Ga0318496_10306098 | Not Available | 877 | Open in IMG/M |
| 3300031719|Ga0306917_10412603 | Not Available | 1055 | Open in IMG/M |
| 3300031719|Ga0306917_10542794 | Not Available | 913 | Open in IMG/M |
| 3300031724|Ga0318500_10279471 | Not Available | 815 | Open in IMG/M |
| 3300031736|Ga0318501_10105037 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1413 | Open in IMG/M |
| 3300031736|Ga0318501_10448269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300031744|Ga0306918_11420524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300031748|Ga0318492_10320813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 808 | Open in IMG/M |
| 3300031753|Ga0307477_10152772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1610 | Open in IMG/M |
| 3300031765|Ga0318554_10296573 | Not Available | 920 | Open in IMG/M |
| 3300031770|Ga0318521_10156815 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1295 | Open in IMG/M |
| 3300031777|Ga0318543_10136398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300031777|Ga0318543_10219623 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300031778|Ga0318498_10148304 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1067 | Open in IMG/M |
| 3300031779|Ga0318566_10186719 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300031781|Ga0318547_10118028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1534 | Open in IMG/M |
| 3300031782|Ga0318552_10054758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1898 | Open in IMG/M |
| 3300031792|Ga0318529_10470579 | Not Available | 585 | Open in IMG/M |
| 3300031794|Ga0318503_10088184 | Not Available | 978 | Open in IMG/M |
| 3300031796|Ga0318576_10025547 | Not Available | 2397 | Open in IMG/M |
| 3300031799|Ga0318565_10608066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300031819|Ga0318568_10064699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2136 | Open in IMG/M |
| 3300031833|Ga0310917_10010406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5066 | Open in IMG/M |
| 3300031835|Ga0318517_10068585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1518 | Open in IMG/M |
| 3300031835|Ga0318517_10102385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 1258 | Open in IMG/M |
| 3300031845|Ga0318511_10267633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300031845|Ga0318511_10458453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300031846|Ga0318512_10554118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300031860|Ga0318495_10124394 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1162 | Open in IMG/M |
| 3300031879|Ga0306919_11043922 | Not Available | 624 | Open in IMG/M |
| 3300031880|Ga0318544_10389277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300031893|Ga0318536_10209534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300031893|Ga0318536_10703742 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031894|Ga0318522_10110927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1020 | Open in IMG/M |
| 3300031894|Ga0318522_10132631 | Not Available | 935 | Open in IMG/M |
| 3300031896|Ga0318551_10412723 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300031896|Ga0318551_10553491 | Not Available | 662 | Open in IMG/M |
| 3300031897|Ga0318520_10752845 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Enoplea → Dorylaimia → Trichinellida → Trichuridae → Trichuris → Trichuris trichiura | 610 | Open in IMG/M |
| 3300031912|Ga0306921_12019457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 613 | Open in IMG/M |
| 3300031941|Ga0310912_10896239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300031945|Ga0310913_11321081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300031946|Ga0310910_10107025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2085 | Open in IMG/M |
| 3300031947|Ga0310909_10071627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2725 | Open in IMG/M |
| 3300031947|Ga0310909_10993715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300031954|Ga0306926_10965029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1017 | Open in IMG/M |
| 3300031954|Ga0306926_12868491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300031959|Ga0318530_10139089 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300031981|Ga0318531_10105660 | Not Available | 1243 | Open in IMG/M |
| 3300032001|Ga0306922_10270036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1828 | Open in IMG/M |
| 3300032001|Ga0306922_11179744 | Not Available | 780 | Open in IMG/M |
| 3300032009|Ga0318563_10098041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1547 | Open in IMG/M |
| 3300032009|Ga0318563_10378324 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300032025|Ga0318507_10156531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300032035|Ga0310911_10273417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 969 | Open in IMG/M |
| 3300032035|Ga0310911_10542514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300032055|Ga0318575_10109321 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1348 | Open in IMG/M |
| 3300032064|Ga0318510_10306077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300032065|Ga0318513_10215174 | Not Available | 927 | Open in IMG/M |
| 3300032065|Ga0318513_10315677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 760 | Open in IMG/M |
| 3300032068|Ga0318553_10623519 | Not Available | 564 | Open in IMG/M |
| 3300032076|Ga0306924_12211981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300032091|Ga0318577_10068541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1622 | Open in IMG/M |
| 3300032261|Ga0306920_101262446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300032782|Ga0335082_11504429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300033289|Ga0310914_10036341 | Not Available | 3972 | Open in IMG/M |
| 3300033290|Ga0318519_11039627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 45.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.25% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26340J50214_100777312 | 3300003368 | Bog Forest Soil | VARERRLDAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLA |
| JGIcombinedJ51221_100094564 | 3300003505 | Forest Soil | VARERRLEARQVEEIFLAFAEAMRELPPDIEAGWLDAQGDLR |
| JGIcombinedJ51221_102477611 | 3300003505 | Forest Soil | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDVEAG |
| Ga0062386_1004679331 | 3300004152 | Bog Forest Soil | VARERRLGAREVEEIFSAFAEAMRELPPDVEAGWLDAQGD |
| Ga0062386_1007181381 | 3300004152 | Bog Forest Soil | VARERRLEARQVEEIFLAFAEAMRELPPDIEAGWLDAQGDLRLAP |
| Ga0062386_1007242171 | 3300004152 | Bog Forest Soil | VARERLLMARQVEEIFLAFAEAMRELPPDIEAGWLDTQGDLRLAP |
| Ga0070739_100884971 | 3300005532 | Surface Soil | VPRERRLNARQVEAIFLAFAEAMRELPPDIEAGWLDEKGDLRLAPDIAQKLRTARR |
| Ga0066704_104028942 | 3300005557 | Soil | MAREKQLSAEQLRQIFLAFAEAMRELPPEIEGGWLDAEGELRLAPDIGRKLRTARN |
| Ga0066700_103660492 | 3300005559 | Soil | VATERRLGAREVEEIFSAFAEAMRELPPDVEAGWL |
| Ga0066670_103201031 | 3300005560 | Soil | VARDRRLGARELEEIFTAFAEIMRELPPDIDAGWLDDQ |
| Ga0066703_108083211 | 3300005568 | Soil | MAAGRGGEVARERRLEAREVEAIFTAFAEAMRELPPDVEAGWLD |
| Ga0066706_113838211 | 3300005598 | Soil | VARERRLGAREVEEIFSAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTA |
| Ga0070762_107336251 | 3300005602 | Soil | MPERGGGVARERRLDAHEVGEIFTAFAEAMRELPPDVEAGWL |
| Ga0070740_101008511 | 3300005607 | Surface Soil | VPRERRLAARQVEAIFLAFAEAMRELPPDIEAGWLDENGDLRLAP |
| Ga0066903_1078944271 | 3300005764 | Tropical Forest Soil | VARERRLEAREVEEIFMAFAEAMRELPPDVEAGWLDAQGDLRL |
| Ga0070766_100677171 | 3300005921 | Soil | MPERGGGVARERRLDAHEVGEIFTAFAEAMRELPPDVEA |
| Ga0070712_1002612393 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VARERRLDAHEVGEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLR |
| Ga0075424_1022059281 | 3300006904 | Populus Rhizosphere | VARERRLDAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDL |
| Ga0126384_112676302 | 3300010046 | Tropical Forest Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAEGNLRLAPDIARKL |
| Ga0126373_112091021 | 3300010048 | Tropical Forest Soil | VAGVARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLR |
| Ga0134063_106377061 | 3300010335 | Grasslands Soil | VARERRLGAREVEEIFSAFAEAMRELPPDVEAGWLD |
| Ga0126372_103384492 | 3300010360 | Tropical Forest Soil | VAGVARERRLGAREVEEIFTAFAEAMRELPPDVDAGWLDAQGDLR |
| Ga0126372_121404162 | 3300010360 | Tropical Forest Soil | VPELARERRLEAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKL |
| Ga0126377_102502691 | 3300010362 | Tropical Forest Soil | MARERRLDAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKL |
| Ga0126379_110286621 | 3300010366 | Tropical Forest Soil | MGPGRGDEVARERRLDAREVEEIFTAFAEAMRELPPDVEAGWL |
| Ga0126379_125744991 | 3300010366 | Tropical Forest Soil | VARERRLGAREVEEIFSAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKL |
| Ga0134128_111257792 | 3300010373 | Terrestrial Soil | LSCAEAGGVARERRLEARDVEAIFREFAEVMRELPPDTEAGWLDS* |
| Ga0126381_1000248865 | 3300010376 | Tropical Forest Soil | VPELARERRLEAREVEEIFTAFAEAMRELPPDVEAGWLDAQGD* |
| Ga0126381_1022650542 | 3300010376 | Tropical Forest Soil | VARERRLEAREVEQIFVAFAEAMRELPPDVEAGWLDAQGDL |
| Ga0126381_1028642271 | 3300010376 | Tropical Forest Soil | VTRERRLGAREVEQIFTALAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRT |
| Ga0126383_111820332 | 3300010398 | Tropical Forest Soil | VPELARERRLEAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTARRV |
| Ga0126383_120245131 | 3300010398 | Tropical Forest Soil | VAGVARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQ |
| Ga0134127_120055272 | 3300010399 | Terrestrial Soil | VARERRLEARDVEAIFRAFAEVMRELPPDTEAGWLDASG |
| Ga0137389_103429431 | 3300012096 | Vadose Zone Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGD |
| Ga0137399_102152041 | 3300012203 | Vadose Zone Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTARRV |
| Ga0137376_116773032 | 3300012208 | Vadose Zone Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGDLRL |
| Ga0137360_107178892 | 3300012361 | Vadose Zone Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIAR |
| Ga0137361_101485541 | 3300012362 | Vadose Zone Soil | VATERRLGAREVEEIFSAFAEAMRELPPDVEAGWLDAQGDL |
| Ga0137398_106417362 | 3300012683 | Vadose Zone Soil | MARERRLEARDVEAIFREFAKVMSELPPDTEAGWL |
| Ga0137395_109738721 | 3300012917 | Vadose Zone Soil | MATERQLNAEQLQRIFLAFAEVMRELPPDIEAGWLDAEGELRLAPD |
| Ga0137404_109504161 | 3300012929 | Vadose Zone Soil | VARERRLEAREVEEIFTAFAEAMRELPPDIEAGWLDAQGDLRLAPDIARK |
| Ga0164308_115135692 | 3300012985 | Soil | VARERRLEARDVEAIFRAFAEAMRELPPDTAAGWLEAS |
| Ga0164306_118977272 | 3300012988 | Soil | VARERRLDAREVGEIFTAFAEAMRELPPDVEAGWL |
| Ga0132257_1027442221 | 3300015373 | Arabidopsis Rhizosphere | VARERRLEAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDL |
| Ga0182041_110076812 | 3300016294 | Soil | VARERRLEAREVEQIFSAFAEAMRELPPDVEAGWLD |
| Ga0182035_104096742 | 3300016341 | Soil | VATERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDAQG |
| Ga0182032_109414362 | 3300016357 | Soil | VARERRLDAREVEEIFTAFAEAMRELPPDIEAGWLDTQGDLRLAPDI |
| Ga0182034_100303081 | 3300016371 | Soil | VARERRLEAREVEEIFAAFAEAMRELPPDVEAGWLDSQGDLRLA |
| Ga0182034_100359115 | 3300016371 | Soil | VARERRLEAREVGAIFAAFAEAMRELPPDVEAGWLDAHGDL |
| Ga0182037_115554431 | 3300016404 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRL |
| Ga0182039_102165481 | 3300016422 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVDAGWLDA |
| Ga0182038_112180762 | 3300016445 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDI |
| Ga0182038_113025992 | 3300016445 | Soil | VATERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTARRV |
| Ga0182038_118565811 | 3300016445 | Soil | VASERRLGARQVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTA |
| Ga0187817_105283031 | 3300017955 | Freshwater Sediment | VATERRLEARQVEEIFLAFAEAMRELPPDIEAGWLDAQ |
| Ga0187776_109995782 | 3300017966 | Tropical Peatland | VPRERRLGARQVEEIFLAFAEAMRELPPDIEAGWLDAQGDLRLAPDIARKLRTAR |
| Ga0187783_105321602 | 3300017970 | Tropical Peatland | VARERQLKAQQLEWIFIAFAEAMRELPPDVEAGWLDAEGELRLAPDIGRKLRTAR |
| Ga0187804_104676482 | 3300018006 | Freshwater Sediment | VARERRLEARDVEAIFRAFAEVMRELPPDTEAGWLD |
| Ga0210407_100937701 | 3300020579 | Soil | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDVEA |
| Ga0210406_104151372 | 3300021168 | Soil | VARERRLGAREVEQIFAAFAEAMRELPPDVEAGWL |
| Ga0210400_102302571 | 3300021170 | Soil | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDAQGDL |
| Ga0210405_113545672 | 3300021171 | Soil | VARERRLEARDVEAIFRAFAEVLRELPPDTEAGFL |
| Ga0210396_117195892 | 3300021180 | Soil | VARERRLGAHEVEQIFAAFAEAMRELPPDIEAGWLDAQGDLRLAPD |
| Ga0210387_104917751 | 3300021405 | Soil | VARERRLDAREVGDIFAAFAEAMRELPPDVEAGWLDAQGDLRL |
| Ga0210394_103660291 | 3300021420 | Soil | VVTERRLAARQVEEIFLAFAEAMRELPPDIDAGWLDAQGDLRLAPDIARKL |
| Ga0210384_119041812 | 3300021432 | Soil | MPERGGGVARERRLDAHEVGEIFTAFAEAMRELPPDVEAGWLDAQGDLRL |
| Ga0187846_101990382 | 3300021476 | Biofilm | VARERRLGAREAEEIFTAFAEAMRELPPDIEAGWLDAEGNLR |
| Ga0210410_111661852 | 3300021479 | Soil | VARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLD |
| Ga0126371_100262103 | 3300021560 | Tropical Forest Soil | VPELARERRLEAREVEEIFTAFAEAMRELPPDVEAGWLDAQGD |
| Ga0222728_10325502 | 3300022508 | Soil | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAP |
| Ga0242670_10660361 | 3300022708 | Soil | VGGVARERRLDAREVGDIFAAFAEAMRELPPDVEAGWLDAQGDLRLA |
| Ga0233356_10485612 | 3300023046 | Soil | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLD |
| Ga0207644_114130131 | 3300025931 | Switchgrass Rhizosphere | VARERRLEARDVEAIFRAFAEVLRELPPDTEAGWLDAEGDL |
| Ga0207704_107498092 | 3300025938 | Miscanthus Rhizosphere | VARERRLEARDVEAIFRAFAEVMRELPPDTEAGWLDASGD |
| Ga0209804_13111231 | 3300026335 | Soil | VAREKRLEARDVEAIFRAFAEVLRELPPDTEAGFL |
| Ga0257160_10263521 | 3300026489 | Soil | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDAQGD |
| Ga0209156_103810601 | 3300026547 | Soil | VATEKRLNAEQLQRIFLEFAEAMRELPPDIEAGWLDAQGELRLAPDVGRK |
| Ga0208240_10089601 | 3300027030 | Forest Soil | MARERRLEARQVEEIFLAFAEAMRELPPDIEAGWLDAQ |
| Ga0208366_10334981 | 3300027073 | Forest Soil | MPERGGGVARERRLDAHEVGEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIA |
| Ga0208097_10391462 | 3300027173 | Forest Soil | MPERGGGVARERRLDAHEVGEIFTAFAEAMRELPPDVEAGWLDA |
| Ga0209528_11376841 | 3300027610 | Forest Soil | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDV |
| Ga0209038_102291662 | 3300027737 | Bog Forest Soil | MVARERRLGAHQVEEIFLAFAEVMRELPPDIEAGWLDEAG |
| Ga0209465_102842682 | 3300027874 | Tropical Forest Soil | MARERRLEAHEVAEIFTAFAEAIRELPPDIEAGWLDAQGDL |
| Ga0209069_108298901 | 3300027915 | Watersheds | MPERGGGVARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDI |
| Ga0308197_100240352 | 3300031093 | Soil | VARERRLDARDVGQIFTAFAEAMSELPPDVEAGWLDAQGDLRLAPDIAR |
| Ga0170822_166512161 | 3300031122 | Forest Soil | VARERRLEARDVEAIFRAFAEVMRELPPDIEAGWLD |
| Ga0318534_102542482 | 3300031544 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDISRKLRT |
| Ga0318541_101301711 | 3300031545 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLD |
| Ga0318538_104828012 | 3300031546 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLD |
| Ga0318538_106246802 | 3300031546 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLR |
| Ga0318538_107616541 | 3300031546 | Soil | VARERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTARRV |
| Ga0318515_101250881 | 3300031572 | Soil | VARERRLGAREVEHIFAAFAEAMRELPPDVEAGWL |
| Ga0318560_102733682 | 3300031682 | Soil | VARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDAQGDLRLASD |
| Ga0310686_1048052892 | 3300031708 | Soil | VARERRLGAGQVEEIFFAFAEAMRELPPDIEAGWLDAQGDLRLA |
| Ga0318496_103060981 | 3300031713 | Soil | VATERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDA |
| Ga0306917_104126031 | 3300031719 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQ |
| Ga0306917_105427941 | 3300031719 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAEGDLRL |
| Ga0318500_102794712 | 3300031724 | Soil | VATERRLGAREVEQIFAAFAEAMRELPPDVEAGWLD |
| Ga0318501_101050372 | 3300031736 | Soil | VARERRLGAREVEHIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARK |
| Ga0318501_104482692 | 3300031736 | Soil | VARERRLEAREVEQIFSAFAEAMRELPPDVEAGWLDAQG |
| Ga0306918_114205241 | 3300031744 | Soil | VARERRLEAREVEQIFSAFAEAMRELPPDVEAGWLDA |
| Ga0318492_103208132 | 3300031748 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPD |
| Ga0307477_101527721 | 3300031753 | Hardwood Forest Soil | VAKERRLEARQVEEIFLAFAEAMRELPPDIEAGWLDAQGDLRLAPDIGRKLRT |
| Ga0318554_102965731 | 3300031765 | Soil | VATERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTAR |
| Ga0318521_101568152 | 3300031770 | Soil | VARERRLEAREVGAIFAAFAEAMRELPPDVEAGWLDAHGDLR |
| Ga0318543_101363981 | 3300031777 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDL |
| Ga0318543_102196231 | 3300031777 | Soil | VARERRLAARQVEEIFLAFAEAMRELPPDIEAGWLDAQGDLRLAPDIARKLRTARRVR |
| Ga0318498_101483041 | 3300031778 | Soil | VATERRLGAREVEEIFAAFAEAMRELPPDVEAGWLD |
| Ga0318566_101867191 | 3300031779 | Soil | VARERRLAARQVEEIFLAFAEAMRELPPDIEAGWL |
| Ga0318547_101180281 | 3300031781 | Soil | VATERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDSQGDLR |
| Ga0318552_100547583 | 3300031782 | Soil | VATERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDSQGDLRLAPD |
| Ga0318529_104705791 | 3300031792 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQG |
| Ga0318503_100881841 | 3300031794 | Soil | VARERRLEAREVEEIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTAR |
| Ga0318576_100255474 | 3300031796 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDA |
| Ga0318565_106080662 | 3300031799 | Soil | VARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDAQ |
| Ga0318568_100646991 | 3300031819 | Soil | VARERRLEAREVGAIFAAFAEAMRELPPDVEAGWLDAHGDLRLAPDIARKLRTARRAIRP |
| Ga0310917_100104061 | 3300031833 | Soil | VARERRLGAREVEHIFAAFAEAMRELPPDVEAGWLDAQG |
| Ga0318517_100685851 | 3300031835 | Soil | VATERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGD |
| Ga0318517_101023852 | 3300031835 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLR |
| Ga0318511_102676331 | 3300031845 | Soil | VARERRLEAREVEEIFMAFAEAMRELPPDVEAGWLDAQGDL |
| Ga0318511_104584531 | 3300031845 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLD |
| Ga0318512_105541182 | 3300031846 | Soil | VATERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLR |
| Ga0318495_101243941 | 3300031860 | Soil | VATERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDSQGDL |
| Ga0306919_110439221 | 3300031879 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTARR |
| Ga0318544_103892771 | 3300031880 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDISRKLR |
| Ga0318536_102095341 | 3300031893 | Soil | VARERRLDAREVEEIFTAFAEAMRELPPDIEAGWLDTQGDLRLAPDIARKLRTA |
| Ga0318536_107037421 | 3300031893 | Soil | VARERRLEAREVGAIFAAFAEAMRELPPDVEAGWLDAHG |
| Ga0318522_101109272 | 3300031894 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVDAGWLDAQGDLRLAPDIARKLR |
| Ga0318522_101326312 | 3300031894 | Soil | VARERRLGAREVEHIFAAFAEAMRELPPDVEAGWLDAQGD |
| Ga0318551_104127231 | 3300031896 | Soil | VARERRLAARQVEEIFLAFAEAMRELPPDIEAGWLDAQG |
| Ga0318551_105534912 | 3300031896 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGCLDA |
| Ga0318520_107528452 | 3300031897 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTAR |
| Ga0306921_120194572 | 3300031912 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVDAGWLDAQGD |
| Ga0310912_108962391 | 3300031941 | Soil | VARERRLRAREVEHIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDI |
| Ga0310913_113210811 | 3300031945 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGD |
| Ga0310910_101070251 | 3300031946 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAEGDLRLAPDIARKL |
| Ga0310909_100716271 | 3300031947 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAP |
| Ga0310909_109937152 | 3300031947 | Soil | VARERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKL |
| Ga0306926_109650291 | 3300031954 | Soil | VARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDA |
| Ga0306926_128684911 | 3300031954 | Soil | VARERRLGAREVEQIFAAFAEAMRELPPDVEAGWLD |
| Ga0318530_101390892 | 3300031959 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDA |
| Ga0318531_101056601 | 3300031981 | Soil | VARERRLGAREVEQIFAAFAEAMRELPPDIEAGWLDAQGDLRLAPD |
| Ga0306922_102700363 | 3300032001 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQ |
| Ga0306922_111797442 | 3300032001 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARK |
| Ga0318563_100980411 | 3300032009 | Soil | VARERRLGAREVEHIFAAFAEAMRELPPDVEAGWLDA |
| Ga0318563_103783242 | 3300032009 | Soil | VARERRLAARQVEEIFLAFAEAMRELPPDIEAGWLDAQGDLRLAH |
| Ga0318507_101565312 | 3300032025 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLR |
| Ga0310911_102734171 | 3300032035 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVDAGWLD |
| Ga0310911_105425141 | 3300032035 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLRTAR |
| Ga0318575_101093212 | 3300032055 | Soil | VATERRLGAREVEEIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIARKLR |
| Ga0318510_103060772 | 3300032064 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLA |
| Ga0318513_102151742 | 3300032065 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPDIAGKLRTA |
| Ga0318513_103156771 | 3300032065 | Soil | VARERRLGAREVEEIFAAFAEAMRELPPDVDAGWLDAQGDLRLA |
| Ga0318553_106235191 | 3300032068 | Soil | VARERRLEAREVEQIFAAFAEAMRELPPDVEVGWLDAQGDLRLAPD |
| Ga0306924_122119811 | 3300032076 | Soil | VARERRLGAREVEEIFTAFAEAMRELPPDVEAGWLDAQGDLRLAPDIA |
| Ga0318577_100685411 | 3300032091 | Soil | VATERRLGAREVEQIFAAFAEAMRELPPDVEAGWLDAQGDLRLAPD |
| Ga0306920_1012624461 | 3300032261 | Soil | VARERRLDAREVGEIFTAFAEAMRELPPDVEAGWLDAQGDLRL |
| Ga0335082_115044292 | 3300032782 | Soil | MARERRLEARQVEAIFRAFAEVMRELPPDTEAGWLDAEG |
| Ga0310914_100363411 | 3300033289 | Soil | VATERRLGAREVEEIFAAFAEAMRELPPDVDAGWLDAQGDLRLAP |
| Ga0318519_110396272 | 3300033290 | Soil | VARERRLEAREVEQIFSAFAEAMRELPPDVEAGWLDAQGD |
| ⦗Top⦘ |