| Basic Information | |
|---|---|
| Family ID | F041185 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 41 residues |
| Representative Sequence | KFAFPAGAVELQPGKEWPVDFGALTNAKRAKCGANASTD |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.62 % |
| % of genes near scaffold ends (potentially truncated) | 98.75 % |
| % of genes from short scaffolds (< 2000 bps) | 86.25 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (56.250 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (32.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (86.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.91% β-sheet: 0.00% Coil/Unstructured: 82.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF13186 | SPASM | 5.62 |
| PF03237 | Terminase_6N | 3.75 |
| PF00154 | RecA | 2.50 |
| PF02562 | PhoH | 1.88 |
| PF00583 | Acetyltransf_1 | 1.88 |
| PF01592 | NifU_N | 1.88 |
| PF01370 | Epimerase | 1.88 |
| PF13353 | Fer4_12 | 1.25 |
| PF10518 | TAT_signal | 1.25 |
| PF13394 | Fer4_14 | 1.25 |
| PF14279 | HNH_5 | 1.25 |
| PF12146 | Hydrolase_4 | 1.25 |
| PF00155 | Aminotran_1_2 | 1.25 |
| PF05118 | Asp_Arg_Hydrox | 0.62 |
| PF13772 | AIG2_2 | 0.62 |
| PF00745 | GlutR_dimer | 0.62 |
| PF08443 | RimK | 0.62 |
| PF01476 | LysM | 0.62 |
| PF08804 | gp32 | 0.62 |
| PF01391 | Collagen | 0.62 |
| PF08241 | Methyltransf_11 | 0.62 |
| PF00768 | Peptidase_S11 | 0.62 |
| PF00303 | Thymidylat_synt | 0.62 |
| PF01521 | Fe-S_biosyn | 0.62 |
| PF08645 | PNK3P | 0.62 |
| PF01471 | PG_binding_1 | 0.62 |
| PF00378 | ECH_1 | 0.62 |
| PF14235 | DUF4337 | 0.62 |
| PF01223 | Endonuclease_NS | 0.62 |
| PF11019 | DUF2608 | 0.62 |
| PF00383 | dCMP_cyt_deam_1 | 0.62 |
| PF13489 | Methyltransf_23 | 0.62 |
| PF13203 | DUF2201_N | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 2.50 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 1.88 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.88 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.88 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.62 |
| COG0241 | Histidinol phosphatase/D-glycero-mannoheptose bisphosphatephosphatase, HAD superfamily | Amino acid transport and metabolism [E] | 0.62 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.62 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.62 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.00 % |
| Unclassified | root | N/A | 35.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000203|TB18AUG2009E_c011197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
| 3300000756|JGI12421J11937_10073803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
| 3300001849|RCM26_1251625 | Not Available | 776 | Open in IMG/M |
| 3300001849|RCM26_1298861 | Not Available | 560 | Open in IMG/M |
| 3300001850|RCM37_1248479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300001851|RCM31_10237692 | Not Available | 586 | Open in IMG/M |
| 3300002098|JGI24219J26650_1027432 | Not Available | 716 | Open in IMG/M |
| 3300002195|metazooDRAFT_1217386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300003394|JGI25907J50239_1121334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300003787|Ga0007811_1002795 | Not Available | 2217 | Open in IMG/M |
| 3300003813|Ga0007879_1011546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300004112|Ga0065166_10060173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
| 3300004684|Ga0065168_1000591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6127 | Open in IMG/M |
| 3300004685|Ga0065177_1006310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2175 | Open in IMG/M |
| 3300004694|Ga0065170_1022068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300004788|Ga0007742_10002059 | All Organisms → cellular organisms → Bacteria | 2908 | Open in IMG/M |
| 3300005581|Ga0049081_10088691 | Not Available | 1157 | Open in IMG/M |
| 3300006029|Ga0075466_1103545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300006037|Ga0075465_10008227 | All Organisms → Viruses → Predicted Viral | 1912 | Open in IMG/M |
| 3300006037|Ga0075465_10048586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300006037|Ga0075465_10098944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300006072|Ga0007881_1145852 | Not Available | 579 | Open in IMG/M |
| 3300006100|Ga0007806_1019296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
| 3300006100|Ga0007806_1045623 | Not Available | 849 | Open in IMG/M |
| 3300006104|Ga0007882_10077288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1288 | Open in IMG/M |
| 3300006105|Ga0007819_1117348 | Not Available | 519 | Open in IMG/M |
| 3300006112|Ga0007857_1045635 | Not Available | 853 | Open in IMG/M |
| 3300006112|Ga0007857_1079550 | Not Available | 604 | Open in IMG/M |
| 3300006115|Ga0007816_1050948 | Not Available | 934 | Open in IMG/M |
| 3300006128|Ga0007828_1054325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300006484|Ga0070744_10118560 | Not Available | 763 | Open in IMG/M |
| 3300006805|Ga0075464_10289792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300006805|Ga0075464_10930806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300006920|Ga0070748_1032364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2141 | Open in IMG/M |
| 3300006920|Ga0070748_1123002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300007554|Ga0102820_1115357 | Not Available | 646 | Open in IMG/M |
| 3300008107|Ga0114340_1000710 | Not Available | 62391 | Open in IMG/M |
| 3300008120|Ga0114355_1109277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300008267|Ga0114364_1066147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
| 3300009068|Ga0114973_10487207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300009151|Ga0114962_10153946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
| 3300009151|Ga0114962_10155033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
| 3300009152|Ga0114980_10843299 | Not Available | 508 | Open in IMG/M |
| 3300009155|Ga0114968_10300932 | Not Available | 897 | Open in IMG/M |
| 3300009159|Ga0114978_10104210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
| 3300009159|Ga0114978_10230111 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300009159|Ga0114978_10394116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300009159|Ga0114978_10570984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300009164|Ga0114975_10494353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 660 | Open in IMG/M |
| 3300009181|Ga0114969_10096049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1914 | Open in IMG/M |
| 3300009182|Ga0114959_10084691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1761 | Open in IMG/M |
| 3300009182|Ga0114959_10461149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300009182|Ga0114959_10466364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300009183|Ga0114974_10044586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2997 | Open in IMG/M |
| 3300009183|Ga0114974_10194750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
| 3300009183|Ga0114974_10324966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
| 3300009183|Ga0114974_10425097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300009183|Ga0114974_10429195 | Not Available | 752 | Open in IMG/M |
| 3300009184|Ga0114976_10397088 | Not Available | 722 | Open in IMG/M |
| 3300009185|Ga0114971_10769960 | Not Available | 523 | Open in IMG/M |
| 3300009218|Ga0103848_1128381 | Not Available | 519 | Open in IMG/M |
| 3300010157|Ga0114964_10116978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1313 | Open in IMG/M |
| 3300010157|Ga0114964_10224546 | Not Available | 898 | Open in IMG/M |
| 3300010157|Ga0114964_10548097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300010157|Ga0114964_10633813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300010158|Ga0114960_10328821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300010334|Ga0136644_10270280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300010334|Ga0136644_10366295 | Not Available | 823 | Open in IMG/M |
| 3300010334|Ga0136644_10413670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300010334|Ga0136644_10438996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300010334|Ga0136644_10707211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 547 | Open in IMG/M |
| 3300010354|Ga0129333_11698298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300010885|Ga0133913_11624895 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300011010|Ga0139557_1039556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300012012|Ga0153799_1008547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2344 | Open in IMG/M |
| 3300012352|Ga0157138_1021772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
| 3300012665|Ga0157210_1032901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300012667|Ga0157208_10003883 | All Organisms → Viruses → Predicted Viral | 2575 | Open in IMG/M |
| 3300013285|Ga0136642_1093791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300013285|Ga0136642_1110359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300013286|Ga0136641_1098840 | Not Available | 813 | Open in IMG/M |
| 3300013295|Ga0170791_12229799 | Not Available | 900 | Open in IMG/M |
| 3300013295|Ga0170791_14159605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300014050|Ga0119952_1059441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1003 | Open in IMG/M |
| 3300017766|Ga0181343_1168216 | Not Available | 607 | Open in IMG/M |
| 3300020159|Ga0211734_10919589 | Not Available | 741 | Open in IMG/M |
| 3300020162|Ga0211735_10894988 | Not Available | 1732 | Open in IMG/M |
| 3300020731|Ga0214170_1022601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
| 3300020731|Ga0214170_1039712 | Not Available | 721 | Open in IMG/M |
| 3300020733|Ga0214172_1034617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300021127|Ga0214193_1030963 | Not Available | 624 | Open in IMG/M |
| 3300021136|Ga0214167_1091539 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina | 567 | Open in IMG/M |
| 3300021139|Ga0214166_1002656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6855 | Open in IMG/M |
| 3300021139|Ga0214166_1023071 | Not Available | 1546 | Open in IMG/M |
| 3300021142|Ga0214192_1169867 | Not Available | 542 | Open in IMG/M |
| 3300021438|Ga0213920_1078027 | Not Available | 648 | Open in IMG/M |
| 3300021519|Ga0194048_10261288 | Not Available | 629 | Open in IMG/M |
| 3300021602|Ga0194060_10579238 | Not Available | 521 | Open in IMG/M |
| 3300021956|Ga0213922_1106661 | Not Available | 561 | Open in IMG/M |
| 3300021962|Ga0222713_10303385 | Not Available | 1016 | Open in IMG/M |
| 3300022591|Ga0236341_1010028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3403 | Open in IMG/M |
| 3300022591|Ga0236341_1012005 | All Organisms → Viruses → Predicted Viral | 2979 | Open in IMG/M |
| 3300022747|Ga0228703_1121761 | Not Available | 586 | Open in IMG/M |
| 3300023184|Ga0214919_10118978 | All Organisms → Viruses → Predicted Viral | 2187 | Open in IMG/M |
| 3300024358|Ga0255173_1000970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5755 | Open in IMG/M |
| 3300025358|Ga0208504_1009230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1452 | Open in IMG/M |
| 3300025369|Ga0208382_1001849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5411 | Open in IMG/M |
| 3300025369|Ga0208382_1003947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3104 | Open in IMG/M |
| 3300025369|Ga0208382_1027122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300025372|Ga0207957_1011471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1203 | Open in IMG/M |
| 3300025372|Ga0207957_1017924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300025372|Ga0207957_1033504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300025390|Ga0208743_1049741 | Not Available | 582 | Open in IMG/M |
| 3300025400|Ga0208387_1001617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5603 | Open in IMG/M |
| 3300025402|Ga0208876_1058257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300025402|Ga0208876_1065184 | Not Available | 544 | Open in IMG/M |
| 3300025413|Ga0208614_1016065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
| 3300025426|Ga0208739_1044486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300025430|Ga0208622_1000068 | Not Available | 46420 | Open in IMG/M |
| 3300025437|Ga0208742_1067154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300025595|Ga0208248_1038938 | Not Available | 1097 | Open in IMG/M |
| 3300025598|Ga0208379_1088740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300025655|Ga0208795_1171119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300025723|Ga0208741_10015798 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1913 | Open in IMG/M |
| 3300025723|Ga0208741_10072545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300025781|Ga0208386_1022254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300025781|Ga0208386_1034380 | Not Available | 719 | Open in IMG/M |
| 3300025789|Ga0208499_1067691 | Not Available | 536 | Open in IMG/M |
| 3300025896|Ga0208916_10244996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300025896|Ga0208916_10280343 | Not Available | 725 | Open in IMG/M |
| 3300026573|Ga0255269_1135132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300027186|Ga0208797_1053750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300027467|Ga0255154_1058720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300027631|Ga0208133_1145368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300027708|Ga0209188_1008397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6077 | Open in IMG/M |
| 3300027708|Ga0209188_1187665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300027708|Ga0209188_1210958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300027736|Ga0209190_1033605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2727 | Open in IMG/M |
| 3300027736|Ga0209190_1120236 | Not Available | 1180 | Open in IMG/M |
| 3300027736|Ga0209190_1157929 | Not Available | 975 | Open in IMG/M |
| 3300027741|Ga0209085_1098333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1291 | Open in IMG/M |
| 3300027741|Ga0209085_1300320 | Not Available | 612 | Open in IMG/M |
| 3300027747|Ga0209189_1084552 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300027747|Ga0209189_1275383 | Not Available | 663 | Open in IMG/M |
| 3300027749|Ga0209084_1111211 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1193 | Open in IMG/M |
| 3300027749|Ga0209084_1221000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300027749|Ga0209084_1365921 | Not Available | 524 | Open in IMG/M |
| 3300027754|Ga0209596_1219342 | Not Available | 799 | Open in IMG/M |
| 3300027777|Ga0209829_10122199 | Not Available | 1229 | Open in IMG/M |
| 3300027782|Ga0209500_10426026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300027798|Ga0209353_10476306 | Not Available | 501 | Open in IMG/M |
| 3300027808|Ga0209354_10318823 | Not Available | 616 | Open in IMG/M |
| 3300027963|Ga0209400_1009735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6157 | Open in IMG/M |
| 3300027969|Ga0209191_1364634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 518 | Open in IMG/M |
| 3300028393|Ga0304728_1135518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300028393|Ga0304728_1195297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300031813|Ga0316217_10240906 | Not Available | 723 | Open in IMG/M |
| 3300032093|Ga0315902_11120705 | Not Available | 575 | Open in IMG/M |
| 3300032676|Ga0316229_1206217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300032753|Ga0316224_1023369 | All Organisms → Viruses → Predicted Viral | 2987 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 32.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 22.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.50% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 2.50% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.88% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.88% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.25% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.25% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.25% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.62% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.62% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.62% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.62% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.62% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025402 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB18AUG2009E_0111973 | 3300000203 | Freshwater | ANAKELQPGQEWPVDFAKLTNSKRQKCGANASAD* |
| JGI12421J11937_100738031 | 3300000756 | Freshwater And Sediment | ASVKYAYPAGAIELQPGQEWPINFGALTNAKRAKCGKAD* |
| RCM26_12516251 | 3300001849 | Marine Plankton | QASGVVFAFPARARELPVGQEWPVDYGALTKAKRAKCGANASDD* |
| RCM26_12988611 | 3300001849 | Marine Plankton | IQQNTGIRFGFPQNARELGVGQEWKVDFGRLTAMKKAKCGANATVD* |
| RCM37_12484791 | 3300001850 | Marine Plankton | RVPVVEIQKQSGIAFKFPQGAVELQPGQEWAVDFGGLTNSKRKVCGANATVD* |
| RCM31_102376921 | 3300001851 | Marine Plankton | AGVKFAFPPNAKELNPGGEWPVDFGALTNAKRAKCGKAD* |
| JGI24219J26650_10274322 | 3300002098 | Lentic | AFPAGAKELAPGAEWPVDFGALTNAKRQKCGAASSTD* |
| metazooDRAFT_12173862 | 3300002195 | Lake | VKYSYPANAKELAPGTEWAVDFGALTNAKRQKCGRAE* |
| JGI25907J50239_11213341 | 3300003394 | Freshwater Lake | GVTYAFPKNINELQPGAEWKVDYGALTNAKRAKCKNNAD* |
| Ga0007811_10027954 | 3300003787 | Freshwater | QQAGVKFAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD* |
| Ga0007879_10115462 | 3300003813 | Freshwater | GVQFALPPGGVELQPGKEWPVNFGALTNAKRAKCGANADAD* |
| Ga0065166_100601734 | 3300004112 | Freshwater Lake | QKRAGVTYAFPKNATELQPGQEWKVDFGALTRAKRAKCGANAE* |
| Ga0065168_10005911 | 3300004684 | Freshwater | GVQFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD* |
| Ga0065177_10063104 | 3300004685 | Freshwater | VKYALPAGAIELAPGKEWTVDFGALTNAKRAKCGANATDD* |
| Ga0065170_10220681 | 3300004694 | Freshwater | IEQQAGVAYALPAGTKELAPGAEWKVDFGALTNSKRQKCGANASTD* |
| Ga0007742_100020591 | 3300004788 | Freshwater Lake | IMQTAGVNFSFPKGAVELAPGQEWPVDFGMLTNAKRAKCGASASSK* |
| Ga0049081_100886911 | 3300005581 | Freshwater Lentic | EAAGGVKFAFPPGAKELAPGTEWPVDFGALTRAKRVKCGATASE* |
| Ga0075466_11035451 | 3300006029 | Aqueous | SISQIEKVAEVNFGFPKNAKELHPGKEWPVDFGALTQAKRNKCGAAAND* |
| Ga0075465_100082275 | 3300006037 | Aqueous | ISQIERVAEVNFSFPKNAKELHPGKEWPVDFGALTAAKRNKCGAAED* |
| Ga0075465_100485861 | 3300006037 | Aqueous | ISQIERVAEVNFSFPKNAKELHPGKEWPVDFGALTAAKRSKCGAAADD* |
| Ga0075465_100989443 | 3300006037 | Aqueous | RVAEVNFGFPKNAKELHPGKEWSVDFGALTQAKRNKCGTTED* |
| Ga0007881_11458521 | 3300006072 | Freshwater | MPGNAQELAPGKEWPVDFGALTNAKRKLCGANADVD* |
| Ga0007806_10192961 | 3300006100 | Freshwater | AGIKFSFPQGAVELQPGKEWPVDFGALTNAKRAKCGANASAD* |
| Ga0007806_10456231 | 3300006100 | Freshwater | FPPTAKELQPGQEWPVDFGKLTASKRSKCGAGSSAD* |
| Ga0007882_100772881 | 3300006104 | Freshwater | PANTTELQPGKEWPVDFGKLTNAKRAKCGANASDD* |
| Ga0007819_11173481 | 3300006105 | Freshwater | FPAGAVELQPGKEWPVDFGKLTNAKRAKCGAGASDD* |
| Ga0007857_10456351 | 3300006112 | Freshwater | MPANATELAPGKEWPVDFGALTNAKRKLCGANADVD* |
| Ga0007857_10795501 | 3300006112 | Freshwater | VQFAFPPGAVELQPGKEWSVDFGKLTQAKRARCGANASDD* |
| Ga0007816_10509481 | 3300006115 | Freshwater | FPPGVKELAPGAEWPVNFGALTQAKRNKCGANASAD* |
| Ga0007828_10543251 | 3300006128 | Freshwater | SNAQEVPPGKEWPVDFGKLTQAKRAKCGANASDD* |
| Ga0070744_101185601 | 3300006484 | Estuarine | YMFPANAKELNPGQEWPVDFGKLTQAKRAKCGKDDD* |
| Ga0075464_102897921 | 3300006805 | Aqueous | IERVAEVNFSFPKNAKELHPGKEWPVDFGALTQAKRNKCGAVASED* |
| Ga0075464_109308061 | 3300006805 | Aqueous | IYAYPKGAVEVQPGKEWPVDFGALTNAKRAKCGKAD* |
| Ga0070748_10323641 | 3300006920 | Aqueous | RVAEVNFSFPKNAKELHPGKEWPVDFGALTAAKRSKCGAAADD* |
| Ga0070748_11230021 | 3300006920 | Aqueous | ERVAEVNFGLPKNAKELQPGKEWPVDFGALTQAKRNKCGAAAND* |
| Ga0102820_11153573 | 3300007554 | Estuarine | SFPAGAKELAPGTEWPVSYGDLTKAKRAKCGGSGD* |
| Ga0114340_100071054 | 3300008107 | Freshwater, Plankton | AFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN* |
| Ga0114355_11092771 | 3300008120 | Freshwater, Plankton | QKQAGVQYAFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN* |
| Ga0114364_10661471 | 3300008267 | Freshwater, Plankton | YAFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN* |
| Ga0114973_104872071 | 3300009068 | Freshwater Lake | KFPANATELAPGQEWPVNYGALTNAKRTKCGKAD* |
| Ga0114962_101539463 | 3300009151 | Freshwater Lake | MQTAGVNFAFPPGAVELAPGQEWPVDFGMLTNAKRAKCGASASP* |
| Ga0114962_101550333 | 3300009151 | Freshwater Lake | MQTAGVNFAFPPGAVELAPGQEWPVDFGMLTNAKRAKCGANASP* |
| Ga0114980_108432992 | 3300009152 | Freshwater Lake | IESQAGVRFAYPAGAKEITPGQEWPVDYGALTNAKRAKCGANAQD* |
| Ga0114968_103009321 | 3300009155 | Freshwater Lake | YHFPAGAVELQPGREWPVDFGALTNAKRAKCGKAN* |
| Ga0114978_101042101 | 3300009159 | Freshwater Lake | PIAQIEQQAAVKFAFPANTKELQPGQEWPVNYGALTNAKRAKCGKAD* |
| Ga0114978_102301113 | 3300009159 | Freshwater Lake | VHFGFPQGAKELSPGQEWPVDFGALTKAKRAKCGKDDD* |
| Ga0114978_103941163 | 3300009159 | Freshwater Lake | VDYKFPQGAVELQPGQEWPVNFGALTNAKRARCGKSED* |
| Ga0114978_105709841 | 3300009159 | Freshwater Lake | YAFPAGAVELQPGQEWKVDFGALTNAKRAKCGKSND* |
| Ga0114975_104943531 | 3300009164 | Freshwater Lake | KVAGVDYKFPKGAIELAPGQEWPVDYGALTNAKRARCGKNAE* |
| Ga0114969_100960493 | 3300009181 | Freshwater Lake | FKFPKNANELAPGQEWPVNYGALTNAKRAKCGKAD* |
| Ga0114959_100846913 | 3300009182 | Freshwater Lake | VKFAFPANIQELPIGGEWPVDFGALTTAKRQKCKSAD* |
| Ga0114959_104611491 | 3300009182 | Freshwater Lake | AGVNFAFPPNANELNPGQEWPVDFGALTNAKRQKCGKNAE* |
| Ga0114959_104663642 | 3300009182 | Freshwater Lake | GVQYKFPNNAKELQPGQEWAVNFGDLTKAKRAKCGSGAD* |
| Ga0114974_1004458610 | 3300009183 | Freshwater Lake | FPPNAKELPVGAEWPIDYGALTKAKRAKCGANTQE* |
| Ga0114974_101947501 | 3300009183 | Freshwater Lake | QAGVEYKFPAGAVELQPGQEWPVDFGALTNAKRAKCGKAE* |
| Ga0114974_103249663 | 3300009183 | Freshwater Lake | TYAFPKNATELQPGKEWPVDYGALTNAKRAKCGKNAE* |
| Ga0114974_104250972 | 3300009183 | Freshwater Lake | AVVDFKFPANATELAPGQEWPVNFGALTNAKRAKCGKAAE* |
| Ga0114974_104291952 | 3300009183 | Freshwater Lake | AGVKFALPPAAKEIAPGTEWSVDFGALTNAKRQKCGRAE* |
| Ga0114976_103970881 | 3300009184 | Freshwater Lake | NIKFAFPVNAKEIDPGKEWPVDYGKLTNAKRAKCGANASE* |
| Ga0114971_107699601 | 3300009185 | Freshwater Lake | SFPAGAKELAPGAEWSVDFGALTKAKRAKCGATASDD* |
| Ga0103848_11283812 | 3300009218 | River Water | TAGVRFGFPATAKELPVGQEWPVDFGALTNAKRAKCGANAKDD* |
| Ga0114964_101169784 | 3300010157 | Freshwater Lake | KFAFPQGAVELQPGSEWPVNFGALTNAKRAKCGKSDD* |
| Ga0114964_102245462 | 3300010157 | Freshwater Lake | YAFPKNAKELASGKEWPVDFGALTNAKRAKCGKTED* |
| Ga0114964_105480971 | 3300010157 | Freshwater Lake | MQEAGVKYAFPAGAIELAPGAEWPVDFGALTKAKKTRCGANAAD* |
| Ga0114964_106338132 | 3300010157 | Freshwater Lake | FAFPKTAKELAPGQEWPVDFGALTKAKRAKCGANADD* |
| Ga0114960_103288212 | 3300010158 | Freshwater Lake | GVKFAFPKGAIELAPGQEWPVDFGALTKAKRAKCGANATDD* |
| Ga0136644_102702802 | 3300010334 | Freshwater Lake | MISTIQSEAGVKFKFPVNAREITPGTEWPVDFGALTKAKRAKCGASAD* |
| Ga0136644_103662952 | 3300010334 | Freshwater Lake | QIQQEAGVKYALPPGFIEIPPGQEWPVDFGALTNAKRAKCGKAD* |
| Ga0136644_104136703 | 3300010334 | Freshwater Lake | EAGVRFAFPANAKELQPGQEWPVNFGQLTASKKQKCGANATDD* |
| Ga0136644_104389962 | 3300010334 | Freshwater Lake | NIMQEAGVKYSFPPNARELAPGAEWPVNFGALTNAKRAKCGANATD* |
| Ga0136644_107072112 | 3300010334 | Freshwater Lake | TAGVNFAFPKNARELNPGQEWPIDFGALTNAKRAKCGANAQAD* |
| Ga0129333_116982981 | 3300010354 | Freshwater To Marine Saline Gradient | DFEFPANATELAPGQEWPVNYGALTNAKRAKCGKAD* |
| Ga0133913_116248951 | 3300010885 | Freshwater Lake | QIQTQAGVQYHYPVGAVELQPGQEWPVNFGALTQAKRAKCGANAE* |
| Ga0139557_10395563 | 3300011010 | Freshwater | TYAFPQGAIELSPGKEWPVDYGALINAKRKKCSGNTKSSE* |
| Ga0153799_10085473 | 3300012012 | Freshwater | MQFPLVTFPKNATELQPGQEWKVDFGALTRAKRAKCGANAE* |
| Ga0157138_10217721 | 3300012352 | Freshwater | VQYKFPAGAVELQPGQEWPVNFGALTNAKRAKCGKAD* |
| Ga0157210_10329013 | 3300012665 | Freshwater | GIAAIQKKAGVTFAFPAGAQELPVGGEWKVDFGALTNAKRAKCKGSGE* |
| Ga0157208_100038831 | 3300012667 | Freshwater | GVQYTFPATAQELAPGAEWRVDFGALTNAKRAKCGKSSD* |
| Ga0136642_10937911 | 3300013285 | Freshwater | QSGVNYAFPKNAAELQPGKEWPVDFGALTNAKRKLCGANASVD* |
| Ga0136642_11103592 | 3300013285 | Freshwater | TAGVNFAFPKNARELDPGKEWPVDFGKLTNAKRAKCGANASTD* |
| Ga0136641_10988402 | 3300013286 | Freshwater | EKQSGVNYAFPKNAAELQPGKEWPVDFGALTNAKRKLCGANASVD* |
| Ga0170791_122297991 | 3300013295 | Freshwater | FSFPANAQELLVGKEWPVDFGKLTNAKRAKCGANATE* |
| Ga0170791_141596051 | 3300013295 | Freshwater | EIEKISGVDFKFPKNAKELAPGQEWPVNYGALTNAKRAKCGKAD* |
| Ga0119952_10594411 | 3300014050 | Freshwater | YNFPAGAKEIAPGNEWPVDYGALTKAKRAKCGANAE* |
| Ga0181343_11682161 | 3300017766 | Freshwater Lake | GVQYHYPANAKEVQPGQEWPVNFGDLTKAKRAKCGSNAQD |
| Ga0211734_109195891 | 3300020159 | Freshwater | QYAFPAGAVEVQPGQEWKVDYGALTNAKRAKCGKSAD |
| Ga0211735_108949884 | 3300020162 | Freshwater | AGVQYKFPAGAVEIAPGSEWPVNYGALTNAKRAKCGRAE |
| Ga0214170_10226011 | 3300020731 | Freshwater | AFPPGAVELAPGKEWPVDFGALTNAKRQKCGANASAD |
| Ga0214170_10397121 | 3300020731 | Freshwater | PPGAQEVPPGKEWPVDFGKLTQAKRAKCGANADTD |
| Ga0214172_10346172 | 3300020733 | Freshwater | QQAGVAYALPAGTKELAPGQEWKVDFGALTNSKRQKCGANASTD |
| Ga0214193_10309631 | 3300021127 | Freshwater | AGVKFAFPPNARELPVGQEWPVDFGALTNAKRAKCGANATDD |
| Ga0214167_10915392 | 3300021136 | Freshwater | KFAFPANAKELAPGAEWPVDFGALTKAKRAKCGANASDD |
| Ga0214166_100265611 | 3300021139 | Freshwater | ADAGVQFAFPAGAKELPVGQEWPVDFGKLTAAKKAKCGNNASDD |
| Ga0214166_10230711 | 3300021139 | Freshwater | EQAGGVKFAFPANAKELAPGAEWPVDFGALTKAKRAKCGANASDD |
| Ga0214192_11698672 | 3300021142 | Freshwater | GIKFAFPQGAVELQPGKEWPVDFGALTQAKRNKCGANASAD |
| Ga0213920_10780273 | 3300021438 | Freshwater | NIMQEAGVKYAFPAGAIELAPGQEWPVDFGALTNAKRAKCGRAE |
| Ga0194048_102612881 | 3300021519 | Anoxic Zone Freshwater | VHFGFPQGGKELNPGQEWPVDFGKLTQVKRAKCGANAED |
| Ga0194060_105792382 | 3300021602 | Anoxic Zone Freshwater | GVKFAFPANARELQPGQEWPVDFGKLTQAKRTKCGANASTD |
| Ga0213922_11066611 | 3300021956 | Freshwater | TMISTIQSQAGIQFKFPANAQEVTPGTEWPVDYGALTKAKRAKCGANAE |
| Ga0222713_103033852 | 3300021962 | Estuarine Water | QIQEYAGVRFAFPANARELAPGQEWPVDYGALTNAKRAKCGKAD |
| Ga0236341_10100289 | 3300022591 | Freshwater | IQEAAGVKYAFPANGKELAPGAEWPVDFGALTNAKRAKCGANAGTD |
| Ga0236341_10120051 | 3300022591 | Freshwater | GVQYAFPAGAKELQPGTEWPVNFGAFTPAKRNKCGANASAD |
| Ga0228703_11217612 | 3300022747 | Freshwater | FAYPAGAKELQPGQEWPVDYGALTNAKRAKCGANATD |
| Ga0214919_101189781 | 3300023184 | Freshwater | ADIQKQAGVIYAYPQGAVEVQPGKEWPVDFGALTNAKRAKCGKAD |
| Ga0255173_100097011 | 3300024358 | Freshwater | IQKQSGITFKYPANAKELQPGQEWPVDFGALTNAKRAKCGKNAE |
| Ga0208504_10092303 | 3300025358 | Freshwater | FAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD |
| Ga0208382_10018496 | 3300025369 | Freshwater | AAGVQFAFPPGAQEVPPGKEWPVDFGKLTQAKRTKCGASASDD |
| Ga0208382_10039474 | 3300025369 | Freshwater | AMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD |
| Ga0208382_10271221 | 3300025369 | Freshwater | QQAGVKFAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD |
| Ga0207957_10114713 | 3300025372 | Freshwater | VQFAFPANAQEVPPGKEWPVDFGKLTQAKRAKCGANASAD |
| Ga0207957_10179241 | 3300025372 | Freshwater | IEQAGGVQFAFPPGAVELAPGKEWPVDFGALTNAKRQKCGANASAD |
| Ga0207957_10335042 | 3300025372 | Freshwater | AGGVQFAFPQGAVELAPGKEWPVDFGALTNAKRQKCGANASAD |
| Ga0208743_10497412 | 3300025390 | Freshwater | AQVNYALPQGGVELQPGKEWSVDFGKLTQMKRQKCGANASDD |
| Ga0208387_10016171 | 3300025400 | Freshwater | VQFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD |
| Ga0208876_10582572 | 3300025402 | Freshwater | VKFAFPANAKELAPGQEWPVDFGKLTQAKRAKCGAGASDD |
| Ga0208876_10651842 | 3300025402 | Freshwater | IEADSGIKFAFPQGAVELQPGKEWPVDFGALTNAKRAKCGANASTD |
| Ga0208614_10160651 | 3300025413 | Freshwater | GVQFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD |
| Ga0208739_10444861 | 3300025426 | Freshwater | MPGNAQELAPGKEWPVDFGALTNAKRKLCGANASVD |
| Ga0208622_10000681 | 3300025430 | Freshwater | QFAFPQGAVELAPGKEWSVDFGALTNAKRQKCGANASAD |
| Ga0208742_10671541 | 3300025437 | Freshwater | QAGVKFAMPANATELAPGKEWPVDFGALTNAKRKLCGANADVD |
| Ga0208248_10389383 | 3300025595 | Freshwater | IEQSAGVMFGFPKGAIELPPGREWAVDFGALTNAKRKKCG |
| Ga0208379_10887401 | 3300025598 | Freshwater | AFPANTVELQPGKEWPVDFGALTKAKRAKCGANASDD |
| Ga0208795_11711193 | 3300025655 | Aqueous | LTKFRVSISQIERVAEVNFSFPKNAKELHPGKEWPVDFGALTQAKRNKCGAAAND |
| Ga0208741_100157981 | 3300025723 | Freshwater | IMSAAQVKYALPPGGVELQPGKEWPVDFGALTNAKRAKCGATASDD |
| Ga0208741_100725451 | 3300025723 | Freshwater | IMQDAGVQFALPPGGVELQPGKEWPVNFGALTNAKRAKCGANADAD |
| Ga0208386_10222543 | 3300025781 | Freshwater | QAGVQFAFPQGAVELAPGKEWSVDFGALTNAKRAKCGANASAD |
| Ga0208386_10343801 | 3300025781 | Freshwater | LPQGGVELQPGKEWSVDFGKLTQAKRARCGANASDD |
| Ga0208499_10676911 | 3300025789 | Freshwater | FPAGAVELQPGKEWPVDFGKLTNAKRAKCGAGASDD |
| Ga0208916_102449963 | 3300025896 | Aqueous | RVAEVNFGFPKNAKELHPGKEWPVDFGALTQAKRNKCGAVASED |
| Ga0208916_102803431 | 3300025896 | Aqueous | FPANAKEITPGTEWPVDFGALTNAKRQKCGSSAKD |
| Ga0255269_11351321 | 3300026573 | Freshwater | AIQQKAGTNFSFPQGVTELPVGGEWPVDYGALTNAKRAKCKG |
| Ga0208797_10537502 | 3300027186 | Estuarine | AHVKYAYPKNAKEVEPGKEWPVDFGALTRSKRAKCGANAE |
| Ga0255154_10587204 | 3300027467 | Freshwater | VASIQQEAGVKFAYPKGGRELQPGREWPVDFGALTNAKRAKCK |
| Ga0208133_11453681 | 3300027631 | Estuarine | VAGVKYAYPKNAKEVEPGKEWPVDFGALTRSKRAKCGANAE |
| Ga0209188_100839710 | 3300027708 | Freshwater Lake | VNFAFPKNARELNPGQEWPVDFGALTNAKRAKCGANANDD |
| Ga0209188_11876651 | 3300027708 | Freshwater Lake | TIQKSAEVYYAFPKNAKELEPGQEWPVDFGKLTQAKRAKCGKSDD |
| Ga0209188_12109583 | 3300027708 | Freshwater Lake | YKFPAGAVELAPGQEWPVNFGALTNAKRAKCGKSED |
| Ga0209190_10336054 | 3300027736 | Freshwater Lake | APIAQIQEYAGVKFALPPAAKEIAPGTEWSVDFGALTNAKRQKCGRAE |
| Ga0209190_11202361 | 3300027736 | Freshwater Lake | ITAGVKFAYPAGARELQPGQEWPVDFGALTNAKRAKCGKNAE |
| Ga0209190_11579292 | 3300027736 | Freshwater Lake | IQQQSGVQYKFPTNATELNPGQEWPVDYGALTNAKRAKCGANAQD |
| Ga0209085_10983333 | 3300027741 | Freshwater Lake | FPKNAKELAPGQEWIVDFGKLTQAKRTKCGANAED |
| Ga0209085_13003201 | 3300027741 | Freshwater Lake | KFPAGAKEIAPGNEWPVDYGALTKAKRAKCGANAE |
| Ga0209189_10845523 | 3300027747 | Freshwater Lake | AGVKFNFPPNAKELAPGTEWPVDYGALTKAKRAKCGANAE |
| Ga0209189_12753833 | 3300027747 | Freshwater Lake | GVNFAFPKNARELNPGQEWPVDFGALTNAKRAKCGANANDD |
| Ga0209084_11112114 | 3300027749 | Freshwater Lake | ISQIQTQAGVQFAFPANANELQPGQEWPVNYGALTNAKRAKCGKSED |
| Ga0209084_12210002 | 3300027749 | Freshwater Lake | PQGAIELQPGREWAVDFGALTNAKRAKCGANASTD |
| Ga0209084_13659211 | 3300027749 | Freshwater Lake | FPKNARELDPGKEWPVDFGKLTNAKRAKCGANASAD |
| Ga0209596_12193421 | 3300027754 | Freshwater Lake | EYAGVKFALPPAAKEIAPGTEWSVDFGALTNAKRQKCGRAE |
| Ga0209829_101221992 | 3300027777 | Freshwater Lake | KFSFPAGAQEVLVGKEWPVDFGKLTNAKRAKCGANATD |
| Ga0209500_104260261 | 3300027782 | Freshwater Lake | EQQAAVKFAFPANTKELQPGQEWPVNYGALTNAKRAKCGKAD |
| Ga0209353_104763061 | 3300027798 | Freshwater Lake | VDYKFPAGVVEVQPGAEWKVDFGALTNAKRAKCGKNAD |
| Ga0209354_103188232 | 3300027808 | Freshwater Lake | AGVDYKFPAGVIEVQPGKEWPVDFGALTNAKRAKCGKNAD |
| Ga0209400_10097351 | 3300027963 | Freshwater Lake | KYALPVGAVEIQPGQEWPVDFGALTNAKRAKCGKAD |
| Ga0209191_13646342 | 3300027969 | Freshwater Lake | IAQIQQKAGVTFAFPAGAQELPAGGEWKVDFGALTNAKRAKCGRAE |
| Ga0304728_11355182 | 3300028393 | Freshwater Lake | QYKFPAGAVELQPGQEWPVNFGALTNAKRAKCGANASE |
| Ga0304728_11952971 | 3300028393 | Freshwater Lake | VHFGFPQGGKELAPGQEWPVDFGKLTQAKRAKCGKDDD |
| Ga0316217_102409061 | 3300031813 | Freshwater | AGVKYAMPAGAIELQPGKEWAVDFGALTNQKRKLCGTNASVD |
| Ga0315902_111207052 | 3300032093 | Freshwater | QAGVQYAFPKNATEVQPGKEWPVDYGALTNAKRKKCGANTN |
| Ga0316229_12062172 | 3300032676 | Freshwater | FAFPPGAQEVPPGKEWPVDFGKLTQAKRAKCGAGASDD |
| Ga0316224_10233691 | 3300032753 | Freshwater | KFAFPAGAVELQPGKEWPVDFGALTNAKRAKCGANASTD |
| ⦗Top⦘ |