| Basic Information | |
|---|---|
| Family ID | F041156 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.50 % |
| % of genes near scaffold ends (potentially truncated) | 18.12 % |
| % of genes from short scaffolds (< 2000 bps) | 86.25 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.375 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.625 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.750 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF02811 | PHP | 58.12 |
| PF07733 | DNA_pol3_alpha | 3.75 |
| PF11799 | IMS_C | 2.50 |
| PF14079 | DUF4260 | 1.25 |
| PF00817 | IMS | 1.25 |
| PF08241 | Methyltransf_11 | 0.62 |
| PF00072 | Response_reg | 0.62 |
| PF00154 | RecA | 0.62 |
| PF01855 | POR_N | 0.62 |
| PF00772 | DnaB | 0.62 |
| PF03952 | Enolase_N | 0.62 |
| PF07859 | Abhydrolase_3 | 0.62 |
| PF00133 | tRNA-synt_1 | 0.62 |
| PF02518 | HATPase_c | 0.62 |
| PF01850 | PIN | 0.62 |
| PF00892 | EamA | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 3.75 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 3.75 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 1.25 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.62 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.62 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.62 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.62 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.38 % |
| Unclassified | root | N/A | 5.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0894665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0894673 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300001330|A305W6_1002199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2185 | Open in IMG/M |
| 3300001535|A3PFW1_10020236 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300003267|soilL1_10024917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1905 | Open in IMG/M |
| 3300003324|soilH2_10022942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7047 | Open in IMG/M |
| 3300003996|Ga0055467_10289759 | Not Available | 522 | Open in IMG/M |
| 3300004114|Ga0062593_100251462 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300004114|Ga0062593_100672417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1004 | Open in IMG/M |
| 3300004156|Ga0062589_101120748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 746 | Open in IMG/M |
| 3300004157|Ga0062590_100094258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae | 1870 | Open in IMG/M |
| 3300004157|Ga0062590_100997575 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300004463|Ga0063356_100145135 | All Organisms → cellular organisms → Bacteria | 2692 | Open in IMG/M |
| 3300004479|Ga0062595_100145558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1367 | Open in IMG/M |
| 3300004479|Ga0062595_102200922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300004480|Ga0062592_100323916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1181 | Open in IMG/M |
| 3300004480|Ga0062592_101246934 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300004643|Ga0062591_101737874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 634 | Open in IMG/M |
| 3300005093|Ga0062594_101419355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 706 | Open in IMG/M |
| 3300005180|Ga0066685_10380026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 981 | Open in IMG/M |
| 3300005181|Ga0066678_10226027 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300005331|Ga0070670_101702632 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005332|Ga0066388_102277113 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005335|Ga0070666_10763483 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005336|Ga0070680_100000012 | All Organisms → cellular organisms → Bacteria | 93956 | Open in IMG/M |
| 3300005336|Ga0070680_100497818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1042 | Open in IMG/M |
| 3300005338|Ga0068868_102135866 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005343|Ga0070687_101381847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300005406|Ga0070703_10618399 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005437|Ga0070710_10190893 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300005440|Ga0070705_101144746 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005450|Ga0066682_10613872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 681 | Open in IMG/M |
| 3300005468|Ga0070707_100080988 | All Organisms → cellular organisms → Bacteria | 3134 | Open in IMG/M |
| 3300005539|Ga0068853_100822621 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005549|Ga0070704_100247350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae | 1462 | Open in IMG/M |
| 3300005558|Ga0066698_10641344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 710 | Open in IMG/M |
| 3300005577|Ga0068857_100514132 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005764|Ga0066903_107867961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300005830|Ga0074473_10850846 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005938|Ga0066795_10247710 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005985|Ga0081539_10322087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
| 3300006640|Ga0075527_10179709 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006755|Ga0079222_11996193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300006847|Ga0075431_101073732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 770 | Open in IMG/M |
| 3300006876|Ga0079217_10124181 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300006914|Ga0075436_100607968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 806 | Open in IMG/M |
| 3300007076|Ga0075435_101633230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
| 3300009092|Ga0105250_10225121 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300009094|Ga0111539_11468357 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300009147|Ga0114129_10215496 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
| 3300009147|Ga0114129_12440642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 626 | Open in IMG/M |
| 3300009162|Ga0075423_10163725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2335 | Open in IMG/M |
| 3300009162|Ga0075423_10327773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1605 | Open in IMG/M |
| 3300009162|Ga0075423_12436622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300009174|Ga0105241_12522055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| 3300009176|Ga0105242_10915462 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300009177|Ga0105248_10487155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1390 | Open in IMG/M |
| 3300009789|Ga0126307_10131123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2001 | Open in IMG/M |
| 3300010042|Ga0126314_10970984 | Not Available | 630 | Open in IMG/M |
| 3300010044|Ga0126310_10024998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3053 | Open in IMG/M |
| 3300010045|Ga0126311_10175295 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300010045|Ga0126311_11309520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
| 3300010047|Ga0126382_12505983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300010333|Ga0134080_10129593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1057 | Open in IMG/M |
| 3300010362|Ga0126377_10379530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1418 | Open in IMG/M |
| 3300010375|Ga0105239_10408711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1537 | Open in IMG/M |
| 3300010391|Ga0136847_10200770 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010397|Ga0134124_10090029 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
| 3300010399|Ga0134127_10038139 | All Organisms → cellular organisms → Bacteria | 3896 | Open in IMG/M |
| 3300010399|Ga0134127_12970132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300010399|Ga0134127_13495578 | Not Available | 515 | Open in IMG/M |
| 3300011003|Ga0138514_100035155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 965 | Open in IMG/M |
| 3300011119|Ga0105246_10260985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1380 | Open in IMG/M |
| 3300011987|Ga0120164_1019086 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012001|Ga0120167_1053874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 877 | Open in IMG/M |
| 3300012008|Ga0120174_1135738 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012046|Ga0136634_10221148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 755 | Open in IMG/M |
| 3300012469|Ga0150984_100176805 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300012519|Ga0157352_1051351 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012668|Ga0157216_10130457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1217 | Open in IMG/M |
| 3300012685|Ga0137397_10095367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2176 | Open in IMG/M |
| 3300012931|Ga0153915_10113729 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
| 3300012955|Ga0164298_11587194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| 3300012957|Ga0164303_11120874 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
| 3300012972|Ga0134077_10200671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
| 3300013100|Ga0157373_10335931 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300013297|Ga0157378_11984354 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300014269|Ga0075302_1160055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300014497|Ga0182008_10146404 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300015079|Ga0167657_1007524 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300015086|Ga0167655_1010441 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300015261|Ga0182006_1142156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 819 | Open in IMG/M |
| 3300015358|Ga0134089_10439525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
| 3300015371|Ga0132258_13634000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1054 | Open in IMG/M |
| 3300015372|Ga0132256_103141974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300015373|Ga0132257_103367936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 582 | Open in IMG/M |
| 3300015374|Ga0132255_101357105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1073 | Open in IMG/M |
| 3300017789|Ga0136617_10701249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
| 3300017792|Ga0163161_11453644 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300018000|Ga0184604_10314926 | Not Available | 554 | Open in IMG/M |
| 3300018028|Ga0184608_10161510 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300018054|Ga0184621_10091445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1068 | Open in IMG/M |
| 3300018066|Ga0184617_1161434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 661 | Open in IMG/M |
| 3300018422|Ga0190265_10107785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2630 | Open in IMG/M |
| 3300018432|Ga0190275_12448870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300018433|Ga0066667_12059072 | Not Available | 527 | Open in IMG/M |
| 3300018465|Ga0190269_10603718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 742 | Open in IMG/M |
| 3300018466|Ga0190268_10509101 | Not Available | 820 | Open in IMG/M |
| 3300018469|Ga0190270_11051018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 844 | Open in IMG/M |
| 3300018469|Ga0190270_11142922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
| 3300018920|Ga0190273_11581359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300019361|Ga0173482_10611472 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300019377|Ga0190264_11752446 | Not Available | 556 | Open in IMG/M |
| 3300019767|Ga0190267_10106888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1127 | Open in IMG/M |
| 3300019885|Ga0193747_1020538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1622 | Open in IMG/M |
| 3300019887|Ga0193729_1052091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1660 | Open in IMG/M |
| 3300019999|Ga0193718_1046803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 945 | Open in IMG/M |
| 3300020202|Ga0196964_10515161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300021329|Ga0210362_1282467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 771 | Open in IMG/M |
| 3300021859|Ga0210334_10413170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 977 | Open in IMG/M |
| 3300024181|Ga0247693_1013532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
| 3300025160|Ga0209109_10260847 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300025907|Ga0207645_10077224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2134 | Open in IMG/M |
| 3300025912|Ga0207707_10120916 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300025917|Ga0207660_10000002 | All Organisms → cellular organisms → Bacteria | 883566 | Open in IMG/M |
| 3300025917|Ga0207660_10485052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1002 | Open in IMG/M |
| 3300025917|Ga0207660_10720852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
| 3300025921|Ga0207652_11824761 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025922|Ga0207646_10016299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 6974 | Open in IMG/M |
| 3300025922|Ga0207646_11291681 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300025923|Ga0207681_10932291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 728 | Open in IMG/M |
| 3300025927|Ga0207687_10138376 | Not Available | 1844 | Open in IMG/M |
| 3300025933|Ga0207706_10597147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 948 | Open in IMG/M |
| 3300025934|Ga0207686_10627986 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300025960|Ga0207651_11979488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300025981|Ga0207640_10540383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 977 | Open in IMG/M |
| 3300026067|Ga0207678_10937971 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300026116|Ga0207674_11629990 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300027876|Ga0209974_10087657 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300027876|Ga0209974_10270480 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300027876|Ga0209974_10407080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300028807|Ga0307305_10278006 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300028814|Ga0307302_10013132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3710 | Open in IMG/M |
| 3300028824|Ga0307310_10038367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1958 | Open in IMG/M |
| 3300028828|Ga0307312_11078459 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300028881|Ga0307277_10276364 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300028884|Ga0307308_10352830 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300028885|Ga0307304_10045611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1605 | Open in IMG/M |
| 3300028885|Ga0307304_10546841 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300029304|Ga0119857_1003886 | All Organisms → cellular organisms → Bacteria | 3585 | Open in IMG/M |
| 3300030336|Ga0247826_10195130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1380 | Open in IMG/M |
| 3300031229|Ga0299913_10251673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1750 | Open in IMG/M |
| 3300031716|Ga0310813_11442323 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032002|Ga0307416_100085586 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
| 3300032002|Ga0307416_103011232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300032205|Ga0307472_102095173 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300032782|Ga0335082_10108895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2734 | Open in IMG/M |
| 3300032782|Ga0335082_11060754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 676 | Open in IMG/M |
| 3300033004|Ga0335084_10241292 | Not Available | 1874 | Open in IMG/M |
| 3300034125|Ga0370484_0054421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 997 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.38% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.12% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.50% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.88% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.25% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.25% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.25% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.25% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.62% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.62% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.62% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.62% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.62% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.62% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.62% |
| Anaerobic Bioreactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001330 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-5cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029304 | Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina | Engineered | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_08946651 | 3300000033 | Soil | VETDQRTWAAVLTRTLAMLFVASLLILVLLPAALAASSR* |
| ICChiseqgaiiDRAFT_08946732 | 3300000033 | Soil | MEIDVRSLAVVMTRTTAMLLLASLLILVLLPAALAAXXR* |
| A305W6_10021992 | 3300001330 | Permafrost | VGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASSR* |
| A3PFW1_100202361 | 3300001535 | Permafrost | VLSLATKHPDGMSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGH* |
| soilL1_100249173 | 3300003267 | Sugarcane Root And Bulk Soil | VETDLRSLAVTLTRTAAMLLLAGLLILVLLPAALAASGR* |
| soilH2_100229428 | 3300003324 | Sugarcane Root And Bulk Soil | MAGASRLTAVEIDVRSLAVALTRTTAALLVAGLLILVLLPAALAANGR* |
| Ga0055467_102897591 | 3300003996 | Natural And Restored Wetlands | VDINFRSLAVVLTRTAAMLFIAVLLILVLLPAALAASGR* |
| Ga0062593_1002514623 | 3300004114 | Soil | VEIDQRTWAAVLARTVAMLFVASLLILVLLPAALAASGR* |
| Ga0062593_1006724172 | 3300004114 | Soil | VEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0062589_1011207481 | 3300004156 | Soil | MEIDVRSLAVVMTRTTAMLLLASLLILVLLPAALAANSR* |
| Ga0062590_1000942581 | 3300004157 | Soil | WRLRAVEIDQRTWAAVLARTVAMLFVASLLILVLLPAALAASGR* |
| Ga0062590_1009975752 | 3300004157 | Soil | MSSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0063356_1001451355 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAVETNLRSLAVVLTRTTAMLLLAGLLILVLLPAALAASGQ* |
| Ga0062595_1001455582 | 3300004479 | Soil | VGTDYRNLAVVLTRTTAMLLLAVLLILVILPAALAASSH* |
| Ga0062595_1022009221 | 3300004479 | Soil | VGIDYRNLAVALTRTTAMLLLAVLLILVVLPAALAASGR* |
| Ga0062592_1003239163 | 3300004480 | Soil | VEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0062592_1012469341 | 3300004480 | Soil | VETDFRQLAVVMTRTAAMLLIAVLLILVLLPAALAANGT* |
| Ga0062591_1017378742 | 3300004643 | Soil | VETEPRSLAAVVTRTAVMLVLAVLLILVLLPAALAASAR* |
| Ga0062594_1014193551 | 3300005093 | Soil | MAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAVLAASSR* |
| Ga0066685_103800262 | 3300005180 | Soil | VETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALAASSR* |
| Ga0066678_102260272 | 3300005181 | Soil | VGSRLTGVAIDPRSLAVVLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0070670_1017026321 | 3300005331 | Switchgrass Rhizosphere | VDLDLRALATDVTKTAAMLLLAVLLVLVLLPAALAANGG* |
| Ga0066388_1022771133 | 3300005332 | Tropical Forest Soil | VESDLRSLAVVLTRTTAALLVAGLLILVLLPAALAANGR* |
| Ga0070666_107634833 | 3300005335 | Switchgrass Rhizosphere | RLRAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0070680_10000001275 | 3300005336 | Corn Rhizosphere | VEIDFRSLAVVMTRTSAMLLFAALLILVLLPAALAANSR* |
| Ga0070680_1004978182 | 3300005336 | Corn Rhizosphere | VEIDLRSFVVDMTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0068868_1021358662 | 3300005338 | Miscanthus Rhizosphere | AVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0070687_1013818471 | 3300005343 | Switchgrass Rhizosphere | MPGACRLRAVEIDVRSLATVMTRTAAMLLFAGLLILVLLPAALAANGR* |
| Ga0070703_106183992 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | PRLRAVEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0070710_101908932 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVGTDLVGLAAVTTRTIAMLLLAILLILVLLPAALAASAT* |
| Ga0070705_1011447462 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0066682_106138722 | 3300005450 | Soil | VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0070707_1000809882 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VEIDVRSLATVMTRTAAMLLFAGLLILVLLPAAVAANAR* |
| Ga0068853_1008226212 | 3300005539 | Corn Rhizosphere | VAIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0070704_1002473501 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0066698_106413442 | 3300005558 | Soil | VEISPRSLAVVLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0068857_1005141322 | 3300005577 | Corn Rhizosphere | MDFRQLAVVMTRTAAMLLIAVLLILVLLPAALAANGT* |
| Ga0066903_1078679611 | 3300005764 | Tropical Forest Soil | VEIDLRNLAVVMTRTTAALLVAGLLILVLLPAALAANGR* |
| Ga0074473_108508462 | 3300005830 | Sediment (Intertidal) | VEIDPRSLAAVVTRTAAMLLLAVLLILVLLPAALAASSR* |
| Ga0066795_102477102 | 3300005938 | Soil | MSRQRAVDQDLRNLAVVMTRTAAMLLLAVLLILGLLPAALAASGH* |
| Ga0081539_103220872 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VEIDYRSLAVVLTRTTASLLLAGLLILVLLPAALAASSR* |
| Ga0075527_101797092 | 3300006640 | Arctic Peat Soil | VDPDLRSLAAVLTRTAAMLLLAVLLILVLLPAALAANGA* |
| Ga0079222_119961932 | 3300006755 | Agricultural Soil | VETDTRSWVAVLTRTAAMLFIAVLLILVLLPAALAASGR* |
| Ga0075431_1010737322 | 3300006847 | Populus Rhizosphere | VENDHRSPAAVLTRTAATLLVAVLLILVLLPAVLAASGR* |
| Ga0079217_101241812 | 3300006876 | Agricultural Soil | VDTDPRSLTVVLTRTAAMLLFAALLILVLLPAVLAASSR* |
| Ga0075436_1006079681 | 3300006914 | Populus Rhizosphere | VGTDFRNLAVVLTRTTAMLLLAVLLILVVLPAALAASGR* |
| Ga0075435_1016332301 | 3300007076 | Populus Rhizosphere | MSSRLRAVEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0105250_102251212 | 3300009092 | Switchgrass Rhizosphere | VEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0111539_114683571 | 3300009094 | Populus Rhizosphere | KPRGHRLRAVEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0114129_102154963 | 3300009147 | Populus Rhizosphere | LAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAALAASAR* |
| Ga0114129_124406422 | 3300009147 | Populus Rhizosphere | VETDLRSLTAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0075423_101637254 | 3300009162 | Populus Rhizosphere | VEIDPRNLAVVLTRTTAMLLIAGLLILVLLPAVLAANGR* |
| Ga0075423_103277733 | 3300009162 | Populus Rhizosphere | RSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0075423_124366221 | 3300009162 | Populus Rhizosphere | VEIDIRSLAAVLTRTTAMLLIAALLILVLLPAALAASVR* |
| Ga0105241_125220552 | 3300009174 | Corn Rhizosphere | VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAANGR* |
| Ga0105242_109154621 | 3300009176 | Miscanthus Rhizosphere | VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0105248_104871553 | 3300009177 | Switchgrass Rhizosphere | VEIDVRSLATVMTRTAAMLLFAGLLILVLLPAALAANGR* |
| Ga0126307_101311232 | 3300009789 | Serpentine Soil | VEIEPRNVAAVLTRTAAMLLIAVLLILVLLPAALAASAR* |
| Ga0126314_109709842 | 3300010042 | Serpentine Soil | TAVEIEPRNVAAVLTRTAAMLLIAVLLILVLLPAALAASAR* |
| Ga0126310_100249982 | 3300010044 | Serpentine Soil | MAVETDVRSLAVALTRTAAMLLLAGLLILVLLPAALAASGR* |
| Ga0126311_101752953 | 3300010045 | Serpentine Soil | VETDQRSWTAVMTRTIAMLFIASLLILVLLPAALAASGR* |
| Ga0126311_113095202 | 3300010045 | Serpentine Soil | MAVETDVRSLAVALTRTAAMLLLAGLLILVLLPAALAASSR* |
| Ga0126382_125059832 | 3300010047 | Tropical Forest Soil | VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAAVAANGR* |
| Ga0134080_101295932 | 3300010333 | Grasslands Soil | VETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALVASSR* |
| Ga0126377_103795302 | 3300010362 | Tropical Forest Soil | MRRLRAVEIDVRSLAVVMTRTTAMLLFAALLILVLLPAALVANSR* |
| Ga0105239_104087113 | 3300010375 | Corn Rhizosphere | VEIDFRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0136847_102007701 | 3300010391 | Freshwater Sediment | VDLNLRHLAVDMTRTTAMLLLAVLLILVLLPAAVAANGH* |
| Ga0134124_100900292 | 3300010397 | Terrestrial Soil | MGRPRLKAVGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASSR* |
| Ga0134127_100381391 | 3300010399 | Terrestrial Soil | AQHKSGEPRLRAVEIDFRNLAAVMTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0134127_129701322 | 3300010399 | Terrestrial Soil | VDIDNRSLAAVLTRTAAMLLIAVLLILVLLPAVLAASNR* |
| Ga0134127_134955781 | 3300010399 | Terrestrial Soil | RSLATVLTRTAASLLIAALLILVLLPAALAASNR* |
| Ga0138514_1000351552 | 3300011003 | Soil | VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAANSR* |
| Ga0105246_102609852 | 3300011119 | Miscanthus Rhizosphere | MSSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAA |
| Ga0120164_10190862 | 3300011987 | Permafrost | MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGN* |
| Ga0120167_10538742 | 3300012001 | Permafrost | MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGH* |
| Ga0120174_11357382 | 3300012008 | Permafrost | MWRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGN* |
| Ga0136634_102211481 | 3300012046 | Polar Desert Sand | DPRSLTAVLTRTAAMLLIAALLILVLLPAVLAASSR* |
| Ga0150984_1001768053 | 3300012469 | Avena Fatua Rhizosphere | DFRSLAVVMTRTTAMLLLASLLILVLLPAALVANSR* |
| Ga0157352_10513513 | 3300012519 | Unplanted Soil | LVEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0157216_101304572 | 3300012668 | Glacier Forefield Soil | VDINLRSLAAVLTRTAAMLLIAVLLILVLLPAALAASAR* |
| Ga0137397_100953672 | 3300012685 | Vadose Zone Soil | VEIDFRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR* |
| Ga0153915_101137292 | 3300012931 | Freshwater Wetlands | MAVGTDLRSLAVVMTRTVVMLLIATLLILVLLPAALAANGA* |
| Ga0164298_115871941 | 3300012955 | Soil | VGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASGR* |
| Ga0164303_111208741 | 3300012957 | Soil | VWRLTGVDLNLRHLAADMTRTTAMLLLAVLLILVILPAALAASGR* |
| Ga0134077_102006712 | 3300012972 | Grasslands Soil | VEISPRSLAVVLTRTTAMLLIAGLLILVLLPAALAASSR* |
| Ga0157373_103359312 | 3300013100 | Corn Rhizosphere | VDTDARTLATDMTRTIATLLLAILSILVLLPAALAANGA* |
| Ga0157378_119843543 | 3300013297 | Miscanthus Rhizosphere | RAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0075302_11600552 | 3300014269 | Natural And Restored Wetlands | MDVRSLAAVVTRTAVMLLIAVLLILVLLPAALAANSR* |
| Ga0182008_101464042 | 3300014497 | Rhizosphere | VDLDFRALAADMTRTAAMLLLAVLLVLVLLPAALAANGA* |
| Ga0167657_10075242 | 3300015079 | Glacier Forefield Soil | MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILGLLPVALAASGN* |
| Ga0167655_10104413 | 3300015086 | Glacier Forefield Soil | MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILGLLPAALAASGN* |
| Ga0182006_11421563 | 3300015261 | Rhizosphere | VEIDFRSLAVVLTRTTAMLLVAGLLILVLLPAALAANVR* |
| Ga0134089_104395252 | 3300015358 | Grasslands Soil | VEISPRSLAVVLTRTAAMLLIAGLLILVLLPAALAANGR* |
| Ga0132258_136340001 | 3300015371 | Arabidopsis Rhizosphere | VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAVLAANGR* |
| Ga0132256_1031419741 | 3300015372 | Arabidopsis Rhizosphere | VEIDLRHLAVDLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0132257_1033679361 | 3300015373 | Arabidopsis Rhizosphere | VDTDLRSLAVVMTRTVVMLLIATLLILVLLPAALAANGA* |
| Ga0132255_1013571052 | 3300015374 | Arabidopsis Rhizosphere | VEIDLRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR* |
| Ga0136617_107012492 | 3300017789 | Polar Desert Sand | VVWRLKSVETDPRSLAAVLTRTAAMLLIAALLILVLLPAVLAASSR |
| Ga0163161_114536442 | 3300017792 | Switchgrass Rhizosphere | VEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0184604_103149261 | 3300018000 | Groundwater Sediment | EPRSLAAVVTRTAAMLLVAVLLILVLLPAALAASSR |
| Ga0184608_101615102 | 3300018028 | Groundwater Sediment | VEIDSRSLAAVLTRTAAMLLLAVLLILVLLPAVLAASGR |
| Ga0184621_100914452 | 3300018054 | Groundwater Sediment | VETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALAASSR |
| Ga0184617_11614342 | 3300018066 | Groundwater Sediment | VETDQRSWTAVLTRTAAMLLIASLLILVLLPAAWAASSR |
| Ga0190265_101077854 | 3300018422 | Soil | LAVETDTRNLAVVLTRTAAMLLLAGILILVLLPEVLVASSR |
| Ga0190275_124488702 | 3300018432 | Soil | LAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAALAASGR |
| Ga0066667_120590721 | 3300018433 | Grasslands Soil | VETDPRSLTAVLTRTAAMLLLAVLLILVLLPAALAASSR |
| Ga0190269_106037182 | 3300018465 | Soil | LAVKADLRSLAVVLTRTAAMLLLAALLILVLLPAALAASAR |
| Ga0190268_105091011 | 3300018466 | Soil | MGVETDIRTLAVVLTRTAAMLLLAGLLILVLLPAALAASAR |
| Ga0190270_110510182 | 3300018469 | Soil | LAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAALAASAR |
| Ga0190270_111429222 | 3300018469 | Soil | VEIEPRSLAAVLTRTAAMLLIAVLLILVLLPAVLAASNR |
| Ga0190273_115813592 | 3300018920 | Soil | VETDQRSWTAVLTRTAAMLLIASLLILVLLPAALAASGR |
| Ga0173482_106114722 | 3300019361 | Soil | VEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0190264_117524461 | 3300019377 | Soil | KPVEADQRSWTAVVTRTLAMLFVASLLILVLLPAALAASGR |
| Ga0190267_101068881 | 3300019767 | Soil | LAVETDIRHLAVVLTRTAAMLLLAGLLILVLLPAALAASAR |
| Ga0193747_10205382 | 3300019885 | Soil | MSRLRAVETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAANSR |
| Ga0193729_10520914 | 3300019887 | Soil | MAVGTDLVGLAAVTTRTIAMLLLAILLILVLLPAALAASAT |
| Ga0193718_10468031 | 3300019999 | Soil | VGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASGR |
| Ga0196964_105151612 | 3300020202 | Soil | MGGVRRLYGVETDFRSLAVVLTRTTAMLLLAGLLILVLMPAVLAASSR |
| Ga0210362_12824671 | 3300021329 | Estuarine | DPRSLAAVVTRTAAMLLLAVLLILVLLPAALAASSR |
| Ga0210334_104131702 | 3300021859 | Estuarine | VEIDPRSLAAVVTRTAAMLLLAVLLILVLLPAALAASSR |
| Ga0247693_10135322 | 3300024181 | Soil | VDTDLRSLAVVMTRTVVMLLIATLLILVLLPAALAANGA |
| Ga0209109_102608471 | 3300025160 | Soil | VDINFRSLAVVLTRTAAMLFIAVLLILVLLPAALAASGR |
| Ga0207645_100772243 | 3300025907 | Miscanthus Rhizosphere | MSSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Ga0207707_101209163 | 3300025912 | Corn Rhizosphere | VEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAASSR |
| Ga0207660_10000002769 | 3300025917 | Corn Rhizosphere | VEIDFRSLAVVMTRTSAMLLFAALLILVLLPAALAANSR |
| Ga0207660_104850521 | 3300025917 | Corn Rhizosphere | AQHKSRERRLRAVEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0207660_107208522 | 3300025917 | Corn Rhizosphere | VEIDLRSFVVDMTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0207652_118247612 | 3300025921 | Corn Rhizosphere | PARRPRLRAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0207646_100162992 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VEIDVRSLATVMTRTAAMLLFAGLLILVLLPAAVAANAR |
| Ga0207646_112916812 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Ga0207681_109322912 | 3300025923 | Switchgrass Rhizosphere | VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAANGR |
| Ga0207687_101383762 | 3300025927 | Miscanthus Rhizosphere | MPSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVL |
| Ga0207706_105971472 | 3300025933 | Corn Rhizosphere | MPSRLRAVEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Ga0207686_106279863 | 3300025934 | Miscanthus Rhizosphere | VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0207651_119794882 | 3300025960 | Switchgrass Rhizosphere | VEIDVRSLAAVLTRTAAMLLIAALLILVLLPAALAANGR |
| Ga0207640_105403833 | 3300025981 | Corn Rhizosphere | LRAVEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0207678_109379711 | 3300026067 | Corn Rhizosphere | DLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0207674_116299902 | 3300026116 | Corn Rhizosphere | MDFRQLAVVMTRTAAMLLIAVLLILVLLPAALAANGT |
| Ga0209974_100876572 | 3300027876 | Arabidopsis Thaliana Rhizosphere | VETDQRTWAAVLTRTLAMLFVASLLILVLLPAALAANGR |
| Ga0209974_102704801 | 3300027876 | Arabidopsis Thaliana Rhizosphere | VETERRSWVAVLTRTATMLLIAAFLILVLLPAALAASVR |
| Ga0209974_104070802 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MAVETNLRSLAVVLTRTTAMLLLAGLLILVLLPAALAASGQ |
| Ga0307305_102780061 | 3300028807 | Soil | RLRAVETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALAASSR |
| Ga0307302_100131322 | 3300028814 | Soil | VETDVRGLATALARTAAMLLLAGVTILVFLPAVLAANSR |
| Ga0307310_100383672 | 3300028824 | Soil | VEIDPRGLAAVVTRTAAMLALAVLLILVLLPAALAASAR |
| Ga0307312_110784592 | 3300028828 | Soil | MSRLRAVETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Ga0307277_102763642 | 3300028881 | Soil | VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Ga0307308_103528302 | 3300028884 | Soil | VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAANSR |
| Ga0307304_100456113 | 3300028885 | Soil | VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Ga0307304_105468411 | 3300028885 | Soil | MSRQRAVDQDLRPLAVVMTRTAAMLLLAVLLILVLLPAALAASGN |
| Ga0119857_10038862 | 3300029304 | Anaerobic Bioreactor | MARALRLKAVDTNLRSLAVAMTRTAAMLLIAVLLILVLLPAALAASGG |
| Ga0247826_101951302 | 3300030336 | Soil | MAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAVLAASSR |
| Ga0299913_102516733 | 3300031229 | Soil | LAVETDIRNLAVVLTRTAAMLLLAGILILVLLPEVLVASSR |
| Ga0310813_114423232 | 3300031716 | Soil | VEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR |
| Ga0307416_1000855865 | 3300032002 | Rhizosphere | RLLAVETDNRNLAVVLTRTAAMLLLAGLLILVLLPAALAASAG |
| Ga0307416_1030112322 | 3300032002 | Rhizosphere | VETDQRSWAAVLTRTAAMLLIASLLILVLLPAALA |
| Ga0307472_1020951732 | 3300032205 | Hardwood Forest Soil | ESAQHPAPRSRLRAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR |
| Ga0335082_101088952 | 3300032782 | Soil | MDPRGFAVAVTRTLAMLLLASLLILVLLPAALAANGT |
| Ga0335082_110607541 | 3300032782 | Soil | VGTDLRSLAVVVTRTVAMLLIATLLILVLLPAALAANGT |
| Ga0335084_102412922 | 3300033004 | Soil | MAVGTDLRSLAVVVTRTVAMLLIATLLILVLLPAALAANGA |
| Ga0370484_0054421_98_217 | 3300034125 | Untreated Peat Soil | VETDFRTLAVVLTRTTAMLLLAVLLILVILPAALAASGR |
| ⦗Top⦘ |