| Basic Information | |
|---|---|
| Family ID | F041238 |
| Family Type | Metagenome |
| Number of Sequences | 160 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MENLLQMWLNPINLGILFLCLTVGIWILAHSDPTRKDK |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.38 % |
| % of genes near scaffold ends (potentially truncated) | 11.88 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.750 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (28.125 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 37.50 |
| PF05368 | NmrA | 7.50 |
| PF08241 | Methyltransf_11 | 4.38 |
| PF01494 | FAD_binding_3 | 3.75 |
| PF13649 | Methyltransf_25 | 3.75 |
| PF12697 | Abhydrolase_6 | 3.12 |
| PF01565 | FAD_binding_4 | 0.62 |
| PF06155 | GBBH-like_N | 0.62 |
| PF01061 | ABC2_membrane | 0.62 |
| PF13460 | NAD_binding_10 | 0.62 |
| PF13808 | DDE_Tnp_1_assoc | 0.62 |
| PF13304 | AAA_21 | 0.62 |
| PF12838 | Fer4_7 | 0.62 |
| PF06197 | DUF998 | 0.62 |
| PF09939 | DUF2171 | 0.62 |
| PF00420 | Oxidored_q2 | 0.62 |
| PF02913 | FAD-oxidase_C | 0.62 |
| PF03720 | UDPG_MGDP_dh_C | 0.62 |
| PF01797 | Y1_Tnp | 0.62 |
| PF07394 | DUF1501 | 0.62 |
| PF12146 | Hydrolase_4 | 0.62 |
| PF05762 | VWA_CoxE | 0.62 |
| PF00892 | EamA | 0.62 |
| PF00440 | TetR_N | 0.62 |
| PF13263 | PHP_C | 0.62 |
| PF02775 | TPP_enzyme_C | 0.62 |
| PF00107 | ADH_zinc_N | 0.62 |
| PF13426 | PAS_9 | 0.62 |
| PF00196 | GerE | 0.62 |
| PF13332 | Fil_haemagg_2 | 0.62 |
| PF00756 | Esterase | 0.62 |
| PF01925 | TauE | 0.62 |
| PF00072 | Response_reg | 0.62 |
| PF12847 | Methyltransf_18 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 7.50 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.75 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.75 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 3.75 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.62 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.62 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.62 |
| COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.75 % |
| Unclassified | root | N/A | 6.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886006|SwRhRL3b_contig_4438135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 858 | Open in IMG/M |
| 3300000956|JGI10216J12902_103154102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300000956|JGI10216J12902_105474955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 825 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101865385 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103289715 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103820419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 896 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107549887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 578 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107918529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108661748 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109283091 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005205|Ga0068999_10065998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
| 3300005213|Ga0068998_10024462 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300005617|Ga0068859_100902352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 968 | Open in IMG/M |
| 3300005617|Ga0068859_101795359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 677 | Open in IMG/M |
| 3300005618|Ga0068864_101200023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 757 | Open in IMG/M |
| 3300005836|Ga0074470_10985685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 64361 | Open in IMG/M |
| 3300005842|Ga0068858_100274071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
| 3300005843|Ga0068860_101485699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 699 | Open in IMG/M |
| 3300005893|Ga0075278_1012316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1120 | Open in IMG/M |
| 3300005900|Ga0075272_1089085 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005903|Ga0075279_10054260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 673 | Open in IMG/M |
| 3300005985|Ga0081539_10005936 | All Organisms → cellular organisms → Bacteria | 12056 | Open in IMG/M |
| 3300005985|Ga0081539_10049824 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
| 3300006354|Ga0075021_10325047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 956 | Open in IMG/M |
| 3300006755|Ga0079222_12604721 | Not Available | 509 | Open in IMG/M |
| 3300006844|Ga0075428_100928602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 922 | Open in IMG/M |
| 3300006845|Ga0075421_100303218 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300006845|Ga0075421_100470442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1498 | Open in IMG/M |
| 3300006845|Ga0075421_102484591 | Not Available | 540 | Open in IMG/M |
| 3300006846|Ga0075430_100936234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 714 | Open in IMG/M |
| 3300006852|Ga0075433_10070015 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
| 3300006852|Ga0075433_10914088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 765 | Open in IMG/M |
| 3300006853|Ga0075420_101255898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium botulinum | 636 | Open in IMG/M |
| 3300006865|Ga0073934_10014102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 9136 | Open in IMG/M |
| 3300006880|Ga0075429_100048593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 3689 | Open in IMG/M |
| 3300006880|Ga0075429_100691233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 894 | Open in IMG/M |
| 3300006880|Ga0075429_100840219 | Not Available | 804 | Open in IMG/M |
| 3300006880|Ga0075429_101029027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 720 | Open in IMG/M |
| 3300006880|Ga0075429_101139376 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300007004|Ga0079218_11183739 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009078|Ga0105106_10445553 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300009081|Ga0105098_10000879 | All Organisms → cellular organisms → Bacteria | 10708 | Open in IMG/M |
| 3300009081|Ga0105098_10195679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium botulinum | 931 | Open in IMG/M |
| 3300009091|Ga0102851_10103352 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300009100|Ga0075418_12249907 | Not Available | 595 | Open in IMG/M |
| 3300009100|Ga0075418_13168281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300009146|Ga0105091_10027419 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300009147|Ga0114129_12527290 | Not Available | 614 | Open in IMG/M |
| 3300009157|Ga0105092_10033710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2723 | Open in IMG/M |
| 3300009162|Ga0075423_13013360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
| 3300009167|Ga0113563_10696502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1138 | Open in IMG/M |
| 3300009167|Ga0113563_12322837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 645 | Open in IMG/M |
| 3300009168|Ga0105104_10002168 | All Organisms → cellular organisms → Bacteria | 14466 | Open in IMG/M |
| 3300009168|Ga0105104_10002722 | All Organisms → cellular organisms → Bacteria | 12774 | Open in IMG/M |
| 3300009168|Ga0105104_10240791 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300009168|Ga0105104_10794637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300010038|Ga0126315_10031698 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
| 3300010038|Ga0126315_10343980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 928 | Open in IMG/M |
| 3300010040|Ga0126308_11361236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300010041|Ga0126312_10607834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 786 | Open in IMG/M |
| 3300010044|Ga0126310_11739347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 519 | Open in IMG/M |
| 3300010362|Ga0126377_10018406 | All Organisms → cellular organisms → Bacteria | 5693 | Open in IMG/M |
| 3300010391|Ga0136847_10372165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2745 | Open in IMG/M |
| 3300011442|Ga0137437_1101797 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300012204|Ga0137374_10024468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 6754 | Open in IMG/M |
| 3300012204|Ga0137374_10031921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 5742 | Open in IMG/M |
| 3300012204|Ga0137374_10105729 | All Organisms → cellular organisms → Bacteria | 2637 | Open in IMG/M |
| 3300012353|Ga0137367_10008808 | All Organisms → cellular organisms → Bacteria | 8061 | Open in IMG/M |
| 3300012353|Ga0137367_10012400 | All Organisms → cellular organisms → Bacteria | 6782 | Open in IMG/M |
| 3300012354|Ga0137366_10398473 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300012355|Ga0137369_10034351 | All Organisms → cellular organisms → Bacteria | 4609 | Open in IMG/M |
| 3300012675|Ga0137337_1036563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 749 | Open in IMG/M |
| 3300012899|Ga0157299_10113739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 718 | Open in IMG/M |
| 3300012931|Ga0153915_10122530 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
| 3300012931|Ga0153915_10653245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1212 | Open in IMG/M |
| 3300012931|Ga0153915_10978853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 985 | Open in IMG/M |
| 3300012964|Ga0153916_10219916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii | 1901 | Open in IMG/M |
| 3300012964|Ga0153916_10525593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 1255 | Open in IMG/M |
| 3300012964|Ga0153916_10697940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1094 | Open in IMG/M |
| 3300012964|Ga0153916_13324474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 505 | Open in IMG/M |
| 3300013760|Ga0120188_1017862 | Not Available | 715 | Open in IMG/M |
| 3300014311|Ga0075322_1013717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1597 | Open in IMG/M |
| 3300014322|Ga0075355_1254712 | Not Available | 508 | Open in IMG/M |
| 3300014326|Ga0157380_11603518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 706 | Open in IMG/M |
| 3300015259|Ga0180085_1082482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 939 | Open in IMG/M |
| 3300015371|Ga0132258_10390885 | All Organisms → cellular organisms → Bacteria | 3453 | Open in IMG/M |
| 3300015371|Ga0132258_12462356 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300018053|Ga0184626_10289306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella kolymensis | 681 | Open in IMG/M |
| 3300018056|Ga0184623_10052089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1871 | Open in IMG/M |
| 3300018059|Ga0184615_10042226 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300018059|Ga0184615_10300562 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300018074|Ga0184640_10341606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 679 | Open in IMG/M |
| 3300021090|Ga0210377_10004017 | All Organisms → cellular organisms → Bacteria | 12470 | Open in IMG/M |
| 3300021090|Ga0210377_10043739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3131 | Open in IMG/M |
| 3300021090|Ga0210377_10235063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1151 | Open in IMG/M |
| 3300021090|Ga0210377_10397894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 818 | Open in IMG/M |
| 3300021090|Ga0210377_10415848 | Not Available | 795 | Open in IMG/M |
| 3300025310|Ga0209172_10052568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2519 | Open in IMG/M |
| 3300025556|Ga0210120_1028653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 1084 | Open in IMG/M |
| 3300025580|Ga0210138_1013148 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300025795|Ga0210114_1082535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 655 | Open in IMG/M |
| 3300025910|Ga0207684_11609793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 526 | Open in IMG/M |
| 3300025922|Ga0207646_10116136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2404 | Open in IMG/M |
| 3300025936|Ga0207670_10295810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1266 | Open in IMG/M |
| 3300025990|Ga0208527_1012090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300026010|Ga0207999_1016095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 691 | Open in IMG/M |
| 3300026075|Ga0207708_10118541 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300026095|Ga0207676_10373325 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300026116|Ga0207674_10696735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 981 | Open in IMG/M |
| 3300027743|Ga0209593_10004548 | All Organisms → cellular organisms → Bacteria | 5806 | Open in IMG/M |
| 3300027743|Ga0209593_10059456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1456 | Open in IMG/M |
| 3300027743|Ga0209593_10088536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1149 | Open in IMG/M |
| 3300027743|Ga0209593_10189315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300027880|Ga0209481_10418769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 688 | Open in IMG/M |
| 3300027887|Ga0208980_10259433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1010 | Open in IMG/M |
| 3300027887|Ga0208980_10303037 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300027887|Ga0208980_10357937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 844 | Open in IMG/M |
| 3300027894|Ga0209068_10266010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 956 | Open in IMG/M |
| 3300027909|Ga0209382_10385766 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300027909|Ga0209382_11210520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 772 | Open in IMG/M |
| 3300027956|Ga0209820_1000897 | All Organisms → cellular organisms → Bacteria | 7310 | Open in IMG/M |
| 3300027979|Ga0209705_10576714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 540 | Open in IMG/M |
| 3300028649|Ga0302162_10063232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300028666|Ga0265336_10223279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 559 | Open in IMG/M |
| 3300029981|Ga0302293_10151125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 736 | Open in IMG/M |
| 3300029989|Ga0311365_11738227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 534 | Open in IMG/M |
| 3300029990|Ga0311336_11706477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 556 | Open in IMG/M |
| 3300030002|Ga0311350_10651032 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300030002|Ga0311350_11111733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 705 | Open in IMG/M |
| 3300030019|Ga0311348_11483506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 504 | Open in IMG/M |
| 3300030047|Ga0302286_10367554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 725 | Open in IMG/M |
| 3300030047|Ga0302286_10655467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 535 | Open in IMG/M |
| 3300030114|Ga0311333_10158502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1735 | Open in IMG/M |
| 3300030943|Ga0311366_10218347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1648 | Open in IMG/M |
| 3300030943|Ga0311366_11220711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 648 | Open in IMG/M |
| 3300031232|Ga0302323_100099468 | All Organisms → cellular organisms → Bacteria | 2799 | Open in IMG/M |
| 3300031250|Ga0265331_10285733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 739 | Open in IMG/M |
| 3300031256|Ga0315556_1077367 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300031521|Ga0311364_11864626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 591 | Open in IMG/M |
| 3300031521|Ga0311364_11978946 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031576|Ga0247727_10005584 | All Organisms → cellular organisms → Bacteria | 25379 | Open in IMG/M |
| 3300031726|Ga0302321_100003305 | All Organisms → cellular organisms → Bacteria | 13827 | Open in IMG/M |
| 3300031726|Ga0302321_100072243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3389 | Open in IMG/M |
| 3300031726|Ga0302321_101063132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 923 | Open in IMG/M |
| 3300031726|Ga0302321_103424060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 516 | Open in IMG/M |
| 3300031949|Ga0214473_10005857 | All Organisms → cellular organisms → Bacteria | 14701 | Open in IMG/M |
| 3300031949|Ga0214473_10516571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1331 | Open in IMG/M |
| 3300032013|Ga0310906_10491392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 829 | Open in IMG/M |
| 3300032783|Ga0335079_10005744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 14203 | Open in IMG/M |
| 3300032829|Ga0335070_11394166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 640 | Open in IMG/M |
| 3300032893|Ga0335069_10021308 | All Organisms → cellular organisms → Bacteria | 8955 | Open in IMG/M |
| 3300032897|Ga0335071_10807513 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300032955|Ga0335076_11036453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 703 | Open in IMG/M |
| 3300033433|Ga0326726_10162826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2042 | Open in IMG/M |
| 3300033433|Ga0326726_10174222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1974 | Open in IMG/M |
| 3300033480|Ga0316620_10272540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1464 | Open in IMG/M |
| 3300033482|Ga0316627_101055641 | Not Available | 793 | Open in IMG/M |
| 3300033486|Ga0316624_12264013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 506 | Open in IMG/M |
| 3300033493|Ga0316631_10191763 | Not Available | 781 | Open in IMG/M |
| 3300033513|Ga0316628_100012361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii | 7481 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 11.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 9.38% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.25% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 4.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.12% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.12% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.88% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.25% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.25% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.25% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.25% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.25% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.62% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.62% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.62% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026010 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300029981 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL3b_0236.00001920 | 2162886006 | Switchgrass Rhizosphere | MENVLQLWLNPINLGILFLCITVGIWILAHSDPTRRDK |
| JGI10216J12902_1031541022 | 3300000956 | Soil | MNSLIQLWLNPVNLGILFLCLTIGIWVLSKAGPWNWDK* |
| JGI10216J12902_1054749551 | 3300000956 | Soil | MQNLIQLWLNPINLGILFLCFTIGIWILAHSDPTRRDK* |
| JGIcombinedJ13530_1018653851 | 3300001213 | Wetland | KIIEMWLNPINLGILFLCLAGGIWILAHSDPTHRDK* |
| JGIcombinedJ13530_1032897152 | 3300001213 | Wetland | ENLLQTWLNPINLGILFLCLCGGIWLLSHTDPNSKHK* |
| JGIcombinedJ13530_1038204191 | 3300001213 | Wetland | MDKIIVMWLNPINLGILFLCLAGGVWILAHSDPNRRDK* |
| JGIcombinedJ13530_1075498871 | 3300001213 | Wetland | KLKFERKTNMEKIIAMWLNPINLGILFLCITGGIWILAHSDPTRRDK* |
| JGIcombinedJ13530_1079185292 | 3300001213 | Wetland | KILEMWLNPINLGIVFLCLCGGIWLLSHTAPHNWKDK* |
| JGIcombinedJ13530_1086617482 | 3300001213 | Wetland | MNSILQLWLNPINLGILFLCLCAGVWILAHSAPNYKDK* |
| JGIcombinedJ13530_1092830911 | 3300001213 | Wetland | TNMEKIIEMWLNPINLGILFLCLTGGIWILAHSDPTRRDK* |
| Ga0068999_100659981 | 3300005205 | Natural And Restored Wetlands | MEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRREKY* |
| Ga0068998_100244622 | 3300005213 | Natural And Restored Wetlands | MNMEKIIEMWLNPINLGILFLCLTGGIWILAHSDPTRRDK* |
| Ga0068859_1009023522 | 3300005617 | Switchgrass Rhizosphere | MENLIQLWLNPVNLGIFFLCSTVGIWILAHSDPTRRDK* |
| Ga0068859_1017953591 | 3300005617 | Switchgrass Rhizosphere | MENVLQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK* |
| Ga0068864_1012000232 | 3300005618 | Switchgrass Rhizosphere | MEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK* |
| Ga0074470_1098568551 | 3300005836 | Sediment (Intertidal) | MENILQQWLNPINLGILFVCLCAGIWLLAHTAPNYKDK* |
| Ga0068858_1002740712 | 3300005842 | Switchgrass Rhizosphere | MENLLQLWLNPIDLGIFFLCITLGIWILAHSDASHRNK* |
| Ga0068860_1014856992 | 3300005843 | Switchgrass Rhizosphere | MENVLQLWLSPLNLGILFLCITVGIWILAHSDPTRRDK* |
| Ga0075278_10123162 | 3300005893 | Rice Paddy Soil | MENTIQLWLNPINLGILFLCLCGGLWLLSHTAPNDKNK* |
| Ga0075272_10890852 | 3300005900 | Rice Paddy Soil | MKMENLIQLWLNPINLGILFLCVTTGIWILAHSAPDHKDK* |
| Ga0075279_100542601 | 3300005903 | Rice Paddy Soil | MKMENLIQLWLNPINLGILFLCVTTGIWILAHSAPDHKGK* |
| Ga0081539_100059368 | 3300005985 | Tabebuia Heterophylla Rhizosphere | METLIQSWLNPINLGVFFLCLTVGIWILSKSAPTHRDK* |
| Ga0081539_100498243 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MENLLQLWLNPINLGILFLCMTVGIWLLAHTDPTRKDK* |
| Ga0075021_103250472 | 3300006354 | Watersheds | MENLLQIWLNPINLGILFLCLCGGIWFLAHTAPNYRDK* |
| Ga0079222_126047212 | 3300006755 | Agricultural Soil | MENLIQVWLNPINLGILFLCFSIGVWILAHSDPTRRDK* |
| Ga0075428_1009286022 | 3300006844 | Populus Rhizosphere | MENLIQVWLNPINLGILFLCFTIGIWILAHSDPTRRDK* |
| Ga0075421_1003032182 | 3300006845 | Populus Rhizosphere | MENLLQMWLNPINLGIFFLCFTVGIWILAHSAPNDKGK* |
| Ga0075421_1004704422 | 3300006845 | Populus Rhizosphere | METLIQLWLDPINLGIFFLCLTVGIWILSKSGPTYRDK* |
| Ga0075421_1024845912 | 3300006845 | Populus Rhizosphere | MKMEKIIEMWLNPVNLGVVFLCFTVGIWILAHSAPNQKDK* |
| Ga0075430_1009362342 | 3300006846 | Populus Rhizosphere | MENLIQVWLNPINLGILFLCLTIGIWILAHSDPTRRDQ* |
| Ga0075433_100700153 | 3300006852 | Populus Rhizosphere | MENVLQLWLNPINLGILFLCITVGIWILAHSDPTRRDK* |
| Ga0075433_109140882 | 3300006852 | Populus Rhizosphere | MENLIQLWLNPVNLGIFFLCFTVGIWILAHSDPTRRDK* |
| Ga0075420_1012558982 | 3300006853 | Populus Rhizosphere | MEKIVEMWLNPVNLGILFLCLTLGIWILSKSGPWNWDK* |
| Ga0073934_100141024 | 3300006865 | Hot Spring Sediment | MENLIQVWLNPINLGILFLCLTLGIWILSKSGPWNWDK* |
| Ga0075429_1000485932 | 3300006880 | Populus Rhizosphere | MENLLQMWLNPINLGIFFLCFTVGIWTLAHSAPNDKGK* |
| Ga0075429_1006912332 | 3300006880 | Populus Rhizosphere | MENLIQVWLNPINLGILFLCLTIGIWILAHSDPTRRDK* |
| Ga0075429_1008402192 | 3300006880 | Populus Rhizosphere | MQNLIQLWLDPINLGLFFLCITVGVWILAHSDPTRRDK* |
| Ga0075429_1010290272 | 3300006880 | Populus Rhizosphere | MENLIQMWLNPINLGILFLCVAIGVWILAHSDPTRK |
| Ga0075429_1011393762 | 3300006880 | Populus Rhizosphere | MEKIIEMWLNPINLGILFLCITVGVWILAHSDPTRKDK* |
| Ga0079218_111837392 | 3300007004 | Agricultural Soil | MENLIQLWLNPINLGLFFLCITVGVWILAHSDPTRRDK* |
| Ga0105106_104455532 | 3300009078 | Freshwater Sediment | MENVLQLWLNPINLGILFLCLTIGIWILAHSDPTRKDK* |
| Ga0105098_100008799 | 3300009081 | Freshwater Sediment | MENVLQMWLNPINLGILFLCITAGIWLLAHSDPTRRDK* |
| Ga0105098_101956792 | 3300009081 | Freshwater Sediment | MENLIQVWLNPVNLGILFLCLTIGIWILSKSGPWNWK* |
| Ga0102851_101033524 | 3300009091 | Freshwater Wetlands | LGMWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK* |
| Ga0075418_122499072 | 3300009100 | Populus Rhizosphere | MENLIQMWLNPINLGILFLCVAIGVWILAHSDPTRKDK* |
| Ga0075418_131682812 | 3300009100 | Populus Rhizosphere | MENALQLWLNPINLGILFLCITVGIWILAQSDPTRRDK* |
| Ga0105091_100274193 | 3300009146 | Freshwater Sediment | METILQTWLNPINLGILFLCLCAGIWLLAHTAPNQRDK* |
| Ga0114129_125272902 | 3300009147 | Populus Rhizosphere | MQNLIQLWLNPINLGILFLCVTVGIWILAHSDPTRKNR* |
| Ga0105092_100337102 | 3300009157 | Freshwater Sediment | MENVLQLWLNPINLGILFVCLTIGIWILSKSGPWNWK* |
| Ga0075423_130133602 | 3300009162 | Populus Rhizosphere | MENVLQLWLNPLNLGILFLCITAGIWILAHSDPTRRDK* |
| Ga0113563_106965022 | 3300009167 | Freshwater Wetlands | MNNILQLWLNPINLGILFLCFCIGIWLLAHTAPNDRGK* |
| Ga0113563_123228371 | 3300009167 | Freshwater Wetlands | KLKFERKTNMEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK* |
| Ga0105104_100021681 | 3300009168 | Freshwater Sediment | LLQMWLNPINLGVLFLCVTIGIWILAHSDPTRRDK* |
| Ga0105104_100027227 | 3300009168 | Freshwater Sediment | MENVLQMWLNPLNLGILFLCVTIGIWILAHSDPTRRDK* |
| Ga0105104_102407912 | 3300009168 | Freshwater Sediment | MENLIQIWLNPINLGILFLCVTVGIWILAHSDPTRRDK* |
| Ga0105104_107946372 | 3300009168 | Freshwater Sediment | METLLQMWLNPINLGIFFLCITVGIWILAHSDSTRRDK* |
| Ga0126315_100316983 | 3300010038 | Serpentine Soil | MENLIQLWLNPINLGILFLCITIGIWVLSKSGPNS* |
| Ga0126315_103439801 | 3300010038 | Serpentine Soil | MENLIQIWLNPINLGILFLCITVGIWILAHSDPTRRDK* |
| Ga0126308_113612361 | 3300010040 | Serpentine Soil | MENVLQMWLNPINLGILFLCLTVGIWILAHSDPTRRDK* |
| Ga0126312_106078341 | 3300010041 | Serpentine Soil | MENLIQMWLNPINLGILFLCVTVGIWILAHSDPTRPDK* |
| Ga0126310_117393471 | 3300010044 | Serpentine Soil | NLIQMWLNPINLGILFLCITVGIWILAHSDPTRRDK* |
| Ga0126377_100184066 | 3300010362 | Tropical Forest Soil | METLIQSWLDPINMGVFFLCLTVGIWILSKSGPTYRDK* |
| Ga0136847_103721652 | 3300010391 | Freshwater Sediment | MDNLLQLWLNPINLGILFLCICTGIWILAHSAPNYKDK* |
| Ga0137437_11017972 | 3300011442 | Soil | MEKIIEMWLNPINLGILFLCITVGVWILAHSDPTRRDK* |
| Ga0137374_100244682 | 3300012204 | Vadose Zone Soil | MEKLLQLWLNPINLGILFLCITIGIWILAHSDPTRKDK* |
| Ga0137374_100319212 | 3300012204 | Vadose Zone Soil | MENLIQIWLNPINLGFFFLCITVGIWILAHSDPTRRDK* |
| Ga0137374_101057294 | 3300012204 | Vadose Zone Soil | MDNLLQLWLNPINLGILFLCITVGIWILAHSDPTRRDK* |
| Ga0137367_100088088 | 3300012353 | Vadose Zone Soil | MQNLVQMWLNPINLGILFLCITVGVWVLAHSDPTRRDK* |
| Ga0137367_100124005 | 3300012353 | Vadose Zone Soil | MENLIQLWLNPINLGILFLCLTVGIWILAHSDPTRRNK* |
| Ga0137366_103984732 | 3300012354 | Vadose Zone Soil | MQNLIQLWLNPLNLGILFLCLAIGVWILAHSDPNRRDK* |
| Ga0137369_100343513 | 3300012355 | Vadose Zone Soil | MENVLQLWLNPINLGILFLCITVGIWILAHSDPNRRDR* |
| Ga0137337_10365632 | 3300012675 | Soil | MENLIQLWLNPINLGILFLCLCAGIWILAHSDPTRK |
| Ga0157299_101137392 | 3300012899 | Soil | MENLIQVWLNPINLGILFLCFSIGIWILAHSDPTRKDK* |
| Ga0153915_101225304 | 3300012931 | Freshwater Wetlands | MQTILGIWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK* |
| Ga0153915_106532452 | 3300012931 | Freshwater Wetlands | MQTILGTWLNPINLGVLFLCISAGIWLLAHTAPTNKGK* |
| Ga0153915_109788532 | 3300012931 | Freshwater Wetlands | MEKILEMWLNPVDLGILVLCITAGIWILANSAPNNGKNK* |
| Ga0153916_102199163 | 3300012964 | Freshwater Wetlands | MQTALSMWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK* |
| Ga0153916_105255933 | 3300012964 | Freshwater Wetlands | MQTILGIWLNPINLGVLFLCLSAGIWLLAHTASTDKGK* |
| Ga0153916_106979402 | 3300012964 | Freshwater Wetlands | MATILGMWLNPVNLGVLFLCITAGIWILAHSALTIRDK* |
| Ga0153916_133244741 | 3300012964 | Freshwater Wetlands | MQNLILIWLNPINLGILFLCLCAGIWILSHSAPNYKDK* |
| Ga0120188_10178622 | 3300013760 | Terrestrial | MENLIQLWLNPINLGILFLCLTLGIWILSKSGPWNWDK* |
| Ga0075322_10137173 | 3300014311 | Natural And Restored Wetlands | MENVLQLCLNPLNLGILFLCITAGIWILAHSDPTRRDK* |
| Ga0075355_12547121 | 3300014322 | Natural And Restored Wetlands | MEKIIAMWLNPINLGILFLCITGGIWILAHSDPNRRDK* |
| Ga0157380_116035182 | 3300014326 | Switchgrass Rhizosphere | MENLIQVWLNPINLGILFLCFSIGIWILAHSDPTRRDK* |
| Ga0180085_10824823 | 3300015259 | Soil | MENLIQLWLNPLNLGILFLCVTVGIWILSKSGPNTMDK* |
| Ga0132258_103908853 | 3300015371 | Arabidopsis Rhizosphere | MENILQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK* |
| Ga0132258_124623562 | 3300015371 | Arabidopsis Rhizosphere | MENLLQLWLNPIDLGILFLCITVGIWILAHSDPDRGNK* |
| Ga0184626_102893062 | 3300018053 | Groundwater Sediment | MENLLQMWLNPINLGILFLCITIGIWILAHSAPTDKGN |
| Ga0184623_100520892 | 3300018056 | Groundwater Sediment | MEKTIEMWLNPINLGILFLCLTVGIWILSKSGPNYRDK |
| Ga0184615_100422261 | 3300018059 | Groundwater Sediment | EIQKGETKMENLIQMWLNPINLGILFLCLTVGIWILAHSAPDQKDK |
| Ga0184615_103005622 | 3300018059 | Groundwater Sediment | MENLIQLWLNPINLGILFLCITVGIWILAHSDPGRGNK |
| Ga0184640_103416062 | 3300018074 | Groundwater Sediment | MDHLLQLWLNPINLGVLFLCLCTGLWILSRCAPNYKDK |
| Ga0210377_1000401710 | 3300021090 | Groundwater Sediment | MENLIQMWLNPINLGILFLCLTVGIWILAHSAPNQKGK |
| Ga0210377_100437394 | 3300021090 | Groundwater Sediment | MENLIQLWLNPINLGILFLCVTTGIWILTHSAPDNKGK |
| Ga0210377_102350632 | 3300021090 | Groundwater Sediment | MENLIQMWLNPINLGILFLCITIGIWILAHSDPTRKDK |
| Ga0210377_103978942 | 3300021090 | Groundwater Sediment | MENLIQMWLNPINLGILFLCLTVGIWILAHSAPDQKDK |
| Ga0210377_104158482 | 3300021090 | Groundwater Sediment | MEIQKGEIEMEKILVMWLSPINLGILFLCITIGIWILAHSDPTRKDK |
| Ga0209172_100525684 | 3300025310 | Hot Spring Sediment | MENLIQVWLNPINLGILFLCLTLGIWILSKSGPWNWDK |
| Ga0210120_10286532 | 3300025556 | Natural And Restored Wetlands | MQNILEMWLNPINLGILFLCISSGIWILAHSAPDYKDK |
| Ga0210138_10131482 | 3300025580 | Natural And Restored Wetlands | MESLIQVWLNPINLGILFLCITAGIWILAHSDPTRRDK |
| Ga0210114_10825352 | 3300025795 | Natural And Restored Wetlands | MENLLQQWLNPINLGILFLCVTIGIWILAHSDPTRKDK |
| Ga0207684_116097932 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MENVLQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK |
| Ga0207646_101161362 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MENILQLWLNPINLGILFLCITVGIWILAHSDPTRRDK |
| Ga0207670_102958102 | 3300025936 | Switchgrass Rhizosphere | MENILQLWLNPLNLGILFLCITVGIWILAHSDPTRRDK |
| Ga0208527_10120902 | 3300025990 | Rice Paddy Soil | MENLIQLWLNPIDLGILFLCICTGIWILAHSAPTYKDK |
| Ga0207999_10160951 | 3300026010 | Rice Paddy Soil | MENLIQLWLNPINLGILFLCLCTGVWILAHSAPNDKSK |
| Ga0207708_101185413 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MENVLQLWLNPVNLGILFLCITVGIWILAHSDPTRRDK |
| Ga0207676_103733252 | 3300026095 | Switchgrass Rhizosphere | MEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK |
| Ga0207674_106967351 | 3300026116 | Corn Rhizosphere | LKFERKTNMEKIIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK |
| Ga0209593_100045486 | 3300027743 | Freshwater Sediment | MENLLQMWLNPINLGVLFLCVTIGIWILAHSDPTRRDK |
| Ga0209593_100594562 | 3300027743 | Freshwater Sediment | METILQTWLNPINLGILFLCLCAGIWLLAHTAPNQRDK |
| Ga0209593_100885362 | 3300027743 | Freshwater Sediment | MENLIQVWLNPVNLGILFLCLTIGIWILSKSGPWNWK |
| Ga0209593_101893152 | 3300027743 | Freshwater Sediment | MENVLQMWLNPLNLGILFLCVTIGIWILAHSDPTRRDK |
| Ga0209481_104187692 | 3300027880 | Populus Rhizosphere | MENLLQMWLNPINLGIFFLCFTVGIWTLAHSAPNDKGK |
| Ga0208980_102594332 | 3300027887 | Wetland | NMEKIIVMWLNPINLGILFLCITGGIWILAHSDPTRRDK |
| Ga0208980_103030372 | 3300027887 | Wetland | MEKIIEMWLNPINLGILFLCVTGGIWILAHSDPARRDK |
| Ga0208980_103579372 | 3300027887 | Wetland | MEKIIEMWLNPINLGILFLCLAGGIWILAHSDPTHRDK |
| Ga0209068_102660102 | 3300027894 | Watersheds | MENLLQIWLNPINLGILFLCLCGGIWFLAHTAPNYRDK |
| Ga0209382_103857662 | 3300027909 | Populus Rhizosphere | MEKIIEMWLNPVNLGVVFLCFTVGIWILAHSAPNQKDK |
| Ga0209382_112105202 | 3300027909 | Populus Rhizosphere | METLIQLWLDPINLGIFFLCLTVGIWILSKSGPTYRDK |
| Ga0209820_10008972 | 3300027956 | Freshwater Sediment | MENVLQMWLNPINLGILFLCITAGIWLLAHSDPTRRDK |
| Ga0209705_105767142 | 3300027979 | Freshwater Sediment | MENVLQLWLNPINLGILFLCLTIGIWILAHSDPTRKDK |
| Ga0302162_100632322 | 3300028649 | Fen | MQNLTELWLNPINLGILFLCFCAGVWILAHCAPNYKDK |
| Ga0265336_102232792 | 3300028666 | Rhizosphere | MENMIQLWLNPINLGILFVCLCAGLWLLSHTAPNDK |
| Ga0302293_101511252 | 3300029981 | Fen | MENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNTKDK |
| Ga0311365_117382271 | 3300029989 | Fen | MESILQLWLNPINLGILFLCFCGGIWLLAHTAPNYKDK |
| Ga0311336_117064771 | 3300029990 | Fen | LIALWLNPINVGILFLCFCGGIWLLAHTAPNYKDK |
| Ga0311350_106510322 | 3300030002 | Fen | MENLLQTWLNPIDLGILFLCFCGGIWLLAHTAPNPKDK |
| Ga0311350_111117331 | 3300030002 | Fen | MENVLQLWLNPVNLGILFLCLCAGIWILAHSAPNYKDK |
| Ga0311348_114835061 | 3300030019 | Fen | METTLQLWLNPVNLGFLFVCLCAGIWILAHSAPNYKDK |
| Ga0302286_103675542 | 3300030047 | Fen | MENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNSKDK |
| Ga0302286_106554671 | 3300030047 | Fen | MENIIQFWLNPINLGILFLCLCGGIWLLAHTAPNPKDK |
| Ga0311333_101585022 | 3300030114 | Fen | METTLQLWLNPINLGILFLCLCAGIWILAHSAPNYKDK |
| Ga0311366_102183472 | 3300030943 | Fen | MENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNPKDK |
| Ga0311366_112207111 | 3300030943 | Fen | MDRAKGENNMENLIALWLNPINVGILFLCFCGGIWLLAHTAPNYKDK |
| Ga0302323_1000994683 | 3300031232 | Fen | METSLQLWLNPVNLGILFLCLCAGIWILAHSAPNYKDK |
| Ga0265331_102857331 | 3300031250 | Rhizosphere | MENILQLWLNPIDLGILFLCLCGGLWLLSHTAPNPKDK |
| Ga0315556_10773673 | 3300031256 | Salt Marsh Sediment | MNTILQMWLNPINLGLFFLCICTGIWILAHSAPNYKDK |
| Ga0311364_118646262 | 3300031521 | Fen | QGENLMENLLQTWLNPINLGILFLCFCGGIWLLAHTAPNSKDK |
| Ga0311364_119789462 | 3300031521 | Fen | MQNLIQLWLNPINLGILFLCLCAGIWMLAHTAPNPKDK |
| Ga0247727_1000558423 | 3300031576 | Biofilm | MDHLLQLWLNPINLGILFLCLCTGIWILAHSAPNYKDK |
| Ga0302321_1000033056 | 3300031726 | Fen | MENLIALWLNPINVGILFLCFCGGIWLLAHTAPNYKDK |
| Ga0302321_1000722432 | 3300031726 | Fen | MESILQLWLNPINLGILFLCFCGGIWLLAHTAPNHKDK |
| Ga0302321_1010631322 | 3300031726 | Fen | MENILQLWLNPINLGILFLCFCGGIWLLAHTAPNHKDK |
| Ga0302321_1034240602 | 3300031726 | Fen | METTLQLWLNPINLGILFVCLCAGIWILAHSAPNYKDK |
| Ga0214473_1000585711 | 3300031949 | Soil | MENLLQMWLNPINLGILFLCLTVGIWILAHSDPTRKDK |
| Ga0214473_105165712 | 3300031949 | Soil | MENLLQMWLNPINLGILILCLTIGIWILSKSGPWNWDK |
| Ga0310906_104913921 | 3300032013 | Soil | IIEMWLNPINLGILFLCITGGIWILAHSDPTRRDK |
| Ga0335079_1000574414 | 3300032783 | Soil | METLLSLWLDPIHLGIFFLCLCTGIWILSHSAPSYRDK |
| Ga0335070_113941662 | 3300032829 | Soil | NILLLWLNPLDLGIFFLCLCAGVWVLAHSAPASKDR |
| Ga0335069_100213083 | 3300032893 | Soil | MQNILLLWLNPLDLGIFFLCLCAGVWVLAHSAPASKDR |
| Ga0335071_108075132 | 3300032897 | Soil | MANILQLWLNPIDLGILFLCVCAGIWILAHSAPNYKDK |
| Ga0335076_110364532 | 3300032955 | Soil | MDNLIQLWLNPIDLGIFFICIAIGVWILAHSAPNYKDK |
| Ga0326726_101628263 | 3300033433 | Peat Soil | MENLIQIWLNPINLGILFLCLCGGLWLLSHTAPNTKDK |
| Ga0326726_101742222 | 3300033433 | Peat Soil | MENLIQMWLNPVSLGIMFLCICAGVWILSHSAPNYKGK |
| Ga0316620_102725401 | 3300033480 | Soil | MQTILGIWLNPINLGVLFLCLSAGIWLLAHTAPTDKGK |
| Ga0316627_1010556412 | 3300033482 | Soil | MEKYLEMWLNPINLGILFLCITIGIWILAHSDPTRRDK |
| Ga0316624_122640132 | 3300033486 | Soil | MENLLATWLHPINLGILWLCITAGIWILAHSAPNWRDKE |
| Ga0316631_101917633 | 3300033493 | Soil | MEKILAQWLNPVNLGILFLCLTGGIWVLAHTAPKNEDE |
| Ga0316628_1000123617 | 3300033513 | Soil | MQTILGTWLNPINLGVLFLCISAGIWLLAHTAPTNKGK |
| ⦗Top⦘ |