Metagenome Family F041238

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F041238
Family Type	Metagenome
Number of Sequences	160
Average Sequence Length	38 residues
Representative Sequence	MENLLQMWLNPINLGILFLCLTVGIWILAHSDPTRKDK
Number of Associated Samples	108
Number of Associated Scaffolds	160

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	84.38 %
% of genes near scaffold ends (potentially truncated)	11.88 %
% of genes from short scaffolds (< 2000 bps)	75.00 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (93.750 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.500 % of family members)
Environment Ontology (ENVO)	Unclassified (23.750 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (28.125 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 160 Family Scaffolds
PF07690	MFS_1	37.50
PF05368	NmrA	7.50
PF08241	Methyltransf_11	4.38
PF01494	FAD_binding_3	3.75
PF13649	Methyltransf_25	3.75
PF12697	Abhydrolase_6	3.12
PF01565	FAD_binding_4	0.62
PF06155	GBBH-like_N	0.62
PF01061	ABC2_membrane	0.62
PF13460	NAD_binding_10	0.62
PF13808	DDE_Tnp_1_assoc	0.62
PF13304	AAA_21	0.62
PF12838	Fer4_7	0.62
PF06197	DUF998	0.62
PF09939	DUF2171	0.62
PF00420	Oxidored_q2	0.62
PF02913	FAD-oxidase_C	0.62
PF03720	UDPG_MGDP_dh_C	0.62
PF01797	Y1_Tnp	0.62
PF07394	DUF1501	0.62
PF12146	Hydrolase_4	0.62
PF05762	VWA_CoxE	0.62
PF00892	EamA	0.62
PF00440	TetR_N	0.62
PF13263	PHP_C	0.62
PF02775	TPP_enzyme_C	0.62
PF00107	ADH_zinc_N	0.62
PF13426	PAS_9	0.62
PF00196	GerE	0.62
PF13332	Fil_haemagg_2	0.62
PF00756	Esterase	0.62
PF01925	TauE	0.62
PF00072	Response_reg	0.62
PF12847	Methyltransf_18	0.62

COG ID	Name	Functional Category	% Frequency in 160 Family Scaffolds
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	7.50
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	3.75
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	3.75
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	3.75
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.62
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.62
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.62
COG3371	Uncharacterized membrane protein	Function unknown [S]	0.62
COG3536	Uncharacterized conserved protein, DUF971 family	Function unknown [S]	0.62

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.75 %
Unclassified	root	N/A	6.25 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.75 %
Unclassified	root	N/A	6.25 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.75 %
Unclassified	root	N/A	6.25 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	59.38 %
Unclassified	root	N/A	6.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.75 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	48.12 %
Unclassified	root	N/A	6.25 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	5.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.75 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.25 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	8.12 %
Unclassified	root	N/A	6.25 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	3.12 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.75 %
Thermoflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia	1.25 %
Ktedonobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria	1.25 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	1.25 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.62 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	8.12 %
Unclassified	root	N/A	6.25 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	3.12 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.75 %
Thermoflexales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales	1.25 %
Ktedonobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales	1.25 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.25 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.62 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	8.12 %
Unclassified	root	N/A	6.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.75 %
Thermoflexaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae	1.25 %
Paenibacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae	1.25 %
Clostridiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae	1.25 %
Ktedonobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae	0.62 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.62 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	8.12 %
Unclassified	root	N/A	6.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.75 %
Clostridium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium	1.25 %
Thermoflexus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus	1.25 %
Cohnella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella	0.62 %
Ktedonobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter	0.62 %
Paenibacillus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus	0.62 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.62 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	8.12 %
Unclassified	root	N/A	6.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.75 %
Thermoflexus hugenholtzii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii	1.25 %
Clostridium botulinum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium botulinum	1.25 %
Ktedonobacter racemifer	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer	0.62 %
Cohnella kolymensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella kolymensis	0.62 %
Paenibacillus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus	0.62 %
Anaerolineales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	0.62 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886006\|SwRhRL3b_contig_4438135	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	858	Open in IMG/M
3300000956\|JGI10216J12902_103154102	All Organisms → cellular organisms → Bacteria → Proteobacteria	1314	Open in IMG/M
3300000956\|JGI10216J12902_105474955	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	825	Open in IMG/M
3300001213\|JGIcombinedJ13530_101865385	All Organisms → cellular organisms → Bacteria	808	Open in IMG/M
3300001213\|JGIcombinedJ13530_103289715	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300001213\|JGIcombinedJ13530_103820419	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	896	Open in IMG/M
3300001213\|JGIcombinedJ13530_107549887	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	578	Open in IMG/M
3300001213\|JGIcombinedJ13530_107918529	All Organisms → cellular organisms → Bacteria → Terrabacteria group	578	Open in IMG/M
3300001213\|JGIcombinedJ13530_108661748	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300001213\|JGIcombinedJ13530_109283091	All Organisms → cellular organisms → Bacteria	719	Open in IMG/M
3300005205\|Ga0068999_10065998	All Organisms → cellular organisms → Bacteria → Terrabacteria group	668	Open in IMG/M
3300005213\|Ga0068998_10024462	All Organisms → cellular organisms → Bacteria	1040	Open in IMG/M
3300005617\|Ga0068859_100902352	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	968	Open in IMG/M
3300005617\|Ga0068859_101795359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	677	Open in IMG/M
3300005618\|Ga0068864_101200023	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	757	Open in IMG/M
3300005836\|Ga0074470_10985685	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	64361	Open in IMG/M
3300005842\|Ga0068858_100274071	All Organisms → cellular organisms → Bacteria → Proteobacteria	1606	Open in IMG/M
3300005843\|Ga0068860_101485699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	699	Open in IMG/M
3300005893\|Ga0075278_1012316	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1120	Open in IMG/M
3300005900\|Ga0075272_1089085	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300005903\|Ga0075279_10054260	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	673	Open in IMG/M
3300005985\|Ga0081539_10005936	All Organisms → cellular organisms → Bacteria	12056	Open in IMG/M
3300005985\|Ga0081539_10049824	All Organisms → cellular organisms → Bacteria	2374	Open in IMG/M
3300006354\|Ga0075021_10325047	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	956	Open in IMG/M
3300006755\|Ga0079222_12604721	Not Available	509	Open in IMG/M
3300006844\|Ga0075428_100928602	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	922	Open in IMG/M
3300006845\|Ga0075421_100303218	All Organisms → cellular organisms → Bacteria	1942	Open in IMG/M
3300006845\|Ga0075421_100470442	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1498	Open in IMG/M
3300006845\|Ga0075421_102484591	Not Available	540	Open in IMG/M
3300006846\|Ga0075430_100936234	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	714	Open in IMG/M
3300006852\|Ga0075433_10070015	All Organisms → cellular organisms → Bacteria	3082	Open in IMG/M
3300006852\|Ga0075433_10914088	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	765	Open in IMG/M
3300006853\|Ga0075420_101255898	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium botulinum	636	Open in IMG/M
3300006865\|Ga0073934_10014102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales	9136	Open in IMG/M
3300006880\|Ga0075429_100048593	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	3689	Open in IMG/M
3300006880\|Ga0075429_100691233	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	894	Open in IMG/M
3300006880\|Ga0075429_100840219	Not Available	804	Open in IMG/M
3300006880\|Ga0075429_101029027	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	720	Open in IMG/M
3300006880\|Ga0075429_101139376	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300007004\|Ga0079218_11183739	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300009078\|Ga0105106_10445553	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300009081\|Ga0105098_10000879	All Organisms → cellular organisms → Bacteria	10708	Open in IMG/M
3300009081\|Ga0105098_10195679	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium botulinum	931	Open in IMG/M
3300009091\|Ga0102851_10103352	All Organisms → cellular organisms → Bacteria	2476	Open in IMG/M
3300009100\|Ga0075418_12249907	Not Available	595	Open in IMG/M
3300009100\|Ga0075418_13168281	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	501	Open in IMG/M
3300009146\|Ga0105091_10027419	All Organisms → cellular organisms → Bacteria	2468	Open in IMG/M
3300009147\|Ga0114129_12527290	Not Available	614	Open in IMG/M
3300009157\|Ga0105092_10033710	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2723	Open in IMG/M
3300009162\|Ga0075423_13013360	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	516	Open in IMG/M
3300009167\|Ga0113563_10696502	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1138	Open in IMG/M
3300009167\|Ga0113563_12322837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	645	Open in IMG/M
3300009168\|Ga0105104_10002168	All Organisms → cellular organisms → Bacteria	14466	Open in IMG/M
3300009168\|Ga0105104_10002722	All Organisms → cellular organisms → Bacteria	12774	Open in IMG/M
3300009168\|Ga0105104_10240791	All Organisms → cellular organisms → Bacteria	987	Open in IMG/M
3300009168\|Ga0105104_10794637	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	549	Open in IMG/M
3300010038\|Ga0126315_10031698	All Organisms → cellular organisms → Bacteria	2754	Open in IMG/M
3300010038\|Ga0126315_10343980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	928	Open in IMG/M
3300010040\|Ga0126308_11361236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	504	Open in IMG/M
3300010041\|Ga0126312_10607834	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	786	Open in IMG/M
3300010044\|Ga0126310_11739347	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	519	Open in IMG/M
3300010362\|Ga0126377_10018406	All Organisms → cellular organisms → Bacteria	5693	Open in IMG/M
3300010391\|Ga0136847_10372165	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2745	Open in IMG/M
3300011442\|Ga0137437_1101797	All Organisms → cellular organisms → Bacteria	985	Open in IMG/M
3300012204\|Ga0137374_10024468	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	6754	Open in IMG/M
3300012204\|Ga0137374_10031921	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	5742	Open in IMG/M
3300012204\|Ga0137374_10105729	All Organisms → cellular organisms → Bacteria	2637	Open in IMG/M
3300012353\|Ga0137367_10008808	All Organisms → cellular organisms → Bacteria	8061	Open in IMG/M
3300012353\|Ga0137367_10012400	All Organisms → cellular organisms → Bacteria	6782	Open in IMG/M
3300012354\|Ga0137366_10398473	All Organisms → cellular organisms → Bacteria	1002	Open in IMG/M
3300012355\|Ga0137369_10034351	All Organisms → cellular organisms → Bacteria	4609	Open in IMG/M
3300012675\|Ga0137337_1036563	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	749	Open in IMG/M
3300012899\|Ga0157299_10113739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	718	Open in IMG/M
3300012931\|Ga0153915_10122530	All Organisms → cellular organisms → Bacteria	2789	Open in IMG/M
3300012931\|Ga0153915_10653245	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1212	Open in IMG/M
3300012931\|Ga0153915_10978853	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	985	Open in IMG/M
3300012964\|Ga0153916_10219916	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii	1901	Open in IMG/M
3300012964\|Ga0153916_10525593	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus	1255	Open in IMG/M
3300012964\|Ga0153916_10697940	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1094	Open in IMG/M
3300012964\|Ga0153916_13324474	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	505	Open in IMG/M
3300013760\|Ga0120188_1017862	Not Available	715	Open in IMG/M
3300014311\|Ga0075322_1013717	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1597	Open in IMG/M
3300014322\|Ga0075355_1254712	Not Available	508	Open in IMG/M
3300014326\|Ga0157380_11603518	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	706	Open in IMG/M
3300015259\|Ga0180085_1082482	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	939	Open in IMG/M
3300015371\|Ga0132258_10390885	All Organisms → cellular organisms → Bacteria	3453	Open in IMG/M
3300015371\|Ga0132258_12462356	All Organisms → cellular organisms → Bacteria	1303	Open in IMG/M
3300018053\|Ga0184626_10289306	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella kolymensis	681	Open in IMG/M
3300018056\|Ga0184623_10052089	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1871	Open in IMG/M
3300018059\|Ga0184615_10042226	All Organisms → cellular organisms → Bacteria	2533	Open in IMG/M
3300018059\|Ga0184615_10300562	All Organisms → cellular organisms → Bacteria	895	Open in IMG/M
3300018074\|Ga0184640_10341606	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	679	Open in IMG/M
3300021090\|Ga0210377_10004017	All Organisms → cellular organisms → Bacteria	12470	Open in IMG/M
3300021090\|Ga0210377_10043739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3131	Open in IMG/M
3300021090\|Ga0210377_10235063	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1151	Open in IMG/M
3300021090\|Ga0210377_10397894	All Organisms → cellular organisms → Bacteria → Terrabacteria group	818	Open in IMG/M
3300021090\|Ga0210377_10415848	Not Available	795	Open in IMG/M
3300025310\|Ga0209172_10052568	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2519	Open in IMG/M
3300025556\|Ga0210120_1028653	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales	1084	Open in IMG/M
3300025580\|Ga0210138_1013148	All Organisms → cellular organisms → Bacteria	1659	Open in IMG/M
3300025795\|Ga0210114_1082535	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	655	Open in IMG/M
3300025910\|Ga0207684_11609793	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	526	Open in IMG/M
3300025922\|Ga0207646_10116136	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2404	Open in IMG/M
3300025936\|Ga0207670_10295810	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1266	Open in IMG/M
3300025990\|Ga0208527_1012090	All Organisms → cellular organisms → Bacteria → Proteobacteria	1041	Open in IMG/M
3300026010\|Ga0207999_1016095	All Organisms → cellular organisms → Bacteria → Terrabacteria group	691	Open in IMG/M
3300026075\|Ga0207708_10118541	All Organisms → cellular organisms → Bacteria	2061	Open in IMG/M
3300026095\|Ga0207676_10373325	All Organisms → cellular organisms → Bacteria	1326	Open in IMG/M
3300026116\|Ga0207674_10696735	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	981	Open in IMG/M
3300027743\|Ga0209593_10004548	All Organisms → cellular organisms → Bacteria	5806	Open in IMG/M
3300027743\|Ga0209593_10059456	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1456	Open in IMG/M
3300027743\|Ga0209593_10088536	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1149	Open in IMG/M
3300027743\|Ga0209593_10189315	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	728	Open in IMG/M
3300027880\|Ga0209481_10418769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer	688	Open in IMG/M
3300027887\|Ga0208980_10259433	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1010	Open in IMG/M
3300027887\|Ga0208980_10303037	All Organisms → cellular organisms → Bacteria	926	Open in IMG/M
3300027887\|Ga0208980_10357937	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	844	Open in IMG/M
3300027894\|Ga0209068_10266010	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	956	Open in IMG/M
3300027909\|Ga0209382_10385766	All Organisms → cellular organisms → Bacteria	1562	Open in IMG/M
3300027909\|Ga0209382_11210520	All Organisms → cellular organisms → Bacteria → Terrabacteria group	772	Open in IMG/M
3300027956\|Ga0209820_1000897	All Organisms → cellular organisms → Bacteria	7310	Open in IMG/M
3300027979\|Ga0209705_10576714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	540	Open in IMG/M
3300028649\|Ga0302162_10063232	All Organisms → cellular organisms → Bacteria → Proteobacteria	840	Open in IMG/M
3300028666\|Ga0265336_10223279	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	559	Open in IMG/M
3300029981\|Ga0302293_10151125	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	736	Open in IMG/M
3300029989\|Ga0311365_11738227	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	534	Open in IMG/M
3300029990\|Ga0311336_11706477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	556	Open in IMG/M
3300030002\|Ga0311350_10651032	All Organisms → cellular organisms → Bacteria	946	Open in IMG/M
3300030002\|Ga0311350_11111733	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	705	Open in IMG/M
3300030019\|Ga0311348_11483506	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	504	Open in IMG/M
3300030047\|Ga0302286_10367554	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	725	Open in IMG/M
3300030047\|Ga0302286_10655467	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	535	Open in IMG/M
3300030114\|Ga0311333_10158502	All Organisms → cellular organisms → Bacteria → Proteobacteria	1735	Open in IMG/M
3300030943\|Ga0311366_10218347	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1648	Open in IMG/M
3300030943\|Ga0311366_11220711	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	648	Open in IMG/M
3300031232\|Ga0302323_100099468	All Organisms → cellular organisms → Bacteria	2799	Open in IMG/M
3300031250\|Ga0265331_10285733	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	739	Open in IMG/M
3300031256\|Ga0315556_1077367	All Organisms → cellular organisms → Bacteria	1310	Open in IMG/M
3300031521\|Ga0311364_11864626	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	591	Open in IMG/M
3300031521\|Ga0311364_11978946	All Organisms → cellular organisms → Bacteria	572	Open in IMG/M
3300031576\|Ga0247727_10005584	All Organisms → cellular organisms → Bacteria	25379	Open in IMG/M
3300031726\|Ga0302321_100003305	All Organisms → cellular organisms → Bacteria	13827	Open in IMG/M
3300031726\|Ga0302321_100072243	All Organisms → cellular organisms → Bacteria → Proteobacteria	3389	Open in IMG/M
3300031726\|Ga0302321_101063132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	923	Open in IMG/M
3300031726\|Ga0302321_103424060	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	516	Open in IMG/M
3300031949\|Ga0214473_10005857	All Organisms → cellular organisms → Bacteria	14701	Open in IMG/M
3300031949\|Ga0214473_10516571	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1331	Open in IMG/M
3300032013\|Ga0310906_10491392	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	829	Open in IMG/M
3300032783\|Ga0335079_10005744	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	14203	Open in IMG/M
3300032829\|Ga0335070_11394166	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	640	Open in IMG/M
3300032893\|Ga0335069_10021308	All Organisms → cellular organisms → Bacteria	8955	Open in IMG/M
3300032897\|Ga0335071_10807513	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300032955\|Ga0335076_11036453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	703	Open in IMG/M
3300033433\|Ga0326726_10162826	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2042	Open in IMG/M
3300033433\|Ga0326726_10174222	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1974	Open in IMG/M
3300033480\|Ga0316620_10272540	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1464	Open in IMG/M
3300033482\|Ga0316627_101055641	Not Available	793	Open in IMG/M
3300033486\|Ga0316624_12264013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	506	Open in IMG/M
3300033493\|Ga0316631_10191763	Not Available	781	Open in IMG/M
3300033513\|Ga0316628_100012361	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii	7481	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	78.75%
Host-Associated	Host-Associated	21.25%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	41.25%
Aquatic	Environmental → Aquatic	37.50%
Plants	Host-Associated → Plants	21.25%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	27.50%
Freshwater	Environmental → Aquatic → Freshwater	19.38%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.37%
Peat	Environmental → Terrestrial → Peat	13.12%
Marine	Environmental → Aquatic → Marine	10.00%
Sediment	Environmental → Aquatic → Sediment	6.88%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.88%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.25%
Cave	Environmental → Terrestrial → Cave	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	14.37%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	13.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.12%
Sediment	Environmental → Aquatic → Freshwater → Sediment	12.50%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	10.62%
Wetlands	Environmental → Aquatic → Marine → Wetlands	9.38%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.88%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	6.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.62%
Loam	Environmental → Terrestrial → Soil → Loam	2.50%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.25%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.25%
Lake	Environmental → Aquatic → Freshwater → Lake	0.62%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.62%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	13.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.12%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	12.50%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	10.62%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	10.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.88%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	6.25%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	6.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.62%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	3.12%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.50%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.25%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.25%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.25%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.25%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.62%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.62%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.62%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	12.50%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	11.88%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	9.38%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	6.25%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	6.25%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	4.38%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.38%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	3.12%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	3.12%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.12%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.12%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	3.12%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.75%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.88%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.88%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.25%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.25%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.25%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.25%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.25%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.25%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.25%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.25%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.62%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.62%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.62%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.62%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.62%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.62%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.62%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.62%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886006	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300005205	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2	Environmental	Open in IMG/M
3300005213	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005893	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202	Environmental	Open in IMG/M
3300005900	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404	Environmental	Open in IMG/M
3300005903	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303	Environmental	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012675	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental	Open in IMG/M
3300014311	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1	Environmental	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015259	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental	Open in IMG/M
3300025556	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025580	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025795	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025990	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes)	Environmental	Open in IMG/M
3300026010	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027743	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027956	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027979	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028649	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2	Environmental	Open in IMG/M
3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Host-Associated	Open in IMG/M
3300029981	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2	Environmental	Open in IMG/M
3300029989	III_Fen_N1 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030019	II_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030047	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3	Environmental	Open in IMG/M
3300030114	I_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Host-Associated	Open in IMG/M
3300031256	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10	Environmental	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M
3300033493	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
SwRhRL3b_0236.00001920	2162886006	Switchgrass Rhizosphere	MENVLQLWLNPINLGILFLCITVGIWILAHSDPTRRDK
JGI10216J12902_1031541022	3300000956	Soil	MNSLIQLWLNPVNLGILFLCLTIGIWVLSKAGPWNWDK*
JGI10216J12902_1054749551	3300000956	Soil	MQNLIQLWLNPINLGILFLCFTIGIWILAHSDPTRRDK*
JGIcombinedJ13530_1018653851	3300001213	Wetland	KIIEMWLNPINLGILFLCLAGGIWILAHSDPTHRDK*
JGIcombinedJ13530_1032897152	3300001213	Wetland	ENLLQTWLNPINLGILFLCLCGGIWLLSHTDPNSKHK*
JGIcombinedJ13530_1038204191	3300001213	Wetland	MDKIIVMWLNPINLGILFLCLAGGVWILAHSDPNRRDK*
JGIcombinedJ13530_1075498871	3300001213	Wetland	KLKFERKTNMEKIIAMWLNPINLGILFLCITGGIWILAHSDPTRRDK*
JGIcombinedJ13530_1079185292	3300001213	Wetland	KILEMWLNPINLGIVFLCLCGGIWLLSHTAPHNWKDK*
JGIcombinedJ13530_1086617482	3300001213	Wetland	MNSILQLWLNPINLGILFLCLCAGVWILAHSAPNYKDK*
JGIcombinedJ13530_1092830911	3300001213	Wetland	TNMEKIIEMWLNPINLGILFLCLTGGIWILAHSDPTRRDK*
Ga0068999_100659981	3300005205	Natural And Restored Wetlands	MEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRREKY*
Ga0068998_100244622	3300005213	Natural And Restored Wetlands	MNMEKIIEMWLNPINLGILFLCLTGGIWILAHSDPTRRDK*
Ga0068859_1009023522	3300005617	Switchgrass Rhizosphere	MENLIQLWLNPVNLGIFFLCSTVGIWILAHSDPTRRDK*
Ga0068859_1017953591	3300005617	Switchgrass Rhizosphere	MENVLQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK*
Ga0068864_1012000232	3300005618	Switchgrass Rhizosphere	MEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK*
Ga0074470_1098568551	3300005836	Sediment (Intertidal)	MENILQQWLNPINLGILFVCLCAGIWLLAHTAPNYKDK*
Ga0068858_1002740712	3300005842	Switchgrass Rhizosphere	MENLLQLWLNPIDLGIFFLCITLGIWILAHSDASHRNK*
Ga0068860_1014856992	3300005843	Switchgrass Rhizosphere	MENVLQLWLSPLNLGILFLCITVGIWILAHSDPTRRDK*
Ga0075278_10123162	3300005893	Rice Paddy Soil	MENTIQLWLNPINLGILFLCLCGGLWLLSHTAPNDKNK*
Ga0075272_10890852	3300005900	Rice Paddy Soil	MKMENLIQLWLNPINLGILFLCVTTGIWILAHSAPDHKDK*
Ga0075279_100542601	3300005903	Rice Paddy Soil	MKMENLIQLWLNPINLGILFLCVTTGIWILAHSAPDHKGK*
Ga0081539_100059368	3300005985	Tabebuia Heterophylla Rhizosphere	METLIQSWLNPINLGVFFLCLTVGIWILSKSAPTHRDK*
Ga0081539_100498243	3300005985	Tabebuia Heterophylla Rhizosphere	MENLLQLWLNPINLGILFLCMTVGIWLLAHTDPTRKDK*
Ga0075021_103250472	3300006354	Watersheds	MENLLQIWLNPINLGILFLCLCGGIWFLAHTAPNYRDK*
Ga0079222_126047212	3300006755	Agricultural Soil	MENLIQVWLNPINLGILFLCFSIGVWILAHSDPTRRDK*
Ga0075428_1009286022	3300006844	Populus Rhizosphere	MENLIQVWLNPINLGILFLCFTIGIWILAHSDPTRRDK*
Ga0075421_1003032182	3300006845	Populus Rhizosphere	MENLLQMWLNPINLGIFFLCFTVGIWILAHSAPNDKGK*
Ga0075421_1004704422	3300006845	Populus Rhizosphere	METLIQLWLDPINLGIFFLCLTVGIWILSKSGPTYRDK*
Ga0075421_1024845912	3300006845	Populus Rhizosphere	MKMEKIIEMWLNPVNLGVVFLCFTVGIWILAHSAPNQKDK*
Ga0075430_1009362342	3300006846	Populus Rhizosphere	MENLIQVWLNPINLGILFLCLTIGIWILAHSDPTRRDQ*
Ga0075433_100700153	3300006852	Populus Rhizosphere	MENVLQLWLNPINLGILFLCITVGIWILAHSDPTRRDK*
Ga0075433_109140882	3300006852	Populus Rhizosphere	MENLIQLWLNPVNLGIFFLCFTVGIWILAHSDPTRRDK*
Ga0075420_1012558982	3300006853	Populus Rhizosphere	MEKIVEMWLNPVNLGILFLCLTLGIWILSKSGPWNWDK*
Ga0073934_100141024	3300006865	Hot Spring Sediment	MENLIQVWLNPINLGILFLCLTLGIWILSKSGPWNWDK*
Ga0075429_1000485932	3300006880	Populus Rhizosphere	MENLLQMWLNPINLGIFFLCFTVGIWTLAHSAPNDKGK*
Ga0075429_1006912332	3300006880	Populus Rhizosphere	MENLIQVWLNPINLGILFLCLTIGIWILAHSDPTRRDK*
Ga0075429_1008402192	3300006880	Populus Rhizosphere	MQNLIQLWLDPINLGLFFLCITVGVWILAHSDPTRRDK*
Ga0075429_1010290272	3300006880	Populus Rhizosphere	MENLIQMWLNPINLGILFLCVAIGVWILAHSDPTRK
Ga0075429_1011393762	3300006880	Populus Rhizosphere	MEKIIEMWLNPINLGILFLCITVGVWILAHSDPTRKDK*
Ga0079218_111837392	3300007004	Agricultural Soil	MENLIQLWLNPINLGLFFLCITVGVWILAHSDPTRRDK*
Ga0105106_104455532	3300009078	Freshwater Sediment	MENVLQLWLNPINLGILFLCLTIGIWILAHSDPTRKDK*
Ga0105098_100008799	3300009081	Freshwater Sediment	MENVLQMWLNPINLGILFLCITAGIWLLAHSDPTRRDK*
Ga0105098_101956792	3300009081	Freshwater Sediment	MENLIQVWLNPVNLGILFLCLTIGIWILSKSGPWNWK*
Ga0102851_101033524	3300009091	Freshwater Wetlands	LGMWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK*
Ga0075418_122499072	3300009100	Populus Rhizosphere	MENLIQMWLNPINLGILFLCVAIGVWILAHSDPTRKDK*
Ga0075418_131682812	3300009100	Populus Rhizosphere	MENALQLWLNPINLGILFLCITVGIWILAQSDPTRRDK*
Ga0105091_100274193	3300009146	Freshwater Sediment	METILQTWLNPINLGILFLCLCAGIWLLAHTAPNQRDK*
Ga0114129_125272902	3300009147	Populus Rhizosphere	MQNLIQLWLNPINLGILFLCVTVGIWILAHSDPTRKNR*
Ga0105092_100337102	3300009157	Freshwater Sediment	MENVLQLWLNPINLGILFVCLTIGIWILSKSGPWNWK*
Ga0075423_130133602	3300009162	Populus Rhizosphere	MENVLQLWLNPLNLGILFLCITAGIWILAHSDPTRRDK*
Ga0113563_106965022	3300009167	Freshwater Wetlands	MNNILQLWLNPINLGILFLCFCIGIWLLAHTAPNDRGK*
Ga0113563_123228371	3300009167	Freshwater Wetlands	KLKFERKTNMEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK*
Ga0105104_100021681	3300009168	Freshwater Sediment	LLQMWLNPINLGVLFLCVTIGIWILAHSDPTRRDK*
Ga0105104_100027227	3300009168	Freshwater Sediment	MENVLQMWLNPLNLGILFLCVTIGIWILAHSDPTRRDK*
Ga0105104_102407912	3300009168	Freshwater Sediment	MENLIQIWLNPINLGILFLCVTVGIWILAHSDPTRRDK*
Ga0105104_107946372	3300009168	Freshwater Sediment	METLLQMWLNPINLGIFFLCITVGIWILAHSDSTRRDK*
Ga0126315_100316983	3300010038	Serpentine Soil	MENLIQLWLNPINLGILFLCITIGIWVLSKSGPNS*
Ga0126315_103439801	3300010038	Serpentine Soil	MENLIQIWLNPINLGILFLCITVGIWILAHSDPTRRDK*
Ga0126308_113612361	3300010040	Serpentine Soil	MENVLQMWLNPINLGILFLCLTVGIWILAHSDPTRRDK*
Ga0126312_106078341	3300010041	Serpentine Soil	MENLIQMWLNPINLGILFLCVTVGIWILAHSDPTRPDK*
Ga0126310_117393471	3300010044	Serpentine Soil	NLIQMWLNPINLGILFLCITVGIWILAHSDPTRRDK*
Ga0126377_100184066	3300010362	Tropical Forest Soil	METLIQSWLDPINMGVFFLCLTVGIWILSKSGPTYRDK*
Ga0136847_103721652	3300010391	Freshwater Sediment	MDNLLQLWLNPINLGILFLCICTGIWILAHSAPNYKDK*
Ga0137437_11017972	3300011442	Soil	MEKIIEMWLNPINLGILFLCITVGVWILAHSDPTRRDK*
Ga0137374_100244682	3300012204	Vadose Zone Soil	MEKLLQLWLNPINLGILFLCITIGIWILAHSDPTRKDK*
Ga0137374_100319212	3300012204	Vadose Zone Soil	MENLIQIWLNPINLGFFFLCITVGIWILAHSDPTRRDK*
Ga0137374_101057294	3300012204	Vadose Zone Soil	MDNLLQLWLNPINLGILFLCITVGIWILAHSDPTRRDK*
Ga0137367_100088088	3300012353	Vadose Zone Soil	MQNLVQMWLNPINLGILFLCITVGVWVLAHSDPTRRDK*
Ga0137367_100124005	3300012353	Vadose Zone Soil	MENLIQLWLNPINLGILFLCLTVGIWILAHSDPTRRNK*
Ga0137366_103984732	3300012354	Vadose Zone Soil	MQNLIQLWLNPLNLGILFLCLAIGVWILAHSDPNRRDK*
Ga0137369_100343513	3300012355	Vadose Zone Soil	MENVLQLWLNPINLGILFLCITVGIWILAHSDPNRRDR*
Ga0137337_10365632	3300012675	Soil	MENLIQLWLNPINLGILFLCLCAGIWILAHSDPTRK
Ga0157299_101137392	3300012899	Soil	MENLIQVWLNPINLGILFLCFSIGIWILAHSDPTRKDK*
Ga0153915_101225304	3300012931	Freshwater Wetlands	MQTILGIWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK*
Ga0153915_106532452	3300012931	Freshwater Wetlands	MQTILGTWLNPINLGVLFLCISAGIWLLAHTAPTNKGK*
Ga0153915_109788532	3300012931	Freshwater Wetlands	MEKILEMWLNPVDLGILVLCITAGIWILANSAPNNGKNK*
Ga0153916_102199163	3300012964	Freshwater Wetlands	MQTALSMWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK*
Ga0153916_105255933	3300012964	Freshwater Wetlands	MQTILGIWLNPINLGVLFLCLSAGIWLLAHTASTDKGK*
Ga0153916_106979402	3300012964	Freshwater Wetlands	MATILGMWLNPVNLGVLFLCITAGIWILAHSALTIRDK*
Ga0153916_133244741	3300012964	Freshwater Wetlands	MQNLILIWLNPINLGILFLCLCAGIWILSHSAPNYKDK*
Ga0120188_10178622	3300013760	Terrestrial	MENLIQLWLNPINLGILFLCLTLGIWILSKSGPWNWDK*
Ga0075322_10137173	3300014311	Natural And Restored Wetlands	MENVLQLCLNPLNLGILFLCITAGIWILAHSDPTRRDK*
Ga0075355_12547121	3300014322	Natural And Restored Wetlands	MEKIIAMWLNPINLGILFLCITGGIWILAHSDPNRRDK*
Ga0157380_116035182	3300014326	Switchgrass Rhizosphere	MENLIQVWLNPINLGILFLCFSIGIWILAHSDPTRRDK*
Ga0180085_10824823	3300015259	Soil	MENLIQLWLNPLNLGILFLCVTVGIWILSKSGPNTMDK*
Ga0132258_103908853	3300015371	Arabidopsis Rhizosphere	MENILQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK*
Ga0132258_124623562	3300015371	Arabidopsis Rhizosphere	MENLLQLWLNPIDLGILFLCITVGIWILAHSDPDRGNK*
Ga0184626_102893062	3300018053	Groundwater Sediment	MENLLQMWLNPINLGILFLCITIGIWILAHSAPTDKGN
Ga0184623_100520892	3300018056	Groundwater Sediment	MEKTIEMWLNPINLGILFLCLTVGIWILSKSGPNYRDK
Ga0184615_100422261	3300018059	Groundwater Sediment	EIQKGETKMENLIQMWLNPINLGILFLCLTVGIWILAHSAPDQKDK
Ga0184615_103005622	3300018059	Groundwater Sediment	MENLIQLWLNPINLGILFLCITVGIWILAHSDPGRGNK
Ga0184640_103416062	3300018074	Groundwater Sediment	MDHLLQLWLNPINLGVLFLCLCTGLWILSRCAPNYKDK
Ga0210377_1000401710	3300021090	Groundwater Sediment	MENLIQMWLNPINLGILFLCLTVGIWILAHSAPNQKGK
Ga0210377_100437394	3300021090	Groundwater Sediment	MENLIQLWLNPINLGILFLCVTTGIWILTHSAPDNKGK
Ga0210377_102350632	3300021090	Groundwater Sediment	MENLIQMWLNPINLGILFLCITIGIWILAHSDPTRKDK
Ga0210377_103978942	3300021090	Groundwater Sediment	MENLIQMWLNPINLGILFLCLTVGIWILAHSAPDQKDK
Ga0210377_104158482	3300021090	Groundwater Sediment	MEIQKGEIEMEKILVMWLSPINLGILFLCITIGIWILAHSDPTRKDK
Ga0209172_100525684	3300025310	Hot Spring Sediment	MENLIQVWLNPINLGILFLCLTLGIWILSKSGPWNWDK
Ga0210120_10286532	3300025556	Natural And Restored Wetlands	MQNILEMWLNPINLGILFLCISSGIWILAHSAPDYKDK
Ga0210138_10131482	3300025580	Natural And Restored Wetlands	MESLIQVWLNPINLGILFLCITAGIWILAHSDPTRRDK
Ga0210114_10825352	3300025795	Natural And Restored Wetlands	MENLLQQWLNPINLGILFLCVTIGIWILAHSDPTRKDK
Ga0207684_116097932	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MENVLQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK
Ga0207646_101161362	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MENILQLWLNPINLGILFLCITVGIWILAHSDPTRRDK
Ga0207670_102958102	3300025936	Switchgrass Rhizosphere	MENILQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK
Ga0208527_10120902	3300025990	Rice Paddy Soil	MENLIQLWLNPIDLGILFLCICTGIWILAHSAPTYKDK
Ga0207999_10160951	3300026010	Rice Paddy Soil	MENLIQLWLNPINLGILFLCLCTGVWILAHSAPNDKSK
Ga0207708_101185413	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MENVLQLWLNPVNLGILFLCITVGIWILAHSDPTRRDK
Ga0207676_103733252	3300026095	Switchgrass Rhizosphere	MEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK
Ga0207674_106967351	3300026116	Corn Rhizosphere	LKFERKTNMEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK
Ga0209593_100045486	3300027743	Freshwater Sediment	MENLLQMWLNPINLGVLFLCVTIGIWILAHSDPTRRDK
Ga0209593_100594562	3300027743	Freshwater Sediment	METILQTWLNPINLGILFLCLCAGIWLLAHTAPNQRDK
Ga0209593_100885362	3300027743	Freshwater Sediment	MENLIQVWLNPVNLGILFLCLTIGIWILSKSGPWNWK
Ga0209593_101893152	3300027743	Freshwater Sediment	MENVLQMWLNPLNLGILFLCVTIGIWILAHSDPTRRDK
Ga0209481_104187692	3300027880	Populus Rhizosphere	MENLLQMWLNPINLGIFFLCFTVGIWTLAHSAPNDKGK
Ga0208980_102594332	3300027887	Wetland	NMEKIIVMWLNPINLGILFLCITGGIWILAHSDPTRRDK
Ga0208980_103030372	3300027887	Wetland	MEKIIEMWLNPINLGILFLCVTGGIWILAHSDPARRDK
Ga0208980_103579372	3300027887	Wetland	MEKIIEMWLNPINLGILFLCLAGGIWILAHSDPTHRDK
Ga0209068_102660102	3300027894	Watersheds	MENLLQIWLNPINLGILFLCLCGGIWFLAHTAPNYRDK
Ga0209382_103857662	3300027909	Populus Rhizosphere	MEKIIEMWLNPVNLGVVFLCFTVGIWILAHSAPNQKDK
Ga0209382_112105202	3300027909	Populus Rhizosphere	METLIQLWLDPINLGIFFLCLTVGIWILSKSGPTYRDK
Ga0209820_10008972	3300027956	Freshwater Sediment	MENVLQMWLNPINLGILFLCITAGIWLLAHSDPTRRDK
Ga0209705_105767142	3300027979	Freshwater Sediment	MENVLQLWLNPINLGILFLCLTIGIWILAHSDPTRKDK
Ga0302162_100632322	3300028649	Fen	MQNLTELWLNPINLGILFLCFCAGVWILAHCAPNYKDK
Ga0265336_102232792	3300028666	Rhizosphere	MENMIQLWLNPINLGILFVCLCAGLWLLSHTAPNDK
Ga0302293_101511252	3300029981	Fen	MENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNTKDK
Ga0311365_117382271	3300029989	Fen	MESILQLWLNPINLGILFLCFCGGIWLLAHTAPNYKDK
Ga0311336_117064771	3300029990	Fen	LIALWLNPINVGILFLCFCGGIWLLAHTAPNYKDK
Ga0311350_106510322	3300030002	Fen	MENLLQTWLNPIDLGILFLCFCGGIWLLAHTAPNPKDK
Ga0311350_111117331	3300030002	Fen	MENVLQLWLNPVNLGILFLCLCAGIWILAHSAPNYKDK
Ga0311348_114835061	3300030019	Fen	METTLQLWLNPVNLGFLFVCLCAGIWILAHSAPNYKDK
Ga0302286_103675542	3300030047	Fen	MENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNSKDK
Ga0302286_106554671	3300030047	Fen	MENIIQFWLNPINLGILFLCLCGGIWLLAHTAPNPKDK
Ga0311333_101585022	3300030114	Fen	METTLQLWLNPINLGILFLCLCAGIWILAHSAPNYKDK
Ga0311366_102183472	3300030943	Fen	MENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNPKDK
Ga0311366_112207111	3300030943	Fen	MDRAKGENNMENLIALWLNPINVGILFLCFCGGIWLLAHTAPNYKDK
Ga0302323_1000994683	3300031232	Fen	METSLQLWLNPVNLGILFLCLCAGIWILAHSAPNYKDK
Ga0265331_102857331	3300031250	Rhizosphere	MENILQLWLNPIDLGILFLCLCGGLWLLSHTAPNPKDK
Ga0315556_10773673	3300031256	Salt Marsh Sediment	MNTILQMWLNPINLGLFFLCICTGIWILAHSAPNYKDK
Ga0311364_118646262	3300031521	Fen	QGENLMENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNSKDK
Ga0311364_119789462	3300031521	Fen	MQNLIQLWLNPINLGILFLCLCAGIWMLAHTAPNPKDK
Ga0247727_1000558423	3300031576	Biofilm	MDHLLQLWLNPINLGILFLCLCTGIWILAHSAPNYKDK
Ga0302321_1000033056	3300031726	Fen	MENLIALWLNPINVGILFLCFCGGIWLLAHTAPNYKDK
Ga0302321_1000722432	3300031726	Fen	MESILQLWLNPINLGILFLCFCGGIWLLAHTAPNHKDK
Ga0302321_1010631322	3300031726	Fen	MENILQLWLNPINLGILFLCFCGGIWLLAHTAPNHKDK
Ga0302321_1034240602	3300031726	Fen	METTLQLWLNPINLGILFVCLCAGIWILAHSAPNYKDK
Ga0214473_1000585711	3300031949	Soil	MENLLQMWLNPINLGILFLCLTVGIWILAHSDPTRKDK
Ga0214473_105165712	3300031949	Soil	MENLLQMWLNPINLGILILCLTIGIWILSKSGPWNWDK
Ga0310906_104913921	3300032013	Soil	IIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK
Ga0335079_1000574414	3300032783	Soil	METLLSLWLDPIHLGIFFLCLCTGIWILSHSAPSYRDK
Ga0335070_113941662	3300032829	Soil	NILLLWLNPLDLGIFFLCLCAGVWVLAHSAPASKDR
Ga0335069_100213083	3300032893	Soil	MQNILLLWLNPLDLGIFFLCLCAGVWVLAHSAPASKDR
Ga0335071_108075132	3300032897	Soil	MANILQLWLNPIDLGILFLCVCAGIWILAHSAPNYKDK
Ga0335076_110364532	3300032955	Soil	MDNLIQLWLNPIDLGIFFICIAIGVWILAHSAPNYKDK
Ga0326726_101628263	3300033433	Peat Soil	MENLIQIWLNPINLGILFLCLCGGLWLLSHTAPNTKDK
Ga0326726_101742222	3300033433	Peat Soil	MENLIQMWLNPVSLGIMFLCICAGVWILSHSAPNYKGK
Ga0316620_102725401	3300033480	Soil	MQTILGIWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK
Ga0316627_1010556412	3300033482	Soil	MEKYLEMWLNPINLGILFLCITIGIWILAHSDPTRRDK
Ga0316624_122640132	3300033486	Soil	MENLLATWLHPINLGILWLCITAGIWILAHSAPNWRDKE
Ga0316631_101917633	3300033493	Soil	MEKILAQWLNPVNLGILFLCLTGGIWVLAHTAPKNEDE
Ga0316628_1000123617	3300033513	Soil	MQTILGTWLNPINLGVLFLCISAGIWLLAHTAPTNKGK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F041238

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences