| Basic Information | |
|---|---|
| Family ID | F041103 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDLYRATQQQTYE |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.34 % |
| % of genes near scaffold ends (potentially truncated) | 83.75 % |
| % of genes from short scaffolds (< 2000 bps) | 88.12 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.375 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.875 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.875 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF13613 | HTH_Tnp_4 | 2.50 |
| PF13359 | DDE_Tnp_4 | 2.50 |
| PF13340 | DUF4096 | 1.88 |
| PF03400 | DDE_Tnp_IS1 | 1.88 |
| PF13592 | HTH_33 | 1.25 |
| PF13610 | DDE_Tnp_IS240 | 1.25 |
| PF13551 | HTH_29 | 1.25 |
| PF00296 | Bac_luciferase | 1.25 |
| PF16889 | Hepar_II_III_N | 1.25 |
| PF13751 | DDE_Tnp_1_6 | 0.62 |
| PF00342 | PGI | 0.62 |
| PF13740 | ACT_6 | 0.62 |
| PF13384 | HTH_23 | 0.62 |
| PF04909 | Amidohydro_2 | 0.62 |
| PF13655 | RVT_N | 0.62 |
| PF13546 | DDE_5 | 0.62 |
| PF01381 | HTH_3 | 0.62 |
| PF13289 | SIR2_2 | 0.62 |
| PF01978 | TrmB | 0.62 |
| PF13005 | zf-IS66 | 0.62 |
| PF00817 | IMS | 0.62 |
| PF00210 | Ferritin | 0.62 |
| PF12762 | DDE_Tnp_IS1595 | 0.62 |
| PF11535 | Calci_bind_CcbP | 0.62 |
| PF13649 | Methyltransf_25 | 0.62 |
| PF04313 | HSDR_N | 0.62 |
| PF13193 | AMP-binding_C | 0.62 |
| PF04218 | CENP-B_N | 0.62 |
| PF00176 | SNF2-rel_dom | 0.62 |
| PF05685 | Uma2 | 0.62 |
| PF02515 | CoA_transf_3 | 0.62 |
| PF03811 | Zn_Tnp_IS1 | 0.62 |
| PF13579 | Glyco_trans_4_4 | 0.62 |
| PF13408 | Zn_ribbon_recom | 0.62 |
| PF13191 | AAA_16 | 0.62 |
| PF08238 | Sel1 | 0.62 |
| PF00206 | Lyase_1 | 0.62 |
| PF01555 | N6_N4_Mtase | 0.62 |
| PF04471 | Mrr_cat | 0.62 |
| PF05690 | ThiG | 0.62 |
| PF00293 | NUDIX | 0.62 |
| PF12680 | SnoaL_2 | 0.62 |
| PF01430 | HSP33 | 0.62 |
| PF03781 | FGE-sulfatase | 0.62 |
| PF07969 | Amidohydro_3 | 0.62 |
| PF13586 | DDE_Tnp_1_2 | 0.62 |
| PF13186 | SPASM | 0.62 |
| PF14319 | Zn_Tnp_IS91 | 0.62 |
| PF02900 | LigB | 0.62 |
| PF13565 | HTH_32 | 0.62 |
| PF01609 | DDE_Tnp_1 | 0.62 |
| PF13594 | Obsolete Pfam Family | 0.62 |
| PF02371 | Transposase_20 | 0.62 |
| PF07724 | AAA_2 | 0.62 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.25 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.62 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.62 |
| COG3677 | Transposase InsA | Mobilome: prophages, transposons [X] | 0.62 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.62 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.62 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.62 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.62 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.62 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.62 |
| COG1281 | Redox-regulated molecular chaperone, HSP33 family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.62 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.62 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.62 % |
| Unclassified | root | N/A | 34.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_12117340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 590 | Open in IMG/M |
| 3300004281|Ga0066397_10014896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1071 | Open in IMG/M |
| 3300005332|Ga0066388_100601426 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300005332|Ga0066388_100644445 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300005332|Ga0066388_101365244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. | 1228 | Open in IMG/M |
| 3300005332|Ga0066388_101722455 | Not Available | 1110 | Open in IMG/M |
| 3300005332|Ga0066388_104405362 | Not Available | 717 | Open in IMG/M |
| 3300005332|Ga0066388_105102753 | Not Available | 667 | Open in IMG/M |
| 3300005467|Ga0070706_101311989 | Not Available | 664 | Open in IMG/M |
| 3300005586|Ga0066691_10954427 | Not Available | 504 | Open in IMG/M |
| 3300005615|Ga0070702_100878962 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005713|Ga0066905_101096167 | Not Available | 707 | Open in IMG/M |
| 3300005764|Ga0066903_101683115 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300005764|Ga0066903_102598229 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300005829|Ga0074479_10678018 | Not Available | 523 | Open in IMG/M |
| 3300005937|Ga0081455_10228147 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300006049|Ga0075417_10036453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2065 | Open in IMG/M |
| 3300006049|Ga0075417_10626752 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006058|Ga0075432_10501974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales | 541 | Open in IMG/M |
| 3300006796|Ga0066665_11130296 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006797|Ga0066659_10223320 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300006844|Ga0075428_100193702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2198 | Open in IMG/M |
| 3300006844|Ga0075428_101307602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea toluenoxydans | 762 | Open in IMG/M |
| 3300006846|Ga0075430_100485354 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006846|Ga0075430_100986886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. 'Orange Guaymas' | 694 | Open in IMG/M |
| 3300006852|Ga0075433_10605672 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006894|Ga0079215_10842287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 647 | Open in IMG/M |
| 3300006969|Ga0075419_10578994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 786 | Open in IMG/M |
| 3300009012|Ga0066710_100808646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1437 | Open in IMG/M |
| 3300009038|Ga0099829_10053300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3005 | Open in IMG/M |
| 3300009038|Ga0099829_11481980 | Not Available | 560 | Open in IMG/M |
| 3300009038|Ga0099829_11614771 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009038|Ga0099829_11696661 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009089|Ga0099828_10347081 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300009090|Ga0099827_10018189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4805 | Open in IMG/M |
| 3300009090|Ga0099827_10198059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1669 | Open in IMG/M |
| 3300009090|Ga0099827_10581101 | Not Available | 966 | Open in IMG/M |
| 3300009090|Ga0099827_11946179 | Not Available | 512 | Open in IMG/M |
| 3300009090|Ga0099827_11949928 | Not Available | 511 | Open in IMG/M |
| 3300009094|Ga0111539_10558819 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300009094|Ga0111539_13076494 | Not Available | 538 | Open in IMG/M |
| 3300009100|Ga0075418_12709111 | Not Available | 541 | Open in IMG/M |
| 3300009147|Ga0114129_10420778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter marinus | 1757 | Open in IMG/M |
| 3300009147|Ga0114129_11207984 | Not Available | 941 | Open in IMG/M |
| 3300009147|Ga0114129_12513155 | Not Available | 616 | Open in IMG/M |
| 3300009156|Ga0111538_13721432 | Not Available | 528 | Open in IMG/M |
| 3300009162|Ga0075423_12624084 | Not Available | 551 | Open in IMG/M |
| 3300009506|Ga0118657_10328321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → unclassified Microgenomates group → Microgenomates group bacterium RBG_16_45_19 | 2044 | Open in IMG/M |
| 3300009691|Ga0114944_1223001 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 758 | Open in IMG/M |
| 3300009792|Ga0126374_11606341 | Not Available | 537 | Open in IMG/M |
| 3300009808|Ga0105071_1022431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 911 | Open in IMG/M |
| 3300009811|Ga0105084_1003333 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 2108 | Open in IMG/M |
| 3300009815|Ga0105070_1119201 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009818|Ga0105072_1007839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter | 1848 | Open in IMG/M |
| 3300009818|Ga0105072_1129304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 521 | Open in IMG/M |
| 3300010036|Ga0126305_10180939 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300010043|Ga0126380_10271282 | Not Available | 1188 | Open in IMG/M |
| 3300010044|Ga0126310_10753372 | Not Available | 744 | Open in IMG/M |
| 3300010046|Ga0126384_11279861 | Not Available | 679 | Open in IMG/M |
| 3300010046|Ga0126384_11549848 | Not Available | 622 | Open in IMG/M |
| 3300010047|Ga0126382_10213976 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300010047|Ga0126382_10656733 | Not Available | 872 | Open in IMG/M |
| 3300010323|Ga0134086_10053901 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300010326|Ga0134065_10118453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 897 | Open in IMG/M |
| 3300010333|Ga0134080_10014897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2819 | Open in IMG/M |
| 3300010356|Ga0116237_11038476 | Not Available | 687 | Open in IMG/M |
| 3300010360|Ga0126372_12178275 | Not Available | 603 | Open in IMG/M |
| 3300010362|Ga0126377_10858639 | Not Available | 969 | Open in IMG/M |
| 3300010362|Ga0126377_12485087 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300010366|Ga0126379_10314340 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium psy1 | 1580 | Open in IMG/M |
| 3300010397|Ga0134124_12193074 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 592 | Open in IMG/M |
| 3300010863|Ga0124850_1066107 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300011269|Ga0137392_10313215 | Not Available | 1298 | Open in IMG/M |
| 3300012189|Ga0137388_11145356 | Not Available | 715 | Open in IMG/M |
| 3300012203|Ga0137399_11420170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thioploca → Thioploca ingrica | 580 | Open in IMG/M |
| 3300012206|Ga0137380_10776428 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 828 | Open in IMG/M |
| 3300012349|Ga0137387_10767219 | Not Available | 698 | Open in IMG/M |
| 3300012349|Ga0137387_11014852 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012353|Ga0137367_10643676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300012359|Ga0137385_11223753 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012362|Ga0137361_10139363 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300012362|Ga0137361_10200956 | Not Available | 1803 | Open in IMG/M |
| 3300012362|Ga0137361_11426429 | Not Available | 615 | Open in IMG/M |
| 3300012363|Ga0137390_11276567 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012494|Ga0157341_1002304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300012513|Ga0157326_1088505 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012685|Ga0137397_10720939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 740 | Open in IMG/M |
| 3300012917|Ga0137395_10169095 | Not Available | 1507 | Open in IMG/M |
| 3300012922|Ga0137394_10017829 | All Organisms → cellular organisms → Bacteria | 5650 | Open in IMG/M |
| 3300012922|Ga0137394_10305028 | Not Available | 1360 | Open in IMG/M |
| 3300012929|Ga0137404_11028546 | Not Available | 754 | Open in IMG/M |
| 3300012948|Ga0126375_12089601 | Not Available | 503 | Open in IMG/M |
| 3300012961|Ga0164302_11303741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 587 | Open in IMG/M |
| 3300012971|Ga0126369_11162096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 861 | Open in IMG/M |
| 3300013306|Ga0163162_10198867 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 2133 | Open in IMG/M |
| 3300015241|Ga0137418_10323819 | Not Available | 1280 | Open in IMG/M |
| 3300015371|Ga0132258_10057714 | All Organisms → cellular organisms → Bacteria | 8923 | Open in IMG/M |
| 3300015371|Ga0132258_10086218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7342 | Open in IMG/M |
| 3300015371|Ga0132258_10580393 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
| 3300015371|Ga0132258_10658811 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
| 3300015371|Ga0132258_11640039 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1623 | Open in IMG/M |
| 3300015373|Ga0132257_100635989 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300015373|Ga0132257_102855474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300015374|Ga0132255_100619704 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1601 | Open in IMG/M |
| 3300016357|Ga0182032_10581982 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 929 | Open in IMG/M |
| 3300016387|Ga0182040_11554182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 563 | Open in IMG/M |
| 3300016404|Ga0182037_11468392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 604 | Open in IMG/M |
| 3300018061|Ga0184619_10073634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1511 | Open in IMG/M |
| 3300018063|Ga0184637_10301142 | Not Available | 971 | Open in IMG/M |
| 3300018063|Ga0184637_10563042 | Not Available | 653 | Open in IMG/M |
| 3300018079|Ga0184627_10008795 | All Organisms → cellular organisms → Bacteria | 4666 | Open in IMG/M |
| 3300018079|Ga0184627_10148734 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300018432|Ga0190275_12980544 | Not Available | 547 | Open in IMG/M |
| 3300018466|Ga0190268_10665008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 756 | Open in IMG/M |
| 3300018468|Ga0066662_10359270 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300019248|Ga0180117_1173627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1240 | Open in IMG/M |
| 3300019789|Ga0137408_1316944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1543 | Open in IMG/M |
| 3300020170|Ga0179594_10012670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica | 2393 | Open in IMG/M |
| 3300025910|Ga0207684_10643619 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300025942|Ga0207689_11304792 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300025961|Ga0207712_10282665 | Not Available | 1355 | Open in IMG/M |
| 3300025961|Ga0207712_10524164 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1016 | Open in IMG/M |
| 3300027056|Ga0209879_1006630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1803 | Open in IMG/M |
| 3300027169|Ga0209897_1040740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 673 | Open in IMG/M |
| 3300027169|Ga0209897_1040976 | Not Available | 671 | Open in IMG/M |
| 3300027277|Ga0209846_1018750 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300027379|Ga0209842_1021104 | Not Available | 1255 | Open in IMG/M |
| 3300027384|Ga0209854_1038882 | Not Available | 806 | Open in IMG/M |
| 3300027384|Ga0209854_1054133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 694 | Open in IMG/M |
| 3300027511|Ga0209843_1008422 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300027527|Ga0209684_1022420 | Not Available | 971 | Open in IMG/M |
| 3300027671|Ga0209588_1148670 | Not Available | 743 | Open in IMG/M |
| 3300027882|Ga0209590_10596317 | Not Available | 711 | Open in IMG/M |
| 3300027882|Ga0209590_11065079 | Not Available | 502 | Open in IMG/M |
| 3300027903|Ga0209488_10594626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300027903|Ga0209488_10619282 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300027907|Ga0207428_10474391 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300027907|Ga0207428_11270485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 511 | Open in IMG/M |
| 3300027957|Ga0209857_1043601 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300028380|Ga0268265_11269776 | Not Available | 736 | Open in IMG/M |
| 3300028828|Ga0307312_10135348 | Not Available | 1554 | Open in IMG/M |
| 3300030516|Ga0268255_10167597 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 640 | Open in IMG/M |
| 3300030619|Ga0268386_10506118 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 825 | Open in IMG/M |
| 3300031093|Ga0308197_10035676 | Not Available | 1200 | Open in IMG/M |
| 3300031114|Ga0308187_10265042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 630 | Open in IMG/M |
| 3300031424|Ga0308179_1003793 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300031679|Ga0318561_10332509 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031720|Ga0307469_10270889 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300031740|Ga0307468_100114349 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300031740|Ga0307468_101054029 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031744|Ga0306918_11404298 | Not Available | 535 | Open in IMG/M |
| 3300031910|Ga0306923_10184926 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 2380 | Open in IMG/M |
| 3300031941|Ga0310912_10538523 | Not Available | 910 | Open in IMG/M |
| 3300031947|Ga0310909_11290026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300031954|Ga0306926_10765958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → unclassified Ktedonobacteraceae → Ktedonobacteraceae bacterium | 1166 | Open in IMG/M |
| 3300032180|Ga0307471_103861814 | Not Available | 530 | Open in IMG/M |
| 3300032782|Ga0335082_10665434 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300034644|Ga0370548_015311 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300034672|Ga0314797_038967 | Not Available | 827 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.88% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 8.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.25% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.62% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.62% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.62% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.62% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_121173402 | 3300000890 | Soil | MGLQIRDDRQMKALTGLSQAQFHHLLPVFSDIYQATQQKTYEEGLTSGMRVRK |
| Ga0066397_100148961 | 3300004281 | Tropical Forest Soil | MEEANRMGLQIRDERQMKALTGLSQDQFDHLLPCFSAIYEAT |
| Ga0066388_1006014261 | 3300005332 | Tropical Forest Soil | MGIQVRDEHHMKAFTGLSQAQCDALVPVFSAIYEATQQQRSAEGVTSG |
| Ga0066388_1006444454 | 3300005332 | Tropical Forest Soil | MGLQIRDERQMPALTGLSPAQFDSLLPVFRDLSQATPQRTYEEGVQSGTRRR |
| Ga0066388_1013652443 | 3300005332 | Tropical Forest Soil | MGLLIRDDRQMKAVTGLSQAQFDHVLPVCTDLYQAAQQQT* |
| Ga0066388_1017224552 | 3300005332 | Tropical Forest Soil | MGRLIRDDRQMKAFTGLSQAQCDPLLPVFSAMDQATQQHT* |
| Ga0066388_1044053622 | 3300005332 | Tropical Forest Soil | VGRHIRDDRQMQALTGLSRAPWDSLLPVFRDLYQATQQPASAGG |
| Ga0066388_1051027532 | 3300005332 | Tropical Forest Soil | MGLLIRDDRQRKALTGLSQAQFDHLLPVFNDLYQAIQHKTYEEGVESGTR |
| Ga0070706_1013119891 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLQIRDDRQMKALTGLSQAQFDQLLSVFRDLYQATQQNTYDAGVESGKVFQSC* |
| Ga0066691_109544271 | 3300005586 | Soil | MGLQIRDNRQRKALTGLSQAQFDHLLPVFSDIYEATQQK |
| Ga0070702_1008789621 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLQIRDDRQMKALTGLSQAQFNHLLPIFSDLYQTTQQKTY |
| Ga0066905_1010961671 | 3300005713 | Tropical Forest Soil | MGLQIRDERQMKALTGLSQAQFDHLLPFFSAIYETTQQKTYAE |
| Ga0066903_1016831152 | 3300005764 | Tropical Forest Soil | MGLQIQDARQMKAFIVLSQAQFDHLLAVFGDIYQAT* |
| Ga0066903_1025982292 | 3300005764 | Tropical Forest Soil | MGLLIRDDRQMKALTGLSQDQFDHLLPVFSAIYQAAQQQTYEKG |
| Ga0074479_106780182 | 3300005829 | Sediment (Intertidal) | MGLQIRDDRQMKALTGLSQEQFDYLLPVFSEISWET |
| Ga0081455_102281472 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGMHIRDDRQMKALTGLSQAQFDHLLPVFNDLYQAIQHKTSEEGVASGTRTRTQ* |
| Ga0075417_100364534 | 3300006049 | Populus Rhizosphere | MGLHIRDERQRKALPGLSQAPCDSLLRVFSDLYRAAQQHA* |
| Ga0075417_106267521 | 3300006049 | Populus Rhizosphere | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDLYRATQQ |
| Ga0075432_105019741 | 3300006058 | Populus Rhizosphere | MGLQIRDDRQMKALTGLSQDQFNHLLPVFSDIYQESIPLI* |
| Ga0066665_111302962 | 3300006796 | Soil | MGLHIRDDRQRQALTGLSQTQCDSLLLAFRGMSLGSQQKTYAAGVESGTRR |
| Ga0066659_102233203 | 3300006797 | Soil | MGLLIRDDRQMKALTGLSQAQFDHLLSVFSDIYRATQQQTYEEGVASGTRR |
| Ga0075428_1001937025 | 3300006844 | Populus Rhizosphere | MGLHIRDDRQMQALTGLSQTQFDYLLLAFRDMYQVSQ |
| Ga0075428_1013076022 | 3300006844 | Populus Rhizosphere | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDIYRATQ |
| Ga0075430_1004853541 | 3300006846 | Populus Rhizosphere | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDLYRATQQQTYE |
| Ga0075430_1009868862 | 3300006846 | Populus Rhizosphere | MGMQIRDERQMKALTGLSQTQFDHLLPVFSDIYQTTQQQTYEKGV* |
| Ga0075433_106056721 | 3300006852 | Populus Rhizosphere | MGLLIRDDRQMKALTGLSQVQFDYLLPVFTDMYQAARQHT* |
| Ga0079215_108422872 | 3300006894 | Agricultural Soil | MGLLMRDNRQMKALTGLSQDQFDFLLPVFSNIYRAAQQKTYEDGVRAGQRK |
| Ga0079216_111067121 | 3300006918 | Agricultural Soil | MGLLIRDNRQMKALTGLSQDQFDDLLPVFSTIYRDAQQKIYEDGVKSGQRKRQPGG |
| Ga0075419_105789942 | 3300006969 | Populus Rhizosphere | MGLQIRDDRQMKALTGLSQAQFDQLLPVFSDLYQGNTAKNV* |
| Ga0066710_1008086463 | 3300009012 | Grasslands Soil | MGLLIRDDRQMKALTGLSQAQFDHLLPVFSDLYQA |
| Ga0099829_100533005 | 3300009038 | Vadose Zone Soil | MGLQIRDDRQRKALTGLSQAQFDPLLSVFSAIYRATQQKTYEAGV |
| Ga0099829_114819801 | 3300009038 | Vadose Zone Soil | MGLQIRDDRQMKALTGLSQAQFDHLLSVFSDVYRTTQQQTYAEGVA |
| Ga0099829_116147712 | 3300009038 | Vadose Zone Soil | MEIQIRDDRQMKALTGLSQAQFDSLLPVFSDIYQA |
| Ga0099829_116966611 | 3300009038 | Vadose Zone Soil | MGMQIRDERQMKALTGLSQAQFDHLLPVFSDIYQTTQQQTYDKGV |
| Ga0099828_103470811 | 3300009089 | Vadose Zone Soil | MGLLIRDDRQMKALTGLSQAQFDHLLPVFSDIYQATQQHTYETGVASGTRRR |
| Ga0099827_100181898 | 3300009090 | Vadose Zone Soil | MGLHIRDDRQMKALTGLSQAQFDHLLSVFSDIYRATQQQTYEEGV |
| Ga0099827_101980591 | 3300009090 | Vadose Zone Soil | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDSYRATQQQTYEEGVQSGTRR |
| Ga0099827_105811013 | 3300009090 | Vadose Zone Soil | MGLQIRDDRQRKALTGLSQAQFDSLLSVFSDIYRATQQKTYEAGVASG |
| Ga0099827_119461792 | 3300009090 | Vadose Zone Soil | MGLQIRDDRQMKALTGLSQAQFDHLLSVFSDLYQATQHNTYEEGVASGTRRRKP |
| Ga0099827_119499282 | 3300009090 | Vadose Zone Soil | MGLQIRDDRQMKALTGLSQAQFDHLLSVFSDIYRATQQQTYEEGV |
| Ga0111539_105588193 | 3300009094 | Populus Rhizosphere | MGMQIRDDRQMKALTGLSQAQFDHLLPVFNDLYQAIQHK |
| Ga0111539_130764942 | 3300009094 | Populus Rhizosphere | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDVYRAAQQQRYEEGSQS |
| Ga0075418_127091111 | 3300009100 | Populus Rhizosphere | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDIYRAAQQQRYEEGS* |
| Ga0114129_104207782 | 3300009147 | Populus Rhizosphere | MGLQIRDDRQMKALTGLSQDQFHHLLPVFSDIYQA |
| Ga0114129_112079841 | 3300009147 | Populus Rhizosphere | MGLHIRDDRQMQALTGLSQTQFDSLLLAFRDMYQVSQQKTY |
| Ga0114129_125131552 | 3300009147 | Populus Rhizosphere | MGLQIRDERQMKALTGLSQAQFDSLLPVFSDIYRATQQ |
| Ga0111538_137214322 | 3300009156 | Populus Rhizosphere | MGLHIRDDRQMQALTGLSQTQFDYLLLAFRDMYQVSQQKTYEEGVESGTRRR |
| Ga0075423_126240841 | 3300009162 | Populus Rhizosphere | MGIQVRDERHMKALTGLSQAQFDDLLSAFSDIYGARQRRHYEEGVASGT |
| Ga0118657_103283211 | 3300009506 | Mangrove Sediment | MAMKIRDERQMKALTGLSPKQFDRLLIEFEQAYQG |
| Ga0114944_12230012 | 3300009691 | Thermal Springs | MGMHIRDDRQMKALTGLSQAQFEHLLPVFNDMYQAAHQKTYA |
| Ga0126374_116063412 | 3300009792 | Tropical Forest Soil | MGLQIRDERQMKALTGLSQAQFAHLLPVFSDLYQTT |
| Ga0105071_10224311 | 3300009808 | Groundwater Sand | MGMQIRDERQMKALTGLSQAQCNHLLPVFSDIYQATQQKTYEKGIESGT |
| Ga0105084_10033332 | 3300009811 | Groundwater Sand | MGLQIRDDRQMKALTGLSQAQFNHLLPVFRDIYRATQQKT |
| Ga0105070_11192012 | 3300009815 | Groundwater Sand | MGLLIRDDRQMKALTGLSQDQFDHLLPVFSAIYQA |
| Ga0105072_10078393 | 3300009818 | Groundwater Sand | MVLQIRDDRQMKALTGLSQAQFDHLLSVFSDIYRATQQQT |
| Ga0105072_11293042 | 3300009818 | Groundwater Sand | MGLQIRDDRQMKALTGLSHAQFDSQLSVFSDIYRATQQQTSEEGVASGTRR |
| Ga0126305_101809391 | 3300010036 | Serpentine Soil | PMGIQVRDERQMQAFTGLSQAQCDDLLPAFSDIYGATQRRH* |
| Ga0126380_102712822 | 3300010043 | Tropical Forest Soil | MGLQMRDDRQMKALTGLSQAQFDHLLPVFRDIYRATQQQ |
| Ga0126310_107533722 | 3300010044 | Serpentine Soil | MGIQVRDERQMQAFTGLSQAQFDDLLPAFSDIYGATQRRH* |
| Ga0126384_112798611 | 3300010046 | Tropical Forest Soil | MGLLIRDDRQMKALTGLSQVQFDHLLPVFSAIYQATQQQTYAQGVASGTRRRKPG |
| Ga0126384_115498482 | 3300010046 | Tropical Forest Soil | MGMQIRDDRQMKALTGLSQAQFDHLLPVFNALYQAT |
| Ga0126382_102139761 | 3300010047 | Tropical Forest Soil | MGLHIRDERQMKALTGLSQAQFDYLLPVFSDIYRATQQHTYEEGSQAGTR |
| Ga0126382_106567331 | 3300010047 | Tropical Forest Soil | MGLLIRDDRQMKALTGLSQVQFDSLLPVFTDIYQAARQHTYEK |
| Ga0134086_100539014 | 3300010323 | Grasslands Soil | VGLQIRDERQMKALTGLSQDQVDHLLPCFSALYESTQHKT* |
| Ga0134065_101184531 | 3300010326 | Grasslands Soil | PVGLQIRDERQMKALTGLSQDQVDHLLPCFSALYESTQHKT* |
| Ga0134080_100148974 | 3300010333 | Grasslands Soil | MGLQIRDERQMKALTGLSQDQVDHLLPCFSALYESTQHKT* |
| Ga0116237_110384762 | 3300010356 | Anaerobic Digestor Sludge | MVIKIRDERQMKALTGLSFAEFERLLPVFTAVYEAQQQRR |
| Ga0126372_121782751 | 3300010360 | Tropical Forest Soil | MGLHIRDERQMKALTGLSQAQFDSLLPVFSDIYRATQQHTYEEGLQ |
| Ga0126377_108586393 | 3300010362 | Tropical Forest Soil | MGLQIRDERQMKALTGLSQAQFDSLLPVFRDIYRA |
| Ga0126377_124850872 | 3300010362 | Tropical Forest Soil | MGMHIRDERQMKAFTDLSPAQCNRLLPVFSDIYQATQQQTYAKGIESGTRR |
| Ga0126379_103143403 | 3300010366 | Tropical Forest Soil | MGLQIRDERQMKALTGLSQAHFDSLLPVFSDIYRATQQQ |
| Ga0134124_121930741 | 3300010397 | Terrestrial Soil | MGLQIRDNRQRKALTGLSQAQFDHLLPFFSDIYEATQQKTYE |
| Ga0124850_10661071 | 3300010863 | Tropical Forest Soil | MGLLIRDDRQMKALTGLSQDQFDHLLPVFSAIYQAAQQQTYEKGQ* |
| Ga0137392_103132151 | 3300011269 | Vadose Zone Soil | MGMQIRDERQMKALTGLSQAQFDRLLPDFSDIYQTAQQQTYEKGVESGTRRR |
| Ga0137388_111453562 | 3300012189 | Vadose Zone Soil | MEIQIRDDRQRKAFTGLSQAQCDSLLPVFSDISRATQHQKSEEGVK |
| Ga0137399_114201702 | 3300012203 | Vadose Zone Soil | MGLQIRDDRQMKALTGLSQAPCDSLRSVFSDLSRATQQKTYEAGGA |
| Ga0137380_107764282 | 3300012206 | Vadose Zone Soil | MGLRIRDDRQMKALTGLSQAQFDHLLPVFSDIYQATQQ |
| Ga0137387_107672191 | 3300012349 | Vadose Zone Soil | MGLQIRDERQMKALTGLSQAQFAHLLPVFSDIYQTTQQQTYEKGVESGTRTRTP |
| Ga0137387_110148522 | 3300012349 | Vadose Zone Soil | MGLHIRDDRQMHALTGLSQTQFDYLLLAFSDMYQVSQQKTYEEGVE |
| Ga0137367_106436762 | 3300012353 | Vadose Zone Soil | MGLHIRDDRQREALTGLSQAQFDHLLPVFSDIYQATQQKTYEG* |
| Ga0137385_112237531 | 3300012359 | Vadose Zone Soil | MGLQMRDDRQMKALTGLSQAPFDHLLPVFSDIYRKTQQQMYEEGVESGTRRRHP |
| Ga0137361_101393635 | 3300012362 | Vadose Zone Soil | MGLQIRDDRQMKALTGLSQDQFDHLLLVFSDIYRTTQQHTY |
| Ga0137361_102009563 | 3300012362 | Vadose Zone Soil | MGLQIRDERQLKALTGLSQAHVDHLLPVFSEVYTEKQQQKY |
| Ga0137361_114264291 | 3300012362 | Vadose Zone Soil | MGLQIRDERQMKALTGLSQDQFDHLLPFFSAIYETAVYE |
| Ga0137390_112765671 | 3300012363 | Vadose Zone Soil | MGLQIRDERQLKALTGLSQAQVDHLLPVFSEVYTAQQQQKYEA |
| Ga0157341_10023041 | 3300012494 | Arabidopsis Rhizosphere | MSSIRDERQRTALTGLSQAQFDSLLPVFSAIYRATQQQTYEEG |
| Ga0157326_10885052 | 3300012513 | Arabidopsis Rhizosphere | MGIQVRDERQMKALTGLSQAQFDDLLPVFSNIYGAMLQQHYEEGVASGT |
| Ga0137397_107209393 | 3300012685 | Vadose Zone Soil | MGLQIRDDRQMTVLTGLSQAQFDHLLPVFSDIYRATQQHTYEEGVQAGTRRRH |
| Ga0137395_101690951 | 3300012917 | Vadose Zone Soil | MGIQVRDERQMKAFTGLSQAQFDDLLPVFSDIYGVTQQQQFPEDDQTQ* |
| Ga0137394_100178291 | 3300012922 | Vadose Zone Soil | MGWQVRDDRQMKALTGLSQAQFDSLLPVFSAIYHATQ |
| Ga0137394_103050282 | 3300012922 | Vadose Zone Soil | MGLQIRDGRQMKALTGLSQDQLDHLVPFFSAIYETTRQKTYTEGV |
| Ga0137404_110285461 | 3300012929 | Vadose Zone Soil | MGLQMRDDRQMKALTGLSQDQFDHLLPFFSALYETTQQKTYAAGVESGTRRRKP |
| Ga0126375_120896011 | 3300012948 | Tropical Forest Soil | MGLQIRDDRQMKALTGLSQDQFDHLLPSFSALYKTTQQKTYAAGVASG |
| Ga0164302_113037411 | 3300012961 | Soil | VGMQIRYDRQMKALTGLSQAQFDALLPVFRDVYQATQQKTSAVGAA |
| Ga0126369_111620961 | 3300012971 | Tropical Forest Soil | MGLLIRDDHQMKALTGLSQVQFDYLLPVFTDIYQAARQHT |
| Ga0163162_101988674 | 3300013306 | Switchgrass Rhizosphere | MGLHIRDERQTKALTGLSQTPFDSLLPVFSDLYRATQQYTYKEGLQSD |
| Ga0137418_103238191 | 3300015241 | Vadose Zone Soil | MGLHIRDDRQMKAFTGLSQAQFAHLLPVFSDIDQTT* |
| Ga0132258_100577141 | 3300015371 | Arabidopsis Rhizosphere | MGLQIRDERQRTALTGLSQAQFDSLLPVFSAIYRAT |
| Ga0132258_100862189 | 3300015371 | Arabidopsis Rhizosphere | MGLQIRDERQRTALTGLSQAQFDSLLPVFSAIYRATQQQTYEE |
| Ga0132258_105803931 | 3300015371 | Arabidopsis Rhizosphere | MGLQIRDDRQIKALTGLSQAQFDHLLSVFSNIYWATQQKTYEGDFSVS* |
| Ga0132258_106588111 | 3300015371 | Arabidopsis Rhizosphere | MGMHIRDERQMKALTGLSQVQFNRLLPVFSDIYQATQQQTYA |
| Ga0132258_116400392 | 3300015371 | Arabidopsis Rhizosphere | MGLQIRDKRQRTALTGLSQAQFDSLLPVFSAIYRATQQQTYEEGLQSG |
| Ga0132257_1006359891 | 3300015373 | Arabidopsis Rhizosphere | MGLQIRDERQMKALTGLSQAQFDSLLPVFSAIYRATQQQTYEEGLQSGTRRR |
| Ga0132257_1028554742 | 3300015373 | Arabidopsis Rhizosphere | MRDERQRTALTGLSQAQFDSLLPVFSAIYRATQQQTYEEGLQ |
| Ga0132255_1006197041 | 3300015374 | Arabidopsis Rhizosphere | MGLQIRDKRQRTALTGLSQAQFDSLLPVFSAIYRATQQQTYEEG |
| Ga0182032_105819822 | 3300016357 | Soil | MGRQIRDERQMKALTGLSQAQFDSLLPVFSDIYRAAQQHAYE |
| Ga0182040_115541821 | 3300016387 | Soil | MGLLIRDDRQMKALTGLSQAQFDFLLPVFSALYQATQQHT |
| Ga0182037_114683922 | 3300016404 | Soil | MGLLIRDDRQMKALTGLSQVQFDHLLPVFSDIYQATQQQTYAKGVE |
| Ga0184619_100736343 | 3300018061 | Groundwater Sediment | MGLQIRDERQLKALTGLSQAHVDHLLPVFSEVYTEKKQQKYV |
| Ga0184637_103011421 | 3300018063 | Groundwater Sediment | MGLQIRDERQLKALTGLSQTQVDHLLPVFSEVYMEKQQQKYAAGVAAGARTRKP |
| Ga0184637_105630422 | 3300018063 | Groundwater Sediment | MEIQIRDDRQMKAFTGLSQAQFDSLLPVFSDIYQATQHKKYEA |
| Ga0184627_100087956 | 3300018079 | Groundwater Sediment | MGVQIRDERQLKALTGLSQAQVDHLLPVFSEVYMENQALW |
| Ga0184627_101487341 | 3300018079 | Groundwater Sediment | VGLQRRDDRQMKALTGLSQAPCDPLLPLFSDLSRATQQHRNEVGVASGTRRRHP |
| Ga0190275_129805442 | 3300018432 | Soil | MGLQIRDERQLKALTGLSHAEFDHLLPVFSEVYTAQQHQ |
| Ga0190268_106650081 | 3300018466 | Soil | EEAKKMGLQIRDERQMKALTGLSQDQFDHLLPFFSAIYEAAQQKT |
| Ga0066662_103592702 | 3300018468 | Grasslands Soil | MGLQIRDDRQMQALTGLSQAQFDHLLSVFSDVYRAT |
| Ga0180117_11736271 | 3300019248 | Groundwater Sediment | MGIQVRDECQMKALTGLSQAQFDRLLPVFSDIYQTTQQQTYAQGIESGTRVRT |
| Ga0137408_13169443 | 3300019789 | Vadose Zone Soil | MGLQIRNERQLKALTGLSQGQFDHLLPVFSDIYLANQQHTYEEGLESGGPKTEAGWWF |
| Ga0179594_100126701 | 3300020170 | Vadose Zone Soil | MGLHIRDDRQMKALTGLSHAQFDHLLPVFNDIYQTTQQQTYEKGVVS |
| Ga0207684_106436191 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLQIRDDRQMKALTGLSQAQFDQLLSVFRDLYQATQQNTYDAGVESGKVFQSC |
| Ga0207689_113047922 | 3300025942 | Miscanthus Rhizosphere | MGLHIRDERQRKALTGLSQAPFDHLLPVFSDLYRATQQ |
| Ga0207712_102826652 | 3300025961 | Switchgrass Rhizosphere | MGLHIRDERQRKALTGLSQAPFDHLLPVFSALYRANPATNI |
| Ga0207712_105241641 | 3300025961 | Switchgrass Rhizosphere | MGLHIRDERQRKALTGLSQAPFDSLLPVFSDLYRATQQYTYKEG |
| Ga0209879_10066301 | 3300027056 | Groundwater Sand | MGLQIRDDRQMKAFTGLSQAQFDHLLPIFSDIYQTTQQKTYRVVPQ |
| Ga0209897_10407402 | 3300027169 | Groundwater Sand | MGLQIRDDRQMKALTGLSQDQFDHLLPFFSALYETTQQKMYAEGVESGTRR |
| Ga0209897_10409762 | 3300027169 | Groundwater Sand | MGLLIRDDRQMKALTGLSQAQFDHLLPFFRDIYEATQQKTYEEEVE |
| Ga0209846_10187501 | 3300027277 | Groundwater Sand | MGLQIRDDRQMKAFTGLSQAQFDHLLPIFSDIYQTTQQKTY |
| Ga0209842_10211041 | 3300027379 | Groundwater Sand | MGLQIRDDRQRKAFTGLSQAQFDHLLPIFSDIDQTTQQK |
| Ga0209854_10388821 | 3300027384 | Groundwater Sand | MGLQIRDDRQMKALTGLSQAQFDHLLPVFRDIYRATQQQTYEE |
| Ga0209854_10541331 | 3300027384 | Groundwater Sand | MGLLIRDDRQMKALTGLSQAQFDHLLPVFSDLYQATQQHTYDTGVA |
| Ga0209843_10084223 | 3300027511 | Groundwater Sand | MGLLIRDDRQMKALTGLSQAQFDHLLPIFSDIYQTTQQKTYEDGVKSGTRRRQ |
| Ga0209684_10224202 | 3300027527 | Tropical Forest Soil | MGLLIRDDRQMKALTGLSQAQFDHLLPVFSDLYPD |
| Ga0209588_11486702 | 3300027671 | Vadose Zone Soil | MGLQIRDERQMKALTGLSQAQFDHLLPVFSDIYRKTQQQMYEEGVESGTRR |
| Ga0209590_105963172 | 3300027882 | Vadose Zone Soil | MGLQIRDDRQRKALTGLSQAQFDPLLSVFSAIYRATQQKTYEAGVA |
| Ga0209590_110650791 | 3300027882 | Vadose Zone Soil | MGLLIRDDRQMKALTGLSHAQFDHLLPVFSDIYQATQQHTYATGVASGT |
| Ga0209488_105946261 | 3300027903 | Vadose Zone Soil | MGMLIRDDRQMKALTGLSQDQFDPLLPVFSDIYQATQQ |
| Ga0209488_106192821 | 3300027903 | Vadose Zone Soil | MGLQIRDDRQMKALTGLSQAQFDHLLSVFSDIYRATQQQTYEEGVEA |
| Ga0207428_104743911 | 3300027907 | Populus Rhizosphere | MGLHMRDDRQMKALTGLSQAQFDHLLPVFRDIYRAT |
| Ga0207428_112704851 | 3300027907 | Populus Rhizosphere | MGLHIRDDRQMQALTGLSQTQFDYLLLAFRDMYQVS |
| Ga0209857_10436012 | 3300027957 | Groundwater Sand | MGLHIRDERQLKALTGLSQAQVDHLLPVFSEVYTEQQQQKYAEGVAS |
| Ga0268265_112697761 | 3300028380 | Switchgrass Rhizosphere | MGLHIRDDRQMQALTGVSQTQCDSLLLAFRDMYQVSQQKTY |
| Ga0307312_101353482 | 3300028828 | Soil | MGLHIRDDRQMQALTGLSQAQFDHLLSVFSDLYQATQQNTYEEGIES |
| Ga0268255_101675972 | 3300030516 | Agave | MGLHIRDDRQMQALTGLSQTQFDSLLLAFRDMYQVSQQKTYEEG |
| Ga0268386_105061182 | 3300030619 | Soil | MGLVIRDDRQMKALTGLSQAQFDQLLPVFESTYQATQQQAYDPNFARL |
| Ga0308197_100356762 | 3300031093 | Soil | MGRHIRDDRQMKAFTGLSQAQLDHLLPVFSDIYEATQQKAYEK |
| Ga0308187_102650421 | 3300031114 | Soil | MGMLIRDDRQMKALTGLSQAQFAHLLPVFSEIYQITQQQTYEKGVEAGTRRRK |
| Ga0308179_10037931 | 3300031424 | Soil | MGRHIRDDRQMKAFTGLSQAQLDHLLPVFSDIYEATQQKAYEKGVESGTRTREPG |
| Ga0318561_103325091 | 3300031679 | Soil | MGIPVRDERHMKALTGLSQAQFDDLLSAFSDIYGAT |
| Ga0307469_102708892 | 3300031720 | Hardwood Forest Soil | MGIQVRDERHMKALTGLSQAQFDDLLPAFSDLYGA |
| Ga0307468_1001143491 | 3300031740 | Hardwood Forest Soil | MGMQIRDDRQMKALTGLSQAQFDHLLPVFNDLYQAIQH |
| Ga0307468_1010540291 | 3300031740 | Hardwood Forest Soil | MGMQIRDERQMKALTGLSQAQFDRLLPVFSDIYQTTQQQTYEQGIESGTRVRT |
| Ga0306918_114042982 | 3300031744 | Soil | MGLQIRDDRQMKALTGLSQVQFDYLLPYFSTIYASTQQKTYVEGVAA |
| Ga0306923_101849263 | 3300031910 | Soil | MGRQIRDERQMKALTGLSQAQFDSLLPVFRDIYRATQQQTYEAGLQSGTR |
| Ga0310912_105385231 | 3300031941 | Soil | MGIPVRDERHMKALTGLSQAQFDDLLSAFSDIYGATQRRHDEEGV |
| Ga0310909_112900261 | 3300031947 | Soil | MGIHVRDERHMQALTGLSQAQFDDLWSAFSDLDGAT |
| Ga0306926_107659581 | 3300031954 | Soil | MGLQIRDERQRKALTGLSQAQFDSLLPVFSDIYRAAQQQRYE |
| Ga0307471_1038618142 | 3300032180 | Hardwood Forest Soil | MGLHIRDDRQMQALTGLSQTQFDYLLLAFRDMYQVSQQKTYEEG |
| Ga0335082_106654342 | 3300032782 | Soil | MGLHSRDDRQMKAVPGLSPAQCDPLLSVFSDVDQTMQ |
| Ga0370548_015311_1002_1109 | 3300034644 | Soil | MRDERQMKALTGLSQAQFDYLLPVFSDIYQATQQKT |
| Ga0314797_038967_3_164 | 3300034672 | Soil | MGLLIRDDRQMKALTGLSQAQFDHLLPVFSAIYQAAQQQTYEKGVESGTRWRKP |
| ⦗Top⦘ |