| Basic Information | |
|---|---|
| Family ID | F041321 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKLN |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.25 % |
| % of genes near scaffold ends (potentially truncated) | 98.75 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.250 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.625 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF01694 | Rhomboid | 63.75 |
| PF02887 | PK_C | 5.00 |
| PF00561 | Abhydrolase_1 | 2.50 |
| PF13336 | AcetylCoA_hyd_C | 1.25 |
| PF01546 | Peptidase_M20 | 1.25 |
| PF03572 | Peptidase_S41 | 1.25 |
| PF09286 | Pro-kuma_activ | 1.25 |
| PF00015 | MCPsignal | 0.62 |
| PF01182 | Glucosamine_iso | 0.62 |
| PF01584 | CheW | 0.62 |
| PF13231 | PMT_2 | 0.62 |
| PF04253 | TFR_dimer | 0.62 |
| PF00291 | PALP | 0.62 |
| PF03929 | PepSY_TM | 0.62 |
| PF02897 | Peptidase_S9_N | 0.62 |
| PF06415 | iPGM_N | 0.62 |
| PF08668 | HDOD | 0.62 |
| PF04191 | PEMT | 0.62 |
| PF16870 | OxoGdeHyase_C | 0.62 |
| PF05635 | 23S_rRNA_IVP | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 63.75 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 5.00 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 1.25 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.25 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 1.25 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0696 | Phosphoglycerate mutase (BPG-independent), AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.62 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.62 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.62 |
| COG3182 | PepSY-associated TM region | Function unknown [S] | 0.62 |
| COG3295 | Uncharacterized conserved protein | Function unknown [S] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.25 % |
| Unclassified | root | N/A | 8.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002916|JGI25389J43894_1097713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300004092|Ga0062389_101971414 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata | 761 | Open in IMG/M |
| 3300005179|Ga0066684_10623399 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005330|Ga0070690_101775747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300005332|Ga0066388_101090283 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300005439|Ga0070711_101129804 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005451|Ga0066681_10289853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300005541|Ga0070733_10606919 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005591|Ga0070761_10162400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300005952|Ga0080026_10052479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300006031|Ga0066651_10783280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300006176|Ga0070765_100354759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300006176|Ga0070765_101517680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300006800|Ga0066660_10598385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300007076|Ga0075435_101039967 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300007265|Ga0099794_10100780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1441 | Open in IMG/M |
| 3300007788|Ga0099795_10173511 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300007788|Ga0099795_10306796 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300009038|Ga0099829_11531678 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009088|Ga0099830_10778772 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300009089|Ga0099828_11534651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 587 | Open in IMG/M |
| 3300009090|Ga0099827_10484541 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300009143|Ga0099792_10003716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5969 | Open in IMG/M |
| 3300009143|Ga0099792_10480302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300009143|Ga0099792_10728405 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010159|Ga0099796_10137256 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010358|Ga0126370_12115077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300010358|Ga0126370_12446679 | Not Available | 519 | Open in IMG/M |
| 3300010360|Ga0126372_10859768 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300010361|Ga0126378_11539091 | Not Available | 754 | Open in IMG/M |
| 3300010362|Ga0126377_10582207 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300010376|Ga0126381_104104187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300010379|Ga0136449_102354040 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300011120|Ga0150983_11355544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300011269|Ga0137392_11281751 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300011271|Ga0137393_10208019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300012189|Ga0137388_10387447 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300012189|Ga0137388_10426753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300012189|Ga0137388_10994350 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300012200|Ga0137382_10891567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300012202|Ga0137363_10530795 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300012202|Ga0137363_10531887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300012203|Ga0137399_10110785 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300012203|Ga0137399_10153644 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300012207|Ga0137381_11780110 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012210|Ga0137378_10169563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2027 | Open in IMG/M |
| 3300012211|Ga0137377_11852780 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012349|Ga0137387_10158841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1613 | Open in IMG/M |
| 3300012354|Ga0137366_10462286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300012356|Ga0137371_10778235 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012361|Ga0137360_10012991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5359 | Open in IMG/M |
| 3300012361|Ga0137360_10372056 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300012362|Ga0137361_10890464 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012362|Ga0137361_11137750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300012923|Ga0137359_11656818 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012923|Ga0137359_11677371 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012927|Ga0137416_11150624 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012971|Ga0126369_10492506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1282 | Open in IMG/M |
| 3300012971|Ga0126369_11711729 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012975|Ga0134110_10083469 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300015242|Ga0137412_10271976 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300016270|Ga0182036_10182578 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300016270|Ga0182036_10254058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
| 3300016341|Ga0182035_10055787 | All Organisms → cellular organisms → Bacteria | 2706 | Open in IMG/M |
| 3300016341|Ga0182035_10360578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300016404|Ga0182037_10061738 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300016445|Ga0182038_10143474 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300017928|Ga0187806_1204888 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300018007|Ga0187805_10131978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300018062|Ga0187784_11579899 | Not Available | 519 | Open in IMG/M |
| 3300018086|Ga0187769_10121581 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300019882|Ga0193713_1048509 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300019888|Ga0193751_1123312 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300020140|Ga0179590_1208917 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300020170|Ga0179594_10027683 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300020199|Ga0179592_10256732 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300020199|Ga0179592_10265152 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300020199|Ga0179592_10426902 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300020579|Ga0210407_11446464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300020581|Ga0210399_10129295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2078 | Open in IMG/M |
| 3300020583|Ga0210401_10873516 | Not Available | 758 | Open in IMG/M |
| 3300021180|Ga0210396_10073728 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300021180|Ga0210396_11142319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300021404|Ga0210389_11230992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300021405|Ga0210387_10419494 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300021405|Ga0210387_11488272 | Not Available | 580 | Open in IMG/M |
| 3300021405|Ga0210387_11803936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021406|Ga0210386_10857487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300021474|Ga0210390_10218396 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300021475|Ga0210392_10949647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300021477|Ga0210398_10115139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 2184 | Open in IMG/M |
| 3300021478|Ga0210402_11711940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300021479|Ga0210410_10923862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300021559|Ga0210409_11635355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300021560|Ga0126371_11999767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300022532|Ga0242655_10225219 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300022726|Ga0242654_10322476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300024330|Ga0137417_1293590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300024331|Ga0247668_1008590 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300024331|Ga0247668_1018199 | Not Available | 1453 | Open in IMG/M |
| 3300025326|Ga0209342_10141783 | Not Available | 2184 | Open in IMG/M |
| 3300025898|Ga0207692_10166387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300025898|Ga0207692_10826321 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300025900|Ga0207710_10544547 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300025905|Ga0207685_10242692 | Not Available | 867 | Open in IMG/M |
| 3300025905|Ga0207685_10500576 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025906|Ga0207699_10494321 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300025918|Ga0207662_11110753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300026041|Ga0207639_12274684 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026304|Ga0209240_1016361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2829 | Open in IMG/M |
| 3300026323|Ga0209472_1034705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2277 | Open in IMG/M |
| 3300026330|Ga0209473_1112568 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300026374|Ga0257146_1024490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300026490|Ga0257153_1093352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300026542|Ga0209805_1193935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300026550|Ga0209474_10004372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12225 | Open in IMG/M |
| 3300026557|Ga0179587_10067307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2100 | Open in IMG/M |
| 3300026557|Ga0179587_10616967 | Not Available | 714 | Open in IMG/M |
| 3300026557|Ga0179587_11197168 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027326|Ga0209731_1056538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300027610|Ga0209528_1107470 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300027651|Ga0209217_1099753 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300027667|Ga0209009_1170331 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027727|Ga0209328_10056337 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300027773|Ga0209810_1330070 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027835|Ga0209515_10449233 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027862|Ga0209701_10164668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1345 | Open in IMG/M |
| 3300027862|Ga0209701_10232007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300027862|Ga0209701_10667019 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027882|Ga0209590_10374368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300027903|Ga0209488_10355758 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300028047|Ga0209526_10158793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1581 | Open in IMG/M |
| 3300028138|Ga0247684_1042600 | Not Available | 729 | Open in IMG/M |
| 3300028776|Ga0302303_10309448 | Not Available | 531 | Open in IMG/M |
| 3300028906|Ga0308309_10356626 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300028906|Ga0308309_11110564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300029636|Ga0222749_10088955 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300029636|Ga0222749_10093656 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300030042|Ga0302300_1007669 | All Organisms → cellular organisms → Bacteria | 4655 | Open in IMG/M |
| 3300030053|Ga0302177_10648933 | Not Available | 536 | Open in IMG/M |
| 3300031057|Ga0170834_108912904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300031128|Ga0170823_10966959 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031128|Ga0170823_15146966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300031128|Ga0170823_16194665 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031525|Ga0302326_10026725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11655 | Open in IMG/M |
| 3300031668|Ga0318542_10029277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2356 | Open in IMG/M |
| 3300031681|Ga0318572_10709534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300031681|Ga0318572_10715168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300031820|Ga0307473_10522457 | Not Available | 805 | Open in IMG/M |
| 3300031823|Ga0307478_11456763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300031879|Ga0306919_10088661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2150 | Open in IMG/M |
| 3300031962|Ga0307479_10292698 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300031962|Ga0307479_10719556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300032205|Ga0307472_100643944 | Not Available | 943 | Open in IMG/M |
| 3300032205|Ga0307472_101286969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300032205|Ga0307472_102133340 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300032782|Ga0335082_11338500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300033289|Ga0310914_10040817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3778 | Open in IMG/M |
| 3300033290|Ga0318519_10693000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300034178|Ga0364934_0038604 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.25% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.62% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.62% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25389J43894_10977131 | 3300002916 | Grasslands Soil | VLALPWRADLFAFGPKLMGPLATSNLFGVLMFTLLAASLFYFGRKKLN* |
| Ga0062389_1019714141 | 3300004092 | Bog Forest Soil | DLFAFGPKIMGSLATNNLFGAFMFLLLAGTLFYFARKKLD* |
| Ga0066684_106233991 | 3300005179 | Soil | WVTTVLRLPWRADLFAFGPKMFGPLATSNLFGLIMFLALAASLFYFARKKLD* |
| Ga0070690_1017757471 | 3300005330 | Switchgrass Rhizosphere | ASMLRLPWSPDLFAFGPKLFGSWATNNFFGLSMFILLAASLFYFARKKLD* |
| Ga0066388_1010902833 | 3300005332 | Tropical Forest Soil | WMVSVLRLPWRADLFSIGPKFWPNLANNNTLAVVMFVLLSASLFHFARKKLD* |
| Ga0070711_1011298042 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RLPWSPDLFAFGPKLFGSWATNNFFGLSMFILLAASLFYFARKKLD* |
| Ga0066681_102898531 | 3300005451 | Soil | GLPWRADLFAFGPKLMGPLATSNLFGTFMFALLAASLFYFARKKLN* |
| Ga0070733_106069192 | 3300005541 | Surface Soil | GPKILGSLATSNLFGVVMFSMLAASLFYFARKKLD* |
| Ga0070761_101624001 | 3300005591 | Soil | FAAALRLPWRPELFSFGPKIMGSLATSNLFGAFMFLILAGSLFYFARKKLD* |
| Ga0080026_100524792 | 3300005952 | Permafrost Soil | FASMLRLPWRADLFAFGPKLFGPLANSNLFGLIMFILLSGSLFYFARKKLD* |
| Ga0066651_107832802 | 3300006031 | Soil | PKVMGPLATSNLFGVFMFALLAASLFYFARKKLN* |
| Ga0070765_1003547591 | 3300006176 | Soil | FSWSLRLPWRPDLFSFGPKLLGPLATNNFFGLVMFLLLAASLFYFARKKLD* |
| Ga0070765_1015176802 | 3300006176 | Soil | LRLPWNPDTIAFGPRLFGSWATNNAFGLIMFILLAASLFYFARKKLD* |
| Ga0066660_105983851 | 3300006800 | Soil | WRADLFAFGPKLMGPLATSNLFGTFMFALLAASLFYFARKKLN* |
| Ga0075435_1010399671 | 3300007076 | Populus Rhizosphere | FGPKMFGPLATSNLFGLIMFLALAASLFYFARKKLD* |
| Ga0099794_101007801 | 3300007265 | Vadose Zone Soil | SALRLPWRADLFAYGPKLLGPLATSNLFGIFMFALLAASLFYFARKKLN* |
| Ga0099795_101735111 | 3300007788 | Vadose Zone Soil | DLFSFGPKLFGPLATSNLFGITMFALLAASLFYFARKKLD* |
| Ga0099795_103067962 | 3300007788 | Vadose Zone Soil | FGPKLLGSLATSNLFATIMFALLCASLFYFARKKLD* |
| Ga0099829_115316782 | 3300009038 | Vadose Zone Soil | WLTSVLRLPWRPDLFSFGPKLMGPLATSNLFGVFMFALLAASLFYFARKKLS* |
| Ga0099830_107787722 | 3300009088 | Vadose Zone Soil | FAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKL* |
| Ga0099828_115346512 | 3300009089 | Vadose Zone Soil | DLFAFGPRIFGSLATSNLFGLFMFILLAASLFYFARKKLN* |
| Ga0099827_104845411 | 3300009090 | Vadose Zone Soil | LRLPWRPDLFSFGPKLMGPLATSNLFGTFMFALLAASLFYFARKKLG* |
| Ga0099792_100037161 | 3300009143 | Vadose Zone Soil | SLRLPWRPDLFAFGPKIFGHLATSNLFGVFMFLMLGASVFYFARKKLD* |
| Ga0099792_104803022 | 3300009143 | Vadose Zone Soil | TSALGLPWRADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKLN* |
| Ga0099792_107284052 | 3300009143 | Vadose Zone Soil | AFGPKIFGHLATSNLFGVFMFLMLGASVFYFARKKLD* |
| Ga0099796_101372561 | 3300010159 | Vadose Zone Soil | PDLFAFGPKIFGHLATSNLFGVFMFLMLGASVFYFARKKLD* |
| Ga0126370_121150772 | 3300010358 | Tropical Forest Soil | PKVFGSLATSNAFGIVMFVVLIISLFYFGRKKLD* |
| Ga0126370_124466791 | 3300010358 | Tropical Forest Soil | LFSFGPKVFGSLATSNAFGIVMFVVLIASLFYFGRKKLD* |
| Ga0126372_108597682 | 3300010360 | Tropical Forest Soil | WRADLFAFGPKILGPLATSNLFGLIMFLVLAGSLFYFARKKLD* |
| Ga0126378_115390911 | 3300010361 | Tropical Forest Soil | LPWRPDLFSFGPKLLGSLATNNLFGLIMFLLLAASLFHFARRKLD* |
| Ga0126377_105822071 | 3300010362 | Tropical Forest Soil | GPKIMGSLATSNLFGIFMFAVLSASLFYFARKKLN* |
| Ga0126381_1041041872 | 3300010376 | Tropical Forest Soil | LPWRADLFSFGPQIMGPLATSNLFGVFMFVLLAASLFYFARKKL* |
| Ga0136449_1023540402 | 3300010379 | Peatlands Soil | WVTAVFRLPWPADLFSFGPKIMGPLATSNLFGIFMFALLGASLFYFARKKLR* |
| Ga0150983_113555442 | 3300011120 | Forest Soil | LFSFGPKIMGSLATNNLFGIFMFALLAASLFYFARKKLN* |
| Ga0137392_112817512 | 3300011269 | Vadose Zone Soil | LQLPWRPDLFAFGPKLMGPLATSSLFGIFMFALLAASLFYFARKKLN* |
| Ga0137393_102080192 | 3300011271 | Vadose Zone Soil | RADLFAYGPKLLGPLATSNLFGIFMFALLAASLFYFARKKLN* |
| Ga0137388_103874472 | 3300012189 | Vadose Zone Soil | FSSLLGLPWRADLFSFGPKIMGPLATSNLFGIFMFALLAASLFYFARKKLN* |
| Ga0137388_104267531 | 3300012189 | Vadose Zone Soil | SILRLPWRPDLFSFGPKIFGSLATSNLFGMIMFVLLAASLFYFARKKLN* |
| Ga0137388_109943502 | 3300012189 | Vadose Zone Soil | SVLRLPWRPDLFSFGPKLMGPLATSNLFGVFMFALLAASLFYFARKKLS* |
| Ga0137382_108915672 | 3300012200 | Vadose Zone Soil | FGPKVMGPLATSNLFGVFMFALLAASLFYFARKKLN* |
| Ga0137363_105307951 | 3300012202 | Vadose Zone Soil | RADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKL* |
| Ga0137363_105318871 | 3300012202 | Vadose Zone Soil | RADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKLN* |
| Ga0137399_101107853 | 3300012203 | Vadose Zone Soil | WRADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKLN* |
| Ga0137399_101536443 | 3300012203 | Vadose Zone Soil | WLTATLRLPWRGDLFAYGPKLLGPLATNNLFGIFMFALLAASLFYFARKKLD* |
| Ga0137381_117801101 | 3300012207 | Vadose Zone Soil | AFGPKILGPLATNNLFGVFMFLMLAASLFHFARKKLD* |
| Ga0137378_101695631 | 3300012210 | Vadose Zone Soil | PKIFGHLAASNLFGVFMFLMLGASVFYFARKKLD* |
| Ga0137377_118527802 | 3300012211 | Vadose Zone Soil | ADLFAFGPKMFGPLATSNLFGLIMFLALAASLFYFARKKLD* |
| Ga0137387_101588413 | 3300012349 | Vadose Zone Soil | FAFGPQLMGPLATSNLFGIFMFALLAASLFYFARKKLN* |
| Ga0137366_104622861 | 3300012354 | Vadose Zone Soil | PWRPDLFSFGPKLMGPLATSNLFGTFMFALLAASLFYFARKKLG* |
| Ga0137371_107782352 | 3300012356 | Vadose Zone Soil | PDLFSFGPKVLGPLGTDSLFGVFMVLMLAASLFYFARKKLD* |
| Ga0137360_100129915 | 3300012361 | Vadose Zone Soil | GPKLLGPLATSNLFGIFMFALLAASLFYFARKKLD* |
| Ga0137360_103720563 | 3300012361 | Vadose Zone Soil | WSPDAFAFGPKLFGSWATNNFFGLVMFALLAASLFYFARKKLD* |
| Ga0137361_108904641 | 3300012362 | Vadose Zone Soil | DLFSFGPKLFGSLATNNLFGIIMFALLAASLFYFARKKLD* |
| Ga0137361_111377502 | 3300012362 | Vadose Zone Soil | SLLALPWRADLFAFGPKVMGPLATSNLFGVFMFALLAASLFYFARKKLN* |
| Ga0137359_116568181 | 3300012923 | Vadose Zone Soil | ADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKL* |
| Ga0137359_116773711 | 3300012923 | Vadose Zone Soil | GPKIMGPLATSNLFGIFMFALLATSLFYFARKKLN* |
| Ga0137416_111506241 | 3300012927 | Vadose Zone Soil | AFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKL* |
| Ga0126369_104925063 | 3300012971 | Tropical Forest Soil | FGPKLLGSLATSNLFGLVMFLLLAASLFYFARKKLG* |
| Ga0126369_117117292 | 3300012971 | Tropical Forest Soil | RADLFSFGPKVFGSLATSNAFGIVMFVVLIASLFYFGRKKLD* |
| Ga0134110_100834693 | 3300012975 | Grasslands Soil | DLFAFGPKMFGPLATSNLFGLIMFMALAASLFYFARKKLD* |
| Ga0137412_102719763 | 3300015242 | Vadose Zone Soil | FGPKLMGSLATNNLFGIFMFALLAASLFYFARKKLN* |
| Ga0182036_101825781 | 3300016270 | Soil | IGPKVLGSLAQNNLFGLIMFLFLGATLFHFARKKLD |
| Ga0182036_102540583 | 3300016270 | Soil | SAVLRLPWRPDLFTFGPKLMGPLATSNLFGALMFVLLAGSLFFFARKKLA |
| Ga0182035_100557871 | 3300016341 | Soil | RLPWRADLFSFGPKILGPLATSNLFGLIMFLVLAGSLFYFARKKLD |
| Ga0182035_103605781 | 3300016341 | Soil | PDLFSFGPKLMGPLAASNLFGALVFVLLAGSLFFFGRKKLD |
| Ga0182037_100617383 | 3300016404 | Soil | FSFGPKLLGSLATNNLFGLIMFLLLAASLFHFARKKLD |
| Ga0182038_101434743 | 3300016445 | Soil | AIGPKVLGSLAQNNLFGLIMFLFLGATLFHFARKKLD |
| Ga0187806_12048881 | 3300017928 | Freshwater Sediment | HWLSVVLRLPWRPDLFSFGPKLLGPLASSNLFGVFMFLLLSASLFYFARKKLD |
| Ga0187805_101319783 | 3300018007 | Freshwater Sediment | FGPKLLGSFATSNLAGLIMFLLLAASLFYFARKKLG |
| Ga0187784_115798992 | 3300018062 | Tropical Peatland | GPKTLGEFAASSWAGVLMFVLLATSLFAFARKRLE |
| Ga0187769_101215812 | 3300018086 | Tropical Peatland | LRWRADLVAFGPKLMGPLATSNLFGVFMFVLLAGSPFYFARKKLD |
| Ga0193713_10485092 | 3300019882 | Soil | GPKIFGSLATSNLFGVFMFLMLGASVFYFARKKLD |
| Ga0193751_11233121 | 3300019888 | Soil | LFAFGPKIFGSLATSNIFGVFMFLMLGASVFYFARKKLD |
| Ga0179590_12089172 | 3300020140 | Vadose Zone Soil | RLPWRPDLFAFGPKIFGSLATSNLFGVFMFLMLGASVFYFARKKLD |
| Ga0179594_100276831 | 3300020170 | Vadose Zone Soil | TSALGLPWRADLFAFGPKLMGPLATSSLFGIFMFALLAASLFYFARKKLD |
| Ga0179592_102567322 | 3300020199 | Vadose Zone Soil | WRADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKL |
| Ga0179592_102651522 | 3300020199 | Vadose Zone Soil | SDLFAFGPKLMGSLATSNLFGIFMFALLGGSLFYFARKKLD |
| Ga0179592_104269022 | 3300020199 | Vadose Zone Soil | LPWRPDLFAFGPKIFGHLATSNLFGVFMFLMLGASVFYFARKKLD |
| Ga0210407_114464641 | 3300020579 | Soil | AIGPKILGGLATNNLFGAFMFVVLAGSLFYFARKKLD |
| Ga0210399_101292953 | 3300020581 | Soil | FAFGPKLLGSLATSNLFGLVMFLLLAASLFYFARKKLS |
| Ga0210401_108735161 | 3300020583 | Soil | AGALHLPWRADLFSFGPKLVGSLANNNLFAVFMFLLLCASLFYFARKKLD |
| Ga0210396_100737281 | 3300021180 | Soil | VLRLPWRPDLFSFGPKLLGPLATSNLFGAAMFLLLAGSLFYFARKKLD |
| Ga0210396_111423192 | 3300021180 | Soil | AIGSKILGGLATNNLFGAFMFVVLAGSLFYFARKKLD |
| Ga0210389_112309921 | 3300021404 | Soil | AFGPKILGPLAVSNLFGVIMFLALAASLFYFARKKLD |
| Ga0210387_104194942 | 3300021405 | Soil | WVTSVFRLPWPADLFSFGPKIMGPLATSNLFGIFMFALLGAALFYFARKKLD |
| Ga0210387_114882722 | 3300021405 | Soil | GPKLLGPLATSNLFGAFMFLLLAGSLFHFARKKLD |
| Ga0210387_118039361 | 3300021405 | Soil | RLPWNPDTIAFGPKLFGSWATNNAFGLIMFIALAASLFYFARKKLD |
| Ga0210386_108574871 | 3300021406 | Soil | LPWRPDLFSFGPKILGSLATSNLFGLFMFMLLAGSLFYFARKKLS |
| Ga0210390_102183963 | 3300021474 | Soil | WRPDLFSFGPKFMGSLATSNLFGIFMFALLGASLFYFARKKLN |
| Ga0210392_109496471 | 3300021475 | Soil | RLPWRPDLFAFGPKLLGSLATSNLFGLVMFLLLAASLFYFARKKLS |
| Ga0210398_101151391 | 3300021477 | Soil | ILRLPWRPDLFSFGPKVLGSLATNNLFGLIMFLLLATSLFYFARKKLD |
| Ga0210402_117119402 | 3300021478 | Soil | SFGPKIMGPLAISNLFGIFMFALLAGSLFYFARKKLN |
| Ga0210410_109238621 | 3300021479 | Soil | LFAFGPKLLGSLATSNLFGLVMFLLLAASLFYFARKKLS |
| Ga0210409_116353551 | 3300021559 | Soil | WRPDLFSFGPKLLGPLATNNLFGSVMFLLLAASLFYFARKKLD |
| Ga0126371_119997672 | 3300021560 | Tropical Forest Soil | TFGPKLMGPLATSNLFGALMFVLLAGSLFFFARKKLA |
| Ga0242655_102252192 | 3300022532 | Soil | PYGSSIYAFGTRLSTSNLFGIFMFALLAGSLFYFARKKLD |
| Ga0242654_103224761 | 3300022726 | Soil | FSFGPKIMGPLATSNLFGIFMFALLGASLFYFARKKLS |
| Ga0137417_12935902 | 3300024330 | Vadose Zone Soil | PWRADLFAFGPKVMGPLATSNLFGVFMFTLLAASLFYFARKKLN |
| Ga0247668_10085901 | 3300024331 | Soil | FSFGPKLFGPLATNNLFGIFMFALLGGSLFYFARKKLDS |
| Ga0247668_10181992 | 3300024331 | Soil | VLRLPWRPDLFSFGPKLMGPLATSNLFGIFMFALLGGSLFYFARKKLD |
| Ga0209342_101417834 | 3300025326 | Soil | GPKIFGALTTSNLFAVGMFLLLAGAQYYFARKKLD |
| Ga0207692_101663871 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LFSFGPKLLGSLATNNLFGLIMFLLLAGSLFHFARKKLD |
| Ga0207692_108263213 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ALGPKLLGSLATSNIFGMVMFLLLAASLFYFARKKLG |
| Ga0207710_105445472 | 3300025900 | Switchgrass Rhizosphere | FGPKLFGSWATNNFFGLSMFILLAASLFYFARKKLD |
| Ga0207685_102426921 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | FGSKLLGSLATNNLFGLIMFLLLAGSLFHFARKKLD |
| Ga0207685_105005762 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SFGPKLFGPLATSNLFGIIMFALLATSLFYFARKKLD |
| Ga0207699_104943212 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LPWSPDLFAFGPKLFGSWATNNFFGLSMFILLAASLFYFARKKLD |
| Ga0207662_111107531 | 3300025918 | Switchgrass Rhizosphere | MLRLPWSPDLFAFGPKLFGSWATNNFFGLSMFILLAASLFYFARKKLD |
| Ga0207639_122746842 | 3300026041 | Corn Rhizosphere | GPKLFGSWATNNFFGLSMFILLAASLFYFARKKLD |
| Ga0209240_10163613 | 3300026304 | Grasslands Soil | PWRADFFAFGPKIMGPLATSNLFGIFMFALLAASLFYFARKKLN |
| Ga0209472_10347053 | 3300026323 | Soil | LPWRADLFAFGPKLMGPLATSNLFGTFMFALLAASLFYFARKKLN |
| Ga0209473_11125682 | 3300026330 | Soil | TAVLGLPWRADLLAFGPKVLGPLATSNLLGLIMFLALAGSLFYFARKKLD |
| Ga0257146_10244902 | 3300026374 | Soil | LLRLPWRADLFAFGPKFMGHLATSNLFGIFMFALLGASLFYFARKKLD |
| Ga0257153_10933521 | 3300026490 | Soil | PDLFAFGPKLLGSLATSNMFGLVMFLLLAASLFYFARKKLS |
| Ga0209805_11939351 | 3300026542 | Soil | FSFGPKLMGPLATSNLFGVFMFALLAGSLFYFARKKLD |
| Ga0209474_100043721 | 3300026550 | Soil | ADLFAFGPKMFGPLATSNLFGLIMFLALAASLFYFARKKLD |
| Ga0179587_100673073 | 3300026557 | Vadose Zone Soil | WRADLFAFGPKLMGPLATSNLFGIFMFALLAGSLFYFARKKLN |
| Ga0179587_106169672 | 3300026557 | Vadose Zone Soil | FSFGPKLFGSLATNNLFGITMFALLAASLFYFARKKLD |
| Ga0179587_111971682 | 3300026557 | Vadose Zone Soil | LPWRADLFAFGPQLMGSLATNNLFGIFMFALLAASLFYFARKKLN |
| Ga0209731_10565382 | 3300027326 | Forest Soil | RADLFAFGPKFMGPFATSNLFGVFMFALLAASLFYFARKKLD |
| Ga0209528_11074702 | 3300027610 | Forest Soil | HWFSWSLQLPWRPDLFSFGPKLLGPLATSNPFGLLMFVLLATSLFYFARKKLT |
| Ga0209217_10997532 | 3300027651 | Forest Soil | DLFAFGPKLLGPFATSNLAGIIMFALLAASLFYFARKKLD |
| Ga0209009_11703311 | 3300027667 | Forest Soil | GPKLMGPLATSNLFGIFMFALLAASLFYFARKKLD |
| Ga0209328_100563371 | 3300027727 | Forest Soil | FSFGPKLLGPLATSNPFGLLMFVLLATSLFYFARKKLT |
| Ga0209810_13300702 | 3300027773 | Surface Soil | AFGPRILGTSLTQGNLLGVVMFLLLAGSLFYFARKKLN |
| Ga0209515_104492331 | 3300027835 | Groundwater | LPLPKDLFEFNPEMLHSLPKNNLFGIIMFAVLAASLFYFARKKLN |
| Ga0209701_101646681 | 3300027862 | Vadose Zone Soil | ALPWRADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKLN |
| Ga0209701_102320071 | 3300027862 | Vadose Zone Soil | ADLFAYGPKLLGPLATSNLFGIFMFALLAASLFYFARKKLN |
| Ga0209701_106670191 | 3300027862 | Vadose Zone Soil | AFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKL |
| Ga0209590_103743681 | 3300027882 | Vadose Zone Soil | RLPWRPDLFSFGPKLMGPLATSNLFGTFMFALLAASLFYFARKKLG |
| Ga0209488_103557582 | 3300027903 | Vadose Zone Soil | FGPKIMGPLATSNLFGIFMFALLAASLFYFARKKLD |
| Ga0209526_101587931 | 3300028047 | Forest Soil | PDLFAFGPKLLGSLATSNLFGLVMFLLLAASLFYFARKKLS |
| Ga0247684_10426001 | 3300028138 | Soil | RPDLFSFGPKLFGNLATNNLFGIFMFALLGGSLFYFARKKLDS |
| Ga0302303_103094481 | 3300028776 | Palsa | GPKILGSLATSNLFGLFMFILLAASLFYFARKKLNKT |
| Ga0308309_103566262 | 3300028906 | Soil | FGPKLLGSLATNNFVGLVMFLLLAASLFYFARKQLD |
| Ga0308309_111105641 | 3300028906 | Soil | LPWNPDTIAFGPKLFGSWATNNAFGLIMFLLLAASLFYFARKKLD |
| Ga0222749_100889553 | 3300029636 | Soil | GLPWRADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKLN |
| Ga0222749_100936563 | 3300029636 | Soil | SSVLRLPWRPDLFSFGPKILGSLATSNLFGLFMFMLLAGSLFYFARKKLS |
| Ga0302300_10076691 | 3300030042 | Palsa | AFGPKILGSLATSNLFGLFMFILLAASLFYFARKKLNKT |
| Ga0302177_106489332 | 3300030053 | Palsa | KILGSLATSNLFGLFMFILLAASLFYFARKKLNKT |
| Ga0170834_1089129042 | 3300031057 | Forest Soil | PWRPDLFAFGPKVLGSLATSNLFGLVMFLLLAASLFYFARKKLS |
| Ga0170823_109669591 | 3300031128 | Forest Soil | WRPDLFAFGPKIFGHLATSNLFGVFMFLMLGASVFYFARKKLD |
| Ga0170823_151469661 | 3300031128 | Forest Soil | DTIAFGPKLFGSWATNNAFGLIMFLLLAASLFYFARKKLD |
| Ga0170823_161946652 | 3300031128 | Forest Soil | PWRPDLFAFGPKIFGHLATSNLFGVFMFLMLGASVFYFARKKLA |
| Ga0302326_100267251 | 3300031525 | Palsa | WFAAILHLPWRADLFAFGPKILGPLATSNLFGLIIFLALAGSLFYFARKKLD |
| Ga0318542_100292771 | 3300031668 | Soil | GLPWRADLFAFGPKVLGPLSTSNLLGLIMFLILAGSLFYFARKKLD |
| Ga0318572_107095341 | 3300031681 | Soil | RPDLFSFGPKLMGPLAASNLFGALVFVLLAGSLFFFGRKKLD |
| Ga0318572_107151681 | 3300031681 | Soil | FAALVRLPWRADLFSFGPKIMGPLAVSNVFGAFMFLVLAGSLFFFARKKLD |
| Ga0307473_105224571 | 3300031820 | Hardwood Forest Soil | FAFGPKILGSLATSNLFGLFMFILLAASLFHFARKKLN |
| Ga0307478_114567631 | 3300031823 | Hardwood Forest Soil | FRLPWRPDLFAFGPKLLGSLATSNLFGLVMFLLLAVSLFYFARKKLS |
| Ga0306919_100886613 | 3300031879 | Soil | LSAVLRLPWRPDLFTFGPKLMGPLATSNLFGALMFVLLAGSLFFFARKKLA |
| Ga0307479_102926981 | 3300031962 | Hardwood Forest Soil | ADLFAFGPKLLGPLATSNLFGVFMFVLLSASLFYFARKKLD |
| Ga0307479_107195562 | 3300031962 | Hardwood Forest Soil | ALGLPWRADLFAFGPKLMGPLATSNLFGIFMFALLAASLFYFARKKLN |
| Ga0307472_1006439441 | 3300032205 | Hardwood Forest Soil | LRVPWRADLFSFGPKLMGSLATNNLFGIFMFAVLAGSLFYFARKKLD |
| Ga0307472_1012869691 | 3300032205 | Hardwood Forest Soil | FAFGPKVMGPLATSNLFGVFMFALLAASLFYFARKKLN |
| Ga0307472_1021333403 | 3300032205 | Hardwood Forest Soil | RRLPWSPDLFAFGPKLFGSWATNNAFGLCMFILLATSLFYFARKKLD |
| Ga0335082_113385001 | 3300032782 | Soil | GPKILGPLASSNLFGTFMFVLLAGSLFHFARKKLD |
| Ga0310914_100408171 | 3300033289 | Soil | FGPKLLGSLATSNLFGLVMFLLLAASLFYFARKKLG |
| Ga0318519_106930001 | 3300033290 | Soil | RPDLFTFGPKLMGPLATSNLFGALMFVLLAGSLFFFARKKLA |
| Ga0364934_0038604_1_114 | 3300034178 | Sediment | FGPKLLGQTLANSNLFGLIMFLILAASLFVFARKKLD |
| ⦗Top⦘ |