NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041290

Metagenome / Metatranscriptome Family F041290

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041290
Family Type Metagenome / Metatranscriptome
Number of Sequences 160
Average Sequence Length 42 residues
Representative Sequence MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNK
Number of Associated Samples 132
Number of Associated Scaffolds 160

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.38 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.62 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.750 % of family members)
Environment Ontology (ENVO) Unclassified
(43.750 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.375 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.94%    β-sheet: 0.00%    Coil/Unstructured: 47.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 160 Family Scaffolds
PF01478Peptidase_A24 94.38
PF04964Flp_Fap 2.50
PF01642MM_CoA_mutase 0.62
PF01584CheW 0.62
PF02954HTH_8 0.62
PF04140ICMT 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 160 Family Scaffolds
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 2.50
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.62

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_13367994All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104396131All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300000789|JGI1027J11758_11180676All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300001431|F14TB_105378213All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300002075|JGI24738J21930_10148839All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300004157|Ga0062590_100535959All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300004798|Ga0058859_11826293All Organisms → cellular organisms → Bacteria → Acidobacteria1438Open in IMG/M
3300005186|Ga0066676_11037608All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300005289|Ga0065704_10137398All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300005336|Ga0070680_101135435All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300005344|Ga0070661_100827554All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300005364|Ga0070673_101976552All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300005440|Ga0070705_100884848All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300005444|Ga0070694_100316697All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300005457|Ga0070662_100693967All Organisms → cellular organisms → Bacteria → Acidobacteria861Open in IMG/M
3300005457|Ga0070662_101322146All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300005471|Ga0070698_101406802All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300005545|Ga0070695_100623764All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300005545|Ga0070695_101731308All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300005564|Ga0070664_100572764All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300005578|Ga0068854_100588016All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300005719|Ga0068861_100255208All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300005842|Ga0068858_102521513All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300005842|Ga0068858_102563658All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300006046|Ga0066652_101773811All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300006196|Ga0075422_10622001All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300006847|Ga0075431_100240509All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus1842Open in IMG/M
3300006854|Ga0075425_100673342All Organisms → cellular organisms → Bacteria → Proteobacteria1189Open in IMG/M
3300006881|Ga0068865_101069037All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300006954|Ga0079219_10576765All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300006954|Ga0079219_11138872All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300007004|Ga0079218_12135770All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300009101|Ga0105247_10640850All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300009156|Ga0111538_10976977All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300009162|Ga0075423_11429992All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300009162|Ga0075423_11663084All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300009174|Ga0105241_10687062All Organisms → cellular organisms → Bacteria → Acidobacteria933Open in IMG/M
3300009174|Ga0105241_10778655All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300009177|Ga0105248_10507898All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300009177|Ga0105248_11595388All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300009545|Ga0105237_12490551All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300009553|Ga0105249_11939801All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300009610|Ga0105340_1241369All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300009789|Ga0126307_11357096All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium576Open in IMG/M
3300009840|Ga0126313_10747636All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300010043|Ga0126380_11968925All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300010044|Ga0126310_10441612All Organisms → cellular organisms → Bacteria → Acidobacteria937Open in IMG/M
3300010044|Ga0126310_11340602All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300010047|Ga0126382_10383211All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300010146|Ga0126320_1012517All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300010147|Ga0126319_1652792All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300010166|Ga0126306_11098178All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300010396|Ga0134126_13054176All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300010400|Ga0134122_10071878All Organisms → cellular organisms → Bacteria2690Open in IMG/M
3300010400|Ga0134122_10849314All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300010400|Ga0134122_12355658All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300010401|Ga0134121_10843554All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300010403|Ga0134123_10714820All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300011270|Ga0137391_11035018All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300011414|Ga0137442_1045895All Organisms → cellular organisms → Bacteria → Acidobacteria869Open in IMG/M
3300012010|Ga0120118_1090121All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300012202|Ga0137363_10994560All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300012208|Ga0137376_11770461All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300012359|Ga0137385_11170056All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300012474|Ga0157356_1004343All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300012501|Ga0157351_1001495All Organisms → cellular organisms → Bacteria → Acidobacteria1506Open in IMG/M
3300012511|Ga0157332_1082911All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300012530|Ga0136635_10194514All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300012684|Ga0136614_10014155All Organisms → cellular organisms → Bacteria → Proteobacteria5727Open in IMG/M
3300012925|Ga0137419_11276520All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300012927|Ga0137416_10095833All Organisms → cellular organisms → Bacteria → Acidobacteria2220Open in IMG/M
3300012929|Ga0137404_11449399All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300012930|Ga0137407_10731918All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300012930|Ga0137407_10889527All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300013296|Ga0157374_11528842All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300013297|Ga0157378_10010368All Organisms → cellular organisms → Bacteria8135Open in IMG/M
3300013297|Ga0157378_11622220All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300013297|Ga0157378_11688693All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300013306|Ga0163162_10304202All Organisms → cellular organisms → Bacteria → Acidobacteria1727Open in IMG/M
3300013308|Ga0157375_10294836All Organisms → cellular organisms → Bacteria → Acidobacteria1785Open in IMG/M
3300013760|Ga0120188_1035714All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300014326|Ga0157380_10072271All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300014487|Ga0182000_10428840All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300015373|Ga0132257_100220164All Organisms → cellular organisms → Bacteria2256Open in IMG/M
3300015374|Ga0132255_104211207All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300017695|Ga0180121_10360978All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300017789|Ga0136617_10401316All Organisms → cellular organisms → Bacteria → Acidobacteria1106Open in IMG/M
3300017789|Ga0136617_10519916All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300018054|Ga0184621_10371229All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300018059|Ga0184615_10372934All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300018071|Ga0184618_10354350All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300018073|Ga0184624_10196011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300018429|Ga0190272_10710181All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300018432|Ga0190275_10071645All Organisms → cellular organisms → Bacteria2975Open in IMG/M
3300018432|Ga0190275_13333914All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300018465|Ga0190269_11158369All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300018466|Ga0190268_10308953All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300018466|Ga0190268_11482088All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300018466|Ga0190268_11998516All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300018468|Ga0066662_12425828All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300018469|Ga0190270_10278300All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300018469|Ga0190270_10868519All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300018482|Ga0066669_12208109All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300018920|Ga0190273_10428555All Organisms → cellular organisms → Bacteria → Acidobacteria941Open in IMG/M
3300019238|Ga0180112_1096199All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300020215|Ga0196963_10389307All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300020215|Ga0196963_10596583All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300021344|Ga0193719_10342286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300021445|Ga0182009_10160239All Organisms → cellular organisms → Bacteria → Acidobacteria1074Open in IMG/M
3300025885|Ga0207653_10255010All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300025903|Ga0207680_10221971All Organisms → cellular organisms → Bacteria → Acidobacteria1296Open in IMG/M
3300025908|Ga0207643_10083741All Organisms → cellular organisms → Bacteria → Acidobacteria1851Open in IMG/M
3300025911|Ga0207654_10462677All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300025920|Ga0207649_11218801All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300025924|Ga0207694_11721698All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300025935|Ga0207709_10250505All Organisms → cellular organisms → Bacteria → Acidobacteria1293Open in IMG/M
3300025935|Ga0207709_11046430All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300025937|Ga0207669_11679115All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300025939|Ga0207665_10351037All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300025942|Ga0207689_10185081All Organisms → cellular organisms → Bacteria → Acidobacteria1718Open in IMG/M
3300025942|Ga0207689_11399475All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300025960|Ga0207651_11983282All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300026041|Ga0207639_10954839All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300026041|Ga0207639_11219055All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300026041|Ga0207639_11332872All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300026116|Ga0207674_10411926All Organisms → cellular organisms → Bacteria → Acidobacteria1306Open in IMG/M
3300026116|Ga0207674_11687247All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300026118|Ga0207675_100313082All Organisms → cellular organisms → Bacteria → Acidobacteria1531Open in IMG/M
3300026118|Ga0207675_102560178All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300027678|Ga0209011_1037402All Organisms → cellular organisms → Bacteria → Acidobacteria1520Open in IMG/M
3300027691|Ga0209485_1015901All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300027765|Ga0209073_10161936All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300027778|Ga0209464_10331023All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300028380|Ga0268265_10467232All Organisms → cellular organisms → Bacteria → Acidobacteria1182Open in IMG/M
3300028380|Ga0268265_11177625All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300028381|Ga0268264_12647246All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300030496|Ga0268240_10140849All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300030513|Ga0268242_1099241All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300031547|Ga0310887_10629034All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300031720|Ga0307469_11233632All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300031740|Ga0307468_100658374All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300031854|Ga0310904_10498678All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300031949|Ga0214473_12327187All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300032003|Ga0310897_10402851All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300033412|Ga0310810_11050725All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300033412|Ga0310810_11408723All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300033988|Ga0334909_034487All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300034005|Ga0334930_045045All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300034006|Ga0334934_005845All Organisms → cellular organisms → Bacteria → Acidobacteria1642Open in IMG/M
3300034133|Ga0334916_027768All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300034172|Ga0334913_045734All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300034221|Ga0334937_054100All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300034221|Ga0334937_182351All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300034268|Ga0372943_1021782All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300034391|Ga0334917_070298All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300034660|Ga0314781_144790All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300034664|Ga0314786_121218All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300034672|Ga0314797_155243All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300034675|Ga0314800_045708All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300034678|Ga0314803_006583All Organisms → cellular organisms → Bacteria → Acidobacteria1441Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.38%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.38%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.12%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.12%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.12%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.12%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.12%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.50%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust1.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.88%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.25%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.25%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.25%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.25%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil1.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.25%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust1.25%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.25%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.25%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.62%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.62%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.62%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.62%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013760Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030513Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033988Soil microbial communities from Mojave Desert, California, United States - 5NOCEnvironmentalOpen in IMG/M
3300034005Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNSEnvironmentalOpen in IMG/M
3300034006Biocrust microbial communities from Mojave Desert, California, United States - 30SMCEnvironmentalOpen in IMG/M
3300034133Biocrust microbial communities from Mojave Desert, California, United States - 12HMCEnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M
3300034221Biocrust microbial communities from Mojave Desert, California, United States - 33SMCEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034391Biocrust microbial communities from Mojave Desert, California, United States - 13HMCEnvironmentalOpen in IMG/M
3300034660Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034678Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1336799413300000363SoilMRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDMTKVAVA
INPhiseqgaiiFebDRAFT_10439613123300000364SoilMRNKRFFLVLVGALIFGVLAAFSVSKYLSSAQAYTKNL
JGI1027J11758_1118067613300000789SoilMRNKRFLFVLAGALAFGLLAAVSVSRYLSSAQAYTKN
F14TB_10537821323300001431SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSRV
JGI24738J21930_1014883913300002075Corn RhizosphereMRNKRFXXVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKIAVA
Ga0062590_10053595913300004157SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAVAKVQIP
Ga0058859_1182629313300004798Host-AssociatedMRNKRFFVVLVGALIFGVLAAVSVSKYLSSAQAFSKNLNKVAV
Ga0066676_1103760813300005186SoilMRNKRFFLVLAGALIFGLLAAVSVSRYLSSAQAYTKDMHRVAVAKVAI
Ga0065704_1013739853300005289Switchgrass RhizosphereMRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRGVAVAKVAIP
Ga0070680_10113543523300005336Corn RhizosphereMRNKRFFIVLAGALLFGLLAAISVTRYLSSAQAYTRNLNRV
Ga0070661_10082755423300005344Corn RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVAVAKVA
Ga0070673_10197655223300005364Switchgrass RhizosphereMRNKRFFIVLGGALLFGLVAAVSVSRYLSSAQAYTKSLNGVVVAK
Ga0070705_10088484813300005440Corn, Switchgrass And Miscanthus RhizosphereMRNKRFFIVLVGALMFGLLAAVSVSRYLSSAQAYTKNLTRVAVAKVAIP
Ga0070694_10031669743300005444Corn, Switchgrass And Miscanthus RhizosphereMRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRGIAVA
Ga0070662_10069396723300005457Corn RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAV
Ga0070662_10132214623300005457Corn RhizosphereMRNKRFFIVLIGALIFGVLAAVSVSKYLSSAQAYSKNLSRVAVAKVA
Ga0070698_10140680223300005471Corn, Switchgrass And Miscanthus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKV
Ga0070695_10062376413300005545Corn, Switchgrass And Miscanthus RhizosphereMRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRG
Ga0070695_10173130823300005545Corn, Switchgrass And Miscanthus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKIVVAKVA
Ga0070664_10057276413300005564Corn RhizosphereMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEF
Ga0068854_10058801633300005578Corn RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYAKNLKK
Ga0068861_10025520813300005719Switchgrass RhizosphereMRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTK
Ga0068858_10252151323300005842Switchgrass RhizosphereMRNKRFFIVLTGALLFGLLAAISVTRYLSSAQAYS
Ga0068858_10256365813300005842Switchgrass RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKN
Ga0066652_10177381123300006046SoilMRNKRFFIVLVGALIFGVLAAVTVSKYLSSAQAYTKNMSKVAVA
Ga0075422_1062200123300006196Populus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVAVAKV
Ga0075431_10024050953300006847Populus RhizosphereMRNKRFLIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAVAKVAIPI
Ga0075425_10067334213300006854Populus RhizosphereMKNKRLLFVLAGALVFGLLAAVSVSRYLSSAQAYTKNLNN
Ga0068865_10106903713300006881Miscanthus RhizosphereMRNKRFFIVLIGALIFGVLAAVSVSKYLSSAQAYSKNLS
Ga0079219_1057676513300006954Agricultural SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVA
Ga0079219_1113887223300006954Agricultural SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYT
Ga0079218_1213577013300007004Agricultural SoilMRNKRLVVVLAGAAMFGLLAAVSVSRYLSNAQANTRNANSVV
Ga0105247_1064085023300009101Switchgrass RhizosphereMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYS
Ga0111538_1097697733300009156Populus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFSKNLNKVAVAKVPIPLG
Ga0075423_1142999223300009162Populus RhizosphereMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAK
Ga0075423_1166308423300009162Populus RhizosphereMRNKRFFIVLVGALIFGVLAAISVSRYLSSAQAYTKNLS
Ga0105241_1068706213300009174Corn RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQALTKNLNKI
Ga0105241_1077865513300009174Corn RhizosphereMRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDMTRVAVAKV
Ga0105248_1050789843300009177Switchgrass RhizosphereMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTK
Ga0105248_1159538823300009177Switchgrass RhizosphereMRNKRFFIVLVGALMFGVLAAVSVSKYLSSAQAFTKNLNKVAV
Ga0105237_1249055113300009545Corn RhizosphereMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKE
Ga0105249_1193980123300009553Switchgrass RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKVAVA
Ga0105340_124136923300009610SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSNAQAYSNSLS
Ga0126307_1135709613300009789Serpentine SoilMRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASSR
Ga0126313_1074763613300009840Serpentine SoilMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNK
Ga0126380_1196892513300010043Tropical Forest SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFSKNLHKVA
Ga0126310_1044161233300010044Serpentine SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNLNKI
Ga0126310_1134060223300010044Serpentine SoilMRNKSLLLALAGAVIFGLIAAVSVSRYISQARAYAENL
Ga0126382_1038321143300010047Tropical Forest SoilMRNKRFLIVLVGALMFGLVAAVSVSRYLSSAQAYTK
Ga0126320_101251713300010146SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFTKNLNKVA
Ga0126319_165279213300010147SoilMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFN
Ga0126306_1109817823300010166Serpentine SoilMRNKRFFLVLVGALIFGVLAAVSVSRYLSNAQGYTKNLN
Ga0134126_1305417623300010396Terrestrial SoilMRNKRFFIVLVGALIFGVLAAVSVSNYLSSAQALTKNLNKVAVAKVPI
Ga0134122_1007187863300010400Terrestrial SoilMRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKNLNGIVVAKVA
Ga0134122_1084931413300010400Terrestrial SoilMRNKRFFIVLTGALLFGLLAAISVTRYLSSAQAYSKNLSRVAV
Ga0134122_1235565823300010400Terrestrial SoilMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLN
Ga0134121_1084355423300010401Terrestrial SoilMRNKRFFIVLVGALMFGVLAAVSVSKYLSSAQAFTK
Ga0134123_1071482013300010403Terrestrial SoilMRNKRFFFVLGGALVFGLLAAVSVSRYLSSAQAYTKNLNTIAV
Ga0137391_1103501813300011270Vadose Zone SoilMRNKRFFIVLVGALLFGLLAAFSVSRYLSSAQAYTKNLNRVA
Ga0137442_104589513300011414SoilMRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKSLNRVAVAKVAI
Ga0120118_109012123300012010PermafrostMRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTNNLNRVAVAKV
Ga0137363_1099456013300012202Vadose Zone SoilMRNKRFFFVLAGALVFGLLAAISVSRYLSSAQAYTKNLNMVAV
Ga0137376_1177046113300012208Vadose Zone SoilMRNKRFFIVLIGALLFGLLAAVSVSRYLSSAQAYTK
Ga0137385_1117005623300012359Vadose Zone SoilMRNKRFFIVLTGALLFGVLAAFSVSRYLSSAQAFSK
Ga0157356_100434313300012474Unplanted SoilMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAKVPI
Ga0157351_100149513300012501Unplanted SoilMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNR
Ga0157332_108291113300012511SoilMRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFAKDMHKVAVAKVAIPV
Ga0136635_1019451413300012530Polar Desert SandMRNKRFVFVMVGAVVFGLVAAFSVSRYLSGTQAYAKNLNSV
Ga0136614_1001415583300012684Polar Desert SandMRNKRFMIALAGAVVFGLIATVAVTRYLANAQAYTKNLG
Ga0137419_1127652013300012925Vadose Zone SoilMRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYT
Ga0137416_1009583313300012927Vadose Zone SoilMRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDM
Ga0137404_1144939923300012929Vadose Zone SoilMRNKRFFIVLTGALLFGVLAAFSVSRYLSSAQAFTKD
Ga0137407_1073191833300012930Vadose Zone SoilMRNKRFFVVLAGALVFGLLAAVTVSRYLSSAQAYSKDLRQVAVAKVAI
Ga0137407_1088952713300012930Vadose Zone SoilMRNKRFFIVLTGALLFGVLAAFSVSRYLSSAQAFSKDLKRVV
Ga0157374_1152884213300013296Miscanthus RhizosphereMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKVAVAKVAI
Ga0157378_1001036813300013297Miscanthus RhizosphereMRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKNLNKVAV
Ga0157378_1162222013300013297Miscanthus RhizosphereMRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFAKDMHKVAV
Ga0157378_1168869323300013297Miscanthus RhizosphereMRNKRFFIVLAGALVFGLLAAVSVNRYLSNAQAFSKDMTKVAVAK
Ga0163162_1030420253300013306Switchgrass RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKIAVAKVAIPIG
Ga0157375_1029483643300013308Miscanthus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNL
Ga0120188_103571423300013760TerrestrialMRNKRFIIVLVGALIFGVLAAVSVSKYLSSAQAFTK
Ga0157380_1007227153300014326Switchgrass RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKDMHKVAVA
Ga0182000_1042884023300014487SoilMRNKRFFLVLVGALIFGVLAAVSVSKYLSSAQAYTKNLNKVAVAKVAI
Ga0132257_10022016463300015373Arabidopsis RhizosphereMRNKRFFLVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVPVAKVAIPIW
Ga0132255_10421120723300015374Arabidopsis RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQALTKNLNKIAVAKVPI
Ga0180121_1036097813300017695Polar Desert SandMRNKRFMIALAGAVVFGLIATVAVTRYLANAQAYTKNLGNVVVAK
Ga0136617_1040131633300017789Polar Desert SandMVGAVVFGLVAAFSVSRYLSGTQAYAKNLNSVVVAKVDI
Ga0136617_1051991613300017789Polar Desert SandMRNKRFLVVLTGAIVFGLFAAVLVSRYLSNAQAYTKNLGNV
Ga0184621_1037122913300018054Groundwater SedimentMRNKRFFIVLAGALIFGLLAAVSVTRYLSSAQAYTKS
Ga0184615_1037293423300018059Groundwater SedimentMRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKNFNRVAVAK
Ga0184618_1035435013300018071Groundwater SedimentMRNKRFFIVLAGALLFGLLAAVSVTRYLSSAQAYTRNLNRVAVAKVSIPLG
Ga0184624_1019601123300018073Groundwater SedimentMRNKRFFIVLVGALIFGVLAAVSVSRYLSNAQAYSNSLSRIAVAKVAIP
Ga0190272_1071018123300018429SoilMRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKNLNRVTVAKVAI
Ga0190275_1007164513300018432SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVAVAKVPIP
Ga0190275_1333391413300018432SoilMRNKRFLIVMAGALVFGLLAAFSVSRYLSSAQANNSNFTKV
Ga0190269_1115836913300018465SoilMRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASSRNMNNV
Ga0190268_1030895333300018466SoilMRNKRFFIVLVGALIFGVLAAVSISKYLSSAQAYT
Ga0190268_1148208823300018466SoilMRNKRFFVVLAGALLFGLLAAVSVSRYLSSAQAYT
Ga0190268_1199851613300018466SoilMRNKRFFVVLVGALIFGLLAAVSVSRYLSSAQAYTKNLTRVAVAKV
Ga0066662_1242582823300018468Grasslands SoilMRNKRFFVVLAGALLFGLLAAVTVSRYLSSAQAYSKDLKP
Ga0190270_1027830043300018469SoilMRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDMT
Ga0190270_1086851913300018469SoilMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQAYTKNLTR
Ga0066669_1220810923300018482Grasslands SoilMRNKRFFRVWVGALIFGVLATVPVSKYLSSAQAYTK
Ga0190273_1042855513300018920SoilMRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTKNLTR
Ga0180112_109619913300019238Groundwater SedimentMRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKTLN
Ga0196963_1038930713300020215SoilMRNKRLVFVLAGAAMFGLLAAVSVSRYLSNAQANPRGA
Ga0196963_1059658323300020215SoilMRNKRLIVVLGGAVVFGLIAAVSVSRYLSNAQGFSRGMN
Ga0193719_1034228613300021344SoilMRNKRFIFVLAGALIFGLLAAVSVSRYLSSAQAYTKNLNRVAV
Ga0182009_1016023933300021445SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLTKVAVAKVAI
Ga0207653_1025501013300025885Corn, Switchgrass And Miscanthus RhizosphereMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKIAVAKV
Ga0207680_1022197143300025903Switchgrass RhizosphereMRNKRFFIVLIGALIFGVLAAVSVSKYLSSAQAYSKNLSRVAVAKVAIP
Ga0207643_1008374153300025908Miscanthus RhizosphereMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAKVPIP
Ga0207654_1046267733300025911Corn RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQACSKNMSKV
Ga0207649_1121880123300025920Corn RhizosphereMRNKRFFVVLVGALIFGVLAAVSVSKYLSSAQAFSKN
Ga0207694_1172169823300025924Corn RhizosphereMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAKVP
Ga0207709_1025050543300025935Miscanthus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAVAKVQIPLG
Ga0207709_1104643013300025935Miscanthus RhizosphereMRNKRFFLVLIGALVFGLLAAVSVSRYLSSAQAYTKSLN
Ga0207669_1167911523300025937Miscanthus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSNAQAYSNTLSRIAVAKVAIP
Ga0207665_1035103733300025939Corn, Switchgrass And Miscanthus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKIVVA
Ga0207689_1018508143300025942Miscanthus RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNMSKVAVAKVTIPIG
Ga0207689_1139947523300025942Miscanthus RhizosphereMRNKRFFLVLVGALIFGVLAAFSVSKYLSSAQAYTKNLSKVAVAKVA
Ga0207651_1198328223300025960Switchgrass RhizosphereMRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSL
Ga0207639_1095483923300026041Corn RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQALTKNLNKIAVA
Ga0207639_1121905523300026041Corn RhizosphereMRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFAKDMHKVAVA
Ga0207639_1133287223300026041Corn RhizosphereMRNKRFFIVLVGALLFGLLAAFSVSRYLSSAQAYTKNLNRVAVAKVAI
Ga0207674_1041192643300026116Corn RhizosphereMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKNLN
Ga0207674_1168724713300026116Corn RhizosphereMRNKRLLIVLVGALIFGVLAAVSVSKYLSSAQAYTKS
Ga0207675_10031308253300026118Switchgrass RhizosphereMRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTKNLTRVAVAKVA
Ga0207675_10256017823300026118Switchgrass RhizosphereMRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRGIAVAK
Ga0209011_103740213300027678Forest SoilMRNKRFFFVLAGALIFGLLAAVSVSRYLSSAQAYTKNMNHVA
Ga0209485_101590113300027691Agricultural SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKNLNKVAVAKVA
Ga0209073_1016193613300027765Agricultural SoilMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKV
Ga0209464_1033102313300027778Wetland SedimentMRNKRFLFVLAGALIFGLVAAVSVSRYLSSAQAYTKNL
Ga0268265_1046723213300028380Switchgrass RhizosphereMRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFA
Ga0268265_1117762523300028380Switchgrass RhizosphereMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKVAVA
Ga0268264_1264724623300028381Switchgrass RhizosphereMRNKRFFLVLVGALIFGVLAAVSVSKYLSSAQAYTKNLSKV
Ga0268240_1014084923300030496SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKIAV
Ga0268242_109924123300030513SoilMRNKRFLIVMAGALVFGLLAAFSVSRYLSSAQANNSNMTKIAVAKVD
Ga0310887_1062903423300031547SoilMRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATVKEFNRVTVAK
Ga0307469_1123363213300031720Hardwood Forest SoilMRNKRFFIVLGGALLFGLLAAVSVSRYLSSAQAYTK
Ga0307468_10065837413300031740Hardwood Forest SoilMRNKRFFIVLAGALVFGLLAAVSVSRYLSSAQAYTN
Ga0310904_1049867823300031854SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFTKNLNKVAV
Ga0214473_1232718723300031949SoilMRNKRFFVVLAGALLFGLLAAVSVSRYLSSAQAYSKNFNRVAVA
Ga0310897_1040285123300032003SoilMRNKRFFIVLVGALIFGVLAAISVSRYLSSAQAYTKNLSKVAVAKVQIPLG
Ga0310810_1105072513300033412SoilMRNKRFFIVLVGALIFGVLAAVTVSKYLSSAQAYTKNM
Ga0310810_1140872323300033412SoilMRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYGKTLN
Ga0334909_034487_538_6423300033988SoilMRNKRLLFVLAGAAVFGLVAAVSVSRYLSNAQAFT
Ga0334930_045045_621_7373300034005Sub-Biocrust SoilMRNKRLLFVLGSAAVFGLLAAVSVSRYLSDAQANTRNMN
Ga0334934_005845_1523_16423300034006BiocrustMRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASSRNLNN
Ga0334916_027768_2_1273300034133Hypolithic BiocrustMRNKRLLVVLVGAAVFGLLAAVSVSRYLSNAQATPRNLANVV
Ga0334913_045734_2_1303300034172Sub-Biocrust SoilMRNKRFLIVMTGALVFGLLAAFSVSRYLSSAQANPNFTKIAVA
Ga0334937_054100_987_10943300034221BiocrustMRNKRLLFVLGSAAVFGLLAAVSVSRYLSDAQASSR
Ga0334937_182351_3_1103300034221BiocrustMRNKRLVFVMCGAVVFGLVAAFSVSRYLSGTQAYAK
Ga0372943_1021782_445_5493300034268SoilMRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASG
Ga0334917_070298_528_6503300034391Hypolithic BiocrustMRNKRLLFVLAGAAVFGLVAAVSVSRYLSNAQAFTRNMNNV
Ga0314781_144790_3_1523300034660SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNMSKVAVAKVAIPI
Ga0314786_121218_462_5843300034664SoilMRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKNLNNV
Ga0314797_155243_405_5093300034672SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSRAQAFT
Ga0314800_045708_2_1303300034675SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNLNKVVV
Ga0314803_006583_1320_14393300034678SoilMRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.